Advanced Search (OLGA)

Gene: Ppp2cb (protein phosphatase 2 catalytic subunit beta) Rattus norvegicus

Analyze

Symbol:

Ppp2cb

Name:

protein phosphatase 2 catalytic subunit beta

RGD ID:

3381

Description:

Enables protein serine/threonine phosphatase activity and transmembrane transporter binding activity. Involved in several processes, including negative regulation of Ras protein signal transduction; regulation of microtubule polymerization; and response to lead ion. Predicted to be located in cytoplasm. Predicted to be part of FAR/SIN/STRIPAK complex and protein phosphatase type 2A complex. Predicted to be active in cytosol. Orthologous to human PPP2CB (protein phosphatase 2 catalytic subunit beta); PARTICIPATES IN dopamine signaling pathway; phosphatidylinositol 3-kinase-Akt signaling pathway; transforming growth factor-beta Smad dependent signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

MGC94855; PP2A-beta; Pp2a2; Protein phosphatase 2 (formerly 2A) catalytic subunit beta isoform; protein phosphatase 2 (formerly 2A), catalytic subunit, beta isoform; protein phosphatase 2, catalytic subunit, beta isoform; protein phosphatase 2, catalytic subunit, beta isozyme; protein phosphatase 2A catalytic alpha subunit; protein phosphatase 2a, catalytic subunit, beta isoform; protein phosphatase-2A-beta; serine/threonine-protein phosphatase 2A catalytic subunit beta isoform

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	65,261,178 - 65,282,658 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	16	65,261,181 - 65,282,634 (-)	Ensembl				GRCr8
mRatBN7.2	16	58,558,119 - 58,579,325 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	58,558,122 - 58,579,576 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	16	63,895,707 - 63,916,635 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	67,309,372 - 67,330,300 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	62,529,938 - 62,550,866 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	62,273,276 - 62,294,767 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	62,273,276 - 62,294,769 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	16	61,933,984 - 61,955,475 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	16	62,330,513 - 62,351,968 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	16	56,594,208 - 56,615,135 (-)	NCBI		Celera
RGSC_v3.1	16	62,330,587 - 62,352,043 (-)	NCBI
Cytogenetic Map	16	q12.3	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17beta-hydroxy-5alpha-androstan-3-one (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

5-aza-2'-deoxycytidine (ISO)

5-fluorouracil (ISO)

acrylamide (ISO)

ammonium chloride (EXP)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (ISO)

atrazine (ISO)

beta-lapachone (ISO)

bexarotene (EXP)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bufalin (ISO)

cadmium dichloride (EXP)

chlorpyrifos (ISO)

clozapine (EXP)

cobalt dichloride (ISO)

cocaine (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

crocidolite asbestos (ISO)

cyclosporin A (ISO)

diarsenic trioxide (ISO)

diazinon (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP)

dichlorine (EXP)

Echimidine (ISO)

enniatin (EXP)

ethanol (ISO)

ethyl methanesulfonate (ISO)

fenthion (ISO)

finasteride (EXP)

flavonoids (EXP)

flutamide (EXP)

gentamycin (EXP)

haloperidol (EXP)

hydrogen peroxide (ISO)

ionomycin (ISO)

ivermectin (ISO)

ketoconazole (EXP)

Lasiocarpine (ISO)

lead(0) (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

menadione (ISO)

methidathion (ISO)

methotrexate (ISO)

methyl methanesulfonate (ISO)

miconazole (EXP)

monocrotaline (ISO)

Morroniside (ISO)

N-methyl-4-phenylpyridinium (ISO)

nefazodone (EXP)

nickel atom (ISO)

niclosamide (ISO)

nitrates (ISO)

nitroglycerin (EXP)

obeticholic acid (ISO)

okadaic acid (ISO)

ozone (EXP)

paracetamol (ISO)

paraquat (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (ISO)

phorbol 13-acetate 12-myristate (ISO)

pirinixic acid (ISO)

potassium chromate (ISO)

pregnenolone 16alpha-carbonitrile (EXP)

riddelliine (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (ISO)

sulindac (EXP)

tert-butyl hydroperoxide (ISO)

tetrachloromethane (EXP,ISO)

tetrahydropalmatine (ISO)

thioacetamide (EXP)

thiram (ISO)

titanium dioxide (ISO)

trichloroethene (ISO)

tunicamycin (ISO)

zinc atom (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

apoptotic mitochondrial changes (IEA,ISO)

mitotic cell cycle (IBA)

negative regulation of canonical NF-kappaB signal transduction (IEA,ISO)

negative regulation of gene expression (IEA,ISO)

negative regulation of Ras protein signal transduction (IDA)

negative regulation of tumor necrosis factor-mediated signaling pathway (IEA,ISO)

proteasome-mediated ubiquitin-dependent protein catabolic process (IEA,ISO)

protein dephosphorylation (IDA)

regulation of gene expression (IEA,ISO)

regulation of microtubule polymerization (IMP)

response to antibiotic (IEA,ISO)

response to endoplasmic reticulum stress (IEA,ISO)

response to hydrogen peroxide (IEA,ISO)

response to lead ion (IDA)

Cellular Component

chromosome (IEA)

chromosome, centromeric region (IEA)

cytoplasm (IEA,ISO)

cytoskeleton (IEA)

cytosol (IBA)

FAR/SIN/STRIPAK complex (IEA,ISO,ISS)

nucleus (IEA)

protein phosphatase type 2A complex (IEA,ISO)

spindle pole (IEA)

Molecular Function

hydrolase activity (IEA)

metal ion binding (IEA)

phosphoprotein phosphatase activity (IDA,IEA)

protein binding (ISO)

protein heterodimerization activity (ISS)

protein serine/threonine phosphatase activity (IBA,IDA,IEA,IMP)

transmembrane transporter binding (IPI)

Molecular Pathway Annotations Click to see Annotation Detail View

Chagas disease pathway (IEA)

dopamine signaling pathway (ISO)

hepatitis C pathway (IEA)

long term depression (IEA)

mRNA decay pathway (IEA)

phosphatidylinositol 3-kinase-Akt signaling pathway (ISO)

transforming growth factor-beta Smad dependent signaling pathway (ISO)

transforming growth factor-beta superfamily mediated signaling pathway (IEA)

Wnt signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Regulation of phosphorylation of neuronal microtubule-associated proteins MAP1b and MAP2 by protein phosphatase-2A and -2B in rat brain.	Gong CX, etal., Brain Res. 2000 Jan 24;853(2):299-309.
3.	Binding of protein phosphatase 2A to the L-type calcium channel Cav1.2 next to Ser1928, its main PKA site, is critical for Ser1928 dephosphorylation.	Hall DD, etal., Biochemistry. 2006 Mar 14;45(10):3448-59.
4.	Molecular cloning of rat phosphoprotein phosphatase 2A beta cDNA and increased expressions of phosphatase 2A alpha and 2A beta in rat liver tumors.	Kitagawa Y, etal., Biochem Biophys Res Commun 1988 Dec 15;157(2):821-7.
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	Regulation of protein phosphatase 2A catalytic activity by alpha4 protein and its yeast homolog Tap42.	Nanahoshi M, etal., Biochem Biophys Res Commun. 1998 Oct 20;251(2):520-6.
7.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
9.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
10.	Over activation of hippocampal serine/threonine protein phosphatases PP1 and PP2A is involved in lead-induced deficits in learning and memory in young rats.	Rahman A, etal., Neurotoxicology. 2012 Jun;33(3):370-83. doi: 10.1016/j.neuro.2012.02.014. Epub 2012 Mar 1.
11.	GOA pipeline	RGD automated data pipeline
12.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
13.	Production of shorter mRNA for protein phosphatase 2A beta by alternative poly(A) addition.	Sasaki K, etal., Biochem Biophys Res Commun 1990 Jul 16;170(1):169-75.
14.	Phosphatase: PP2A structural importance, regulation and its aberrant expression in cancer.	Seshacharyulu P, etal., Cancer Lett. 2013 Jul 10;335(1):9-18. doi: 10.1016/j.canlet.2013.02.036. Epub 2013 Feb 20.
15.	Protein phosphatase 2A forms a molecular complex with Shc and regulates Shc tyrosine phosphorylation and downstream mitogenic signaling.	Ugi S, etal., Mol Cell Biol 2002 Apr;22(7):2375-87.
16.	DARPP-32, Jack of All Trades... Master of Which?	Yger M and Girault JA, Front Behav Neurosci. 2011 Sep 8;5:56. doi: 10.3389/fnbeh.2011.00056. eCollection 2011.

Additional References at PubMed

PMID:2174876	PMID:2554256	PMID:10781942	PMID:12477932	PMID:12716901	PMID:15375154	PMID:15489334	PMID:16717086	PMID:16875859	PMID:17085438	PMID:17906371	PMID:18245083
PMID:22871113	PMID:23349830	PMID:23376485	PMID:30361391

Genomics

Comparative Map Data

Ppp2cb
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	65,261,178 - 65,282,658 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	16	65,261,181 - 65,282,634 (-)	Ensembl				GRCr8
mRatBN7.2	16	58,558,119 - 58,579,325 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	58,558,122 - 58,579,576 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	16	63,895,707 - 63,916,635 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	67,309,372 - 67,330,300 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	62,529,938 - 62,550,866 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	62,273,276 - 62,294,767 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	62,273,276 - 62,294,769 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	16	61,933,984 - 61,955,475 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	16	62,330,513 - 62,351,968 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	16	56,594,208 - 56,615,135 (-)	NCBI		Celera
RGSC_v3.1	16	62,330,587 - 62,352,043 (-)	NCBI
Cytogenetic Map	16	q12.3	NCBI

PPP2CB
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	8	30,785,616 - 30,812,818 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	8	30,774,457 - 30,814,314 (-)	Ensembl			hg38	GRCh38
GRCh37	8	30,643,132 - 30,670,334 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	8	30,762,668 - 30,789,894 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	8	30,762,668 - 30,789,894	NCBI
Celera	8	29,603,219 - 29,630,439 (-)	NCBI		Celera
Cytogenetic Map	8	p12	NCBI
HuRef	8	29,189,574 - 29,216,794 (-)	NCBI		HuRef
CHM1_1	8	30,844,570 - 30,871,782 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	8	31,066,636 - 31,093,832 (-)	NCBI		T2T-CHM13v2.0

Ppp2cb
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	34,089,672 - 34,109,831 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	34,089,653 - 34,109,469 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	8	33,599,621 - 33,619,804 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	33,599,625 - 33,619,441 (+)	Ensembl			mm10	GRCm38
MGSCv37	8	34,710,093 - 34,730,276 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	8	35,065,560 - 35,085,738 (+)	NCBI		MGSCv36	mm8
Celera	8	36,244,600 - 36,253,763 (+)	NCBI		Celera
Cytogenetic Map	8	A4	NCBI
cM Map	8	20.63	NCBI

Ppp2cb
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955463	7,226,912 - 7,249,490 (-)	Ensembl
ChiLan1.0	NW_004955463	7,229,717 - 7,249,490 (-)	NCBI	ChiLan1.0	ChiLan1.0

PPP2CB
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	7	49,358,884 - 49,386,294 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	8	25,074,866 - 25,102,081 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	8	30,099,605 - 30,126,917 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	8	27,288,250 - 27,302,606 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	8	27,288,263 - 27,302,606 (-)	Ensembl			panPan2	panpan1.1

PPP2CB
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	16	33,532,703 - 33,567,011 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	16	33,532,958 - 33,566,640 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	16	33,992,179 - 34,026,212 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	16	35,558,843 - 35,592,945 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	16	35,558,838 - 35,592,943 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	16	33,657,510 - 33,691,593 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	16	34,231,924 - 34,265,951 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	16	34,350,519 - 34,384,589 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Ppp2cb
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404943	56,729,981 - 56,742,299 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936792	622,166 - 633,335 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936792	622,105 - 633,800 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PPP2CB
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	15	54,296,113 - 54,325,213 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	15	54,295,786 - 54,325,220 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	15	61,676,897 - 61,697,557 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PPP2CB
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	8	28,903,074 - 28,930,300 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	8	28,903,240 - 28,930,376 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666052	13,168,625 - 13,195,901 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ppp2cb
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624780	13,332,636 - 13,369,301 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Variants

Variants in Ppp2cb
157 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	99
Count of miRNA genes:	76
Interacting mature miRNAs:	92
Transcripts:	ENSRNOT00000020663
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2300163	Bmd64	Bone mineral density QTL 64	5.3	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	16	37752156	82752156	Rat
1600378	Arunc4	Aerobic running capacity QTL 4		0.03	exercise endurance trait (VT:0002332)	longest distance run on treadmill (CMO:0001406)	16	380245	80345693	Rat
70215	Niddm29	Non-insulin dependent diabetes mellitus QTL 29	3.54		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	16	19004435	75226532	Rat
1578768	Stresp22	Stress response QTL 22	2.8		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	16	35288870	80288870	Rat
737826	Alc11	Alcohol consumption QTL 11	3.2		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	16	4227609	60252231	Rat
2302057	Pia29	Pristane induced arthritis QTL 29	3.6	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111)	16	21735975	66735975	Rat
7205510	Activ5	Activity QTL 5	3.78	0.00028	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	16	42396345	84729064	Rat
631525	Pia14	Pristane induced arthritis QTL 14	4.4		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	16	55711087	83402471	Rat
8694453	Bw172	Body weight QTL 172	8.33	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	16	24325513	69325513	Rat
7411648	Foco22	Food consumption QTL 22	15	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	16	52726464	84729064	Rat
1298529	Arunc1	Aerobic running capacity QTL 1	4		exercise endurance trait (VT:0002332)	longest distance run on treadmill (CMO:0001406)	16	31951520	60148445	Rat
2312663	Slep9	Serum leptin concentration QTL 9		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	16	832236	59492508	Rat
2312660	Bw95	Body weight QTL 95		0.05	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	16	832236	59492508	Rat
6903294	Stl30	Serum triglyceride level QTL 30	2.6	0.0013	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	16	25152793	70152793	Rat
2293690	Bss45	Bone structure and strength QTL 45	5.13	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	16	37752156	82752156	Rat
8694364	Abfw7	Abdominal fat weight QTL 7	12.22	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	16	52726464	84729064	Rat
2312666	Insul16	Insulin level QTL 16		0.01	blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	16	832236	59492508	Rat
8694429	Bw164	Body weight QTL 164	5	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	16	52726464	84729064	Rat
70205	Gcr3	Gastric cancer resistance QTL 3	2.3		stomach morphology trait (VT:0000470)	stomach tumor diameter (CMO:0001889)	16	17696791	82635055	Rat
2312669	Stl23	Serum triglyceride level QTL 23		0.01	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	16	832236	59492508	Rat

Markers in Region

RH127900

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	16	58,558,146 - 58,558,353 (+)	MAPPER	mRatBN7.2
Rnor_6.0	16	62,273,301 - 62,273,507	NCBI	Rnor6.0
Rnor_5.0	16	61,934,009 - 61,934,215	UniSTS	Rnor5.0
RGSC_v3.4	16	62,330,538 - 62,330,744	UniSTS	RGSC3.4
Celera	16	56,594,233 - 56,594,439	UniSTS
RH 3.4 Map	16	542.31	UniSTS
Cytogenetic Map	16	q12.3	UniSTS

BF397059

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	16	58,569,971 - 58,570,146 (+)	MAPPER	mRatBN7.2
Rnor_6.0	16	62,285,126 - 62,285,300	NCBI	Rnor6.0
Rnor_5.0	16	61,945,834 - 61,946,008	UniSTS	Rnor5.0
RGSC_v3.4	16	62,342,363 - 62,342,537	UniSTS	RGSC3.4
Celera	16	56,606,056 - 56,606,230	UniSTS
RH 3.4 Map	16	542.9	UniSTS
Cytogenetic Map	16	q12.3	UniSTS

UniSTS:235869

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	16	58,558,404 - 58,558,590 (+)	MAPPER	mRatBN7.2
Rnor_6.0	16	62,273,559 - 62,273,744	NCBI	Rnor6.0
Rnor_5.0	16	61,934,267 - 61,934,452	UniSTS	Rnor5.0
RGSC_v3.4	16	62,330,796 - 62,330,981	UniSTS	RGSC3.4
Celera	16	56,594,491 - 56,594,676	UniSTS
Cytogenetic Map	16	q12.3	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_017040	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063275055	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC085926	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473970	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ225122	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229111	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ231171	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000016	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M23591	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M58439	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X14087	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000020663 ⟹ ENSRNOP00000020663

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	16	65,261,181 - 65,282,634 (-)	Ensembl
mRatBN7.2 Ensembl	16	58,558,122 - 58,579,576 (-)	Ensembl
Rnor_6.0 Ensembl	16	62,273,276 - 62,294,769 (-)	Ensembl

RefSeq Acc Id:

NM_017040 ⟹ NP_058736

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	65,261,178 - 65,282,383 (-)	NCBI
mRatBN7.2	16	58,558,119 - 58,579,325 (-)	NCBI
Rnor_6.0	16	62,273,276 - 62,294,767 (-)	NCBI
Rnor_5.0	16	61,933,984 - 61,955,475 (-)	NCBI
RGSC_v3.4	16	62,330,513 - 62,351,968 (-)	RGD
Celera	16	56,594,208 - 56,615,135 (-)	RGD

Sequence:

show sequence

GGCACGAGCGCCGAGAGAACCGCGGCCAGAGCGCGGAGAGGCCTGCGGGCGGCGACGGCAGCGG
GAGGGCGGGCGCCGTCGGGCCGGAGCCTCCCCCGAGCCGCGCCGCGCTCTGGCTCCGAGCCGTG
AGCCCTTTTTGCCGCGCCCCGAGCGCGTGGCCGGGGGCCGGGCGGGGCGGGCGCTCCCGGAGGC
CGGGGCCGGCGGCTGCCCGCTGGGCTTGGGCGGGGCGCGGGCTGCCCGCTCCGCGGCTCGGTGG
TCCCGCCGGGGGCCGGCGGCGGGGGAGGCGGCGGGGACGCGCGGCTCGCCGCCATGGACGACAA
GGCGTTCACCAAGGAGCTGGACCAGTGGGTGGAGCAGCTGAACGAGTGTAAGCAGCTGAACGAG
AACCAAGTGCGGACGCTGTGCGAGAAGGCTAAGGAAATTTTAACAAAAGAATCAAATGTACAAG
AGGTTCGCTGTCCTGTTACCGTCTGTGGAGATGTGCATGGCCAATTCCATGACCTTATGGAACT
CTTCAGAATTGGTGGAAAATCACCAGACACCAACTATCTATTCATGGGTGACTATGTAGACAGA
GGATATTATTCTGTGGAGACCGTGACTCTTCTTGTAGCATTAAAGGTGCGCTATCCAGAGCGTA
TCACAATATTGCGAGGAAATCATGAAAGCCGGCAGATCACACAAGTATATGGCTTTTATGATGA
ATGCCTACGAAAGTATGGGAACGCCAACGTGTGGAAATACTTTACAGATCTCTTTGATTATCTT
CCACTTACAGCTTTAGTAGATGGACAGATATTCTGCCTCCACGGTGGCCTCTCTCCATCCATAG
ATACACTGGATCACATAAGAGCCCTGGATCGCTTACAGGAAGTTCCACATGAGGGCCCAATGTG
TGATCTCTTATGGTCAGATCCAGATGACCGTGGTGGCTGGGGCATTTCTCCACGTGGTGCTGGC
TACACATTTGGACAAGACATTTCTGAAACATTTAACCATGCCAACGGCCTCACACTGGTGTCCC
GTGCTCACCAGCTTGTAATGGAAGGATATAATTGGTGCCATGATCGGAATGTGGTCACCATTTT
TAGTGCACCCAATTACTGCTACCGCTGTGGGAACCAGGCTGCTATCATGGAATTAGACGACACT
TTAAAATACTCTTTTCTTCAGTTTGACCCAGCACCTCGTCGTGGAGAGCCTCATGTGACCCGGC
GCACCCCAGACTACTTCCTATAAATTCCTCCCCAGGACCTGTCTTTGTATGTTGAAGTATACCT
GGCTTTTTAAAAAATATATATACATATATATATTTAAAAACAACAGTTATCTGTGTGTCTCTGT
AACAAATTGTGCTATGTCTTGACGTTAAAACACATCATGGACCAAAACGTGCCATACTAATGGT
GAGCCATCAGCACGGTGTGAACTTGAGTCCACTGTCCTAGCCGAGTCAACCAGGCAGCCGCCTG
CCCGCCTGCCTGCTGTAGTAGCCGTCCTTCGTGACTGGTTAAGGGAAAGGGTCACTGGTGGCTT
CATCTCCTTTGCGCTTACTTGGAAATTTAGTTACAAGTTTAACTGGCATGGATTATAGAGTTGG
AGTTTTATTTTTAAGAATTGACAAGCTGACTTCCACTTAAATTCATAACCCTTTATTTTGTTGA
AATGTATGACTAACTGAAGAAGAGATTCTTGGAGTATGTTGTCATAACACTAAGATTTCCTTTC
AAGTTTCCTGAACTGAATTACTGTTGGATGTTGACCTGCACATTCTGTATATTTGTCCTGACAG
TGTTGCATCCTCCTTGCTGTACTGAACAAATAAACTTCCCAATTTAGAGAG

hide sequence

RefSeq Acc Id:

XM_063275055 ⟹ XP_063131125

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	65,261,178 - 65,282,658 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_058736	(Get FASTA)	NCBI Sequence Viewer
	XP_063131125	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA41912	(Get FASTA)	NCBI Sequence Viewer
	AAA41913	(Get FASTA)	NCBI Sequence Viewer
	AAH85926	(Get FASTA)	NCBI Sequence Viewer
	CAA32249	(Get FASTA)	NCBI Sequence Viewer
	EDM09140	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000020663
	ENSRNOP00000020663.1
GenBank Protein	P62716	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_058736 ⟸ NM_017040

- UniProtKB:

Q6LDK0 (UniProtKB/Swiss-Prot), P62716 (UniProtKB/Swiss-Prot), A0A8I5ZZ39 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MDDKAFTKELDQWVEQLNECKQLNENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHD
LMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHESRQITQVYG
FYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHE
GPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNV
VTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL

hide sequence

Ensembl Acc Id:

ENSRNOP00000020663 ⟸ ENSRNOT00000020663

RefSeq Acc Id:	XP_063131125 ⟸ XM_063275055
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I5ZZ39 (UniProtKB/TrEMBL)

Protein Domains

Serine/threonine specific protein phosphatases

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P62716-F1-model_v2	AlphaFold	P62716	1-309	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3381	AgrOrtholog
BioCyc Gene	G2FUF-11118	BioCyc
Ensembl Genes	ENSRNOG00000015182	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000020663	ENTREZGENE
	ENSRNOT00000020663.4	UniProtKB/Swiss-Prot
Gene3D-CATH	3.60.21.10	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7109733	IMAGE-MGC_LOAD
InterPro	Calcineurin-like_PHP_ApaH	UniProtKB/Swiss-Prot
	Metallo-depent_PP-like	UniProtKB/Swiss-Prot
	PPA2-like	UniProtKB/Swiss-Prot
	Ser/Thr-sp_prot-phosphatase	UniProtKB/Swiss-Prot
KEGG Report	rno:24673	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:94855	IMAGE-MGC_LOAD
NCBI Gene	24673	ENTREZGENE
PANTHER	SERINE/THREONINE-PROTEIN PHOSPHATASE PP2A-RELATED	UniProtKB/Swiss-Prot
Pfam	Metallophos	UniProtKB/Swiss-Prot
PhenoGen	Ppp2cb	PhenoGen
PRINTS	STPHPHTASE	UniProtKB/Swiss-Prot
PROSITE	SER_THR_PHOSPHATASE	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000015182	RatGTEx
SMART	PP2Ac	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF56300	UniProtKB/Swiss-Prot
UniProt	A0A8I5ZZ39	ENTREZGENE, UniProtKB/TrEMBL
	A6IVT2_RAT	UniProtKB/TrEMBL
	P62716	ENTREZGENE, UniProtKB/Swiss-Prot
	Q6LDK0	ENTREZGENE
UniProt Secondary	P11082	UniProtKB/Swiss-Prot
	Q6LDK0	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-02-17	Ppp2cb	protein phosphatase 2 catalytic subunit beta	Ppp2cb	protein phosphatase 2, catalytic subunit, beta isozyme	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-06-26	Ppp2cb	protein phosphatase 2, catalytic subunit, beta isozyme	Ppp2cb	protein phosphatase 2, catalytic subunit, beta isoform	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2010-04-23	Ppp2cb	protein phosphatase 2, catalytic subunit, beta isoform	Ppp2cb	protein phosphatase 2 (formerly 2A), catalytic subunit, beta isoform	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Ppp2cb	protein phosphatase 2 (formerly 2A), catalytic subunit, beta isoform		protein phosphatase 2a, catalytic subunit, beta isoform	Name updated	1299863	APPROVED
2002-06-10	Ppp2cb	Protein phosphatase 2 (formerly 2A), catalytic subunit, beta isoform			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_physical_interaction	forms complex with Shc by interacting with Shc PTB domain	729591

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Send us a Message

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)