Mbl1 (mannose binding lectin 1) - Rat Genome Database

Name: Mbl1
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Advanced Search (OLGA)

Gene: Mbl1 (mannose binding lectin 1) Rattus norvegicus

Analyze

Symbol:

Mbl1

Name:

mannose binding lectin 1

RGD ID:

3055

Description:

Enables several functions, including D-mannose binding activity; calcium-dependent carbohydrate binding activity; and phosphatidylinositol-4-phosphate binding activity. Involved in complement activation, lectin pathway and protein homotrimerization. Located in extracellular space. Orthologous to human MBL1P (mannose binding lectin 1, pseudogene); PARTICIPATES IN coagulation cascade pathway; complement system pathway; phagocytosis pathway; INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

mannan-binding protein; mannose binding lectin (A); mannose binding lectin 1, protein A; mannose binding lectin 2, protein C; Mannose binding protein A serum; Mannose binding protein A, serum; mannose-binding lectin (protein A) 1; mannose-binding protein A; MBP-A; Mbpa; Mlb1

RGD Orthologs

Human

Mouse

Alliance Orthologs

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	17,063,232 - 17,069,271 (+)	NCBI		GRCr8
mRatBN7.2	16	17,029,146 - 17,035,187 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	17,029,118 - 17,035,174 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	16	17,093,376 - 17,099,473 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	18,221,699 - 18,227,754 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	17,146,274 - 17,152,371 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	18,736,154 - 18,742,193 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	18,736,154 - 18,742,193 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	18,604,750 - 18,610,789 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	16	17,591,820 - 17,597,859 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	16	17,591,817 - 17,597,857 (+)	NCBI
Celera	16	17,254,917 - 17,260,956 (+)	NCBI		Celera
RH 3.4 Map	16	167.5	RGD
Cytogenetic Map	16	p14	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

aspergillosis (ISO)

herpes simplex (ISO)

Kawasaki disease (ISO)

Myocardial Reperfusion Injury (IDA,IMP,ISO)

obesity (ISO)

Reperfusion Injury (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(1->4)-beta-D-glucan (ISO)

1,1-dichloroethene (ISO)

1,2-dichloroethane (ISO)

17alpha-ethynylestradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

3H-1,2-dithiole-3-thione (EXP)

aflatoxin B1 (ISO)

ammonium chloride (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

butanal (ISO)

clofibric acid (EXP)

copper atom (EXP)

copper(0) (EXP)

cyclosporin A (ISO)

diclofenac (ISO)

endosulfan (EXP)

epoxiconazole (ISO)

felbamate (EXP)

fipronil (ISO)

fumonisin B1 (ISO)

genistein (ISO)

gentamycin (EXP)

gliotoxin (EXP)

glyphosate (EXP)

indometacin (EXP)

lead(0) (ISO)

lipopolysaccharide (ISO)

mercury dichloride (EXP)

N,N-diethyl-m-toluamide (ISO)

N-nitrosodiethylamine (EXP,ISO)

nefazodone (EXP)

ozone (ISO)

paracetamol (EXP,ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP)

phenobarbital (EXP)

phenytoin (EXP)

pirinixic acid (EXP,ISO)

rotenone (EXP)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

silicon dioxide (ISO)

silver atom (ISO)

silver(0) (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

titanium dioxide (EXP)

trichloroethene (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

complement activation, classical pathway (IEA)

complement activation, lectin pathway (IDA,ISO)

defense response to Gram-positive bacterium (ISO)

killing by host of symbiont cells (ISO)

positive regulation of phagocytosis (IBA,ISO)

protein homotrimerization (IDA)

surfactant homeostasis (IBA)

Cellular Component

collagen trimer (IEA)

extracellular space (IBA,IDA,ISO)

multivesicular body (IBA)

Molecular Function

calcium ion binding (IDA)

calcium-dependent carbohydrate binding (IDA)

calcium-dependent protein binding (IPI)

D-mannose binding (IDA)

identical protein binding (IPI)

oligosaccharide binding (IDA)

phosphatidylinositol-4-phosphate binding (IDA)

polysaccharide binding (IDA)

protease binding (IDA)

protein binding (IPI)

protein homodimerization activity (IPI)

Molecular Pathway Annotations Click to see Annotation Detail View

coagulation cascade pathway (IEA)

complement system pathway (IEA)

phagocytosis pathway (IEA)

Staphylococcus aureus infection pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Resistance of MBL gene-knockout mice to experimental systemic aspergillosis.	Clemons KV, etal., Immunol Lett. 2010 Feb 16;128(2):105-7. doi: 10.1016/j.imlet.2009.12.021. Epub 2010 Jan 12.
2.	The mannose-binding lectin-pathway is involved in complement activation in the course of renal ischemia-reperfusion injury.	de Vries B, etal., Am J Pathol. 2004 Nov;165(5):1677-88.
3.	Exon structure of a mannose-binding protein gene reflects its evolutionary relationship to the asialoglycoprotein receptor and nonfibrillar collagens.	Drickamer K and McCreary V, J Biol Chem 1987 Feb 25;262(6):2582-9.
4.	Mannose-binding proteins isolated from rat liver contain carbohydrate-recognition domains linked to collagenous tails. Complete primary structures and homology with pulmonary surfactant apoprotein.	Drickamer K, etal., J Biol Chem 1986 May 25;261(15):6878-87.
5.	Protection from inflammatory disease in insulin resistance: the role of mannan-binding lectin.	Fernandez-Real JM, etal., Diabetologia. 2006 Oct;49(10):2402-11. Epub 2006 Aug 29.
6.	Mannan-binding lectin modulates the response to HSV-2 infection.	Gadjeva M, etal., Clin Exp Immunol. 2004 Nov;138(2):304-11.
7.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
8.	Impaired secretion of rat mannose-binding protein resulting from mutations in the collagen-like domain.	Heise CT, etal., J Immunol. 2000 Aug 1;165(3):1403-9.
9.	Inhibition of mannose-binding lectin reduces postischemic myocardial reperfusion injury.	Jordan JE, etal., Circulation. 2001 Sep 18;104(12):1413-8.
10.	A novel type of binding specificity to phospholipids for rat mannose-binding proteins isolated from serum and liver.	Kuroki Y, etal., FEBS Lett. 1997 Sep 8;414(2):387-92.
11.	High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.	Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
12.	The mannose-binding lectin pathway is a significant contributor to reperfusion injury in the type 2 diabetic heart.	La Bonte LR, etal., Diab Vasc Dis Res. 2009 Jul;6(3):172-80.
13.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
14.	Near-planar solution structures of mannose-binding lectin oligomers provide insight on activation of lectin pathway of complement.	Miller A, etal., J Biol Chem. 2012 Feb 3;287(6):3930-45. doi: 10.1074/jbc.M111.320341. Epub 2011 Dec 13.
15.	Involvement of mannose-binding lectin in the pathogenesis of Kawasaki disease-like murine vasculitis.	Nakamura A, etal., Clin Immunol. 2014 Jul;153(1):64-72. doi: 10.1016/j.clim.2014.03.019. Epub 2014 Apr 8.
16.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
17.	Structural analysis of monosaccharide recognition by rat liver mannose-binding protein.	Ng KK, etal., J Biol Chem. 1996 Jan 12;271(2):663-74.
18.	Orientation of bound ligands in mannose-binding proteins. Implications for multivalent ligand recognition.	Ng KK, etal., J Biol Chem. 2002 May 3;277(18):16088-95. doi: 10.1074/jbc.M200493200. Epub 2002 Feb 15.
19.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
20.	GOA pipeline	RGD automated data pipeline
21.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
22.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
23.	Engineering novel complement activity into a pulmonary surfactant protein.	Venkatraman Girija U, etal., J Biol Chem. 2010 Apr 2;285(14):10546-52. doi: 10.1074/jbc.M109.097493. Epub 2010 Jan 29.
24.	Interaction of mannose-binding protein with associated serine proteases: effects of naturally occurring mutations.	Wallis R and Dodd RB, J Biol Chem 2000 Oct 6;275(40):30962-9.
25.	Dominant effects of mutations in the collagenous domain of mannose-binding protein.	Wallis R J Immunol 2002 May 1;168(9):4553-8.
26.	Decoupling of carbohydrate binding and MASP-2 autoactivation in variant mannose-binding lectins associated with immunodeficiency.	Wallis R, etal., J Immunol. 2005 Nov 15;175(10):6846-51.
27.	Mannose-binding lectin is a regulator of inflammation that accompanies myocardial ischemia and reperfusion injury.	Walsh MC, etal., J Immunol. 2005 Jul 1;175(1):541-6.
28.	Activation of the lectin pathway by natural IgM in a model of ischemia/reperfusion injury.	Zhang M, etal., J Immunol. 2006 Oct 1;177(7):4727-34.

Additional References at PubMed

PMID:1436090	PMID:1721241	PMID:3584121	PMID:7704532	PMID:9922165	PMID:12477932	PMID:14724269	PMID:15060079	PMID:15148336	PMID:15489334	PMID:21866632	PMID:22879370

Genomics

Comparative Map Data

Mbl1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	17,063,232 - 17,069,271 (+)	NCBI		GRCr8
mRatBN7.2	16	17,029,146 - 17,035,187 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	17,029,118 - 17,035,174 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	16	17,093,376 - 17,099,473 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	18,221,699 - 18,227,754 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	17,146,274 - 17,152,371 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	18,736,154 - 18,742,193 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	18,736,154 - 18,742,193 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	18,604,750 - 18,610,789 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	16	17,591,820 - 17,597,859 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	16	17,591,817 - 17,597,857 (+)	NCBI
Celera	16	17,254,917 - 17,260,956 (+)	NCBI		Celera
RH 3.4 Map	16	167.5	RGD
Cytogenetic Map	16	p14	NCBI

MBL1P
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	10	79,920,178 - 79,923,119 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	10	79,920,327 - 79,923,032 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh38.p14 Ensembl	10	79,920,178 - 79,923,119 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	10	81,679,934 - 81,682,875 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	10	81,669,914 - 81,672,855 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	10	81,669,913 - 81,672,855	NCBI
Celera	10	75,670,857 - 75,673,805 (+)	NCBI		Celera
Cytogenetic Map	10	q22.3	NCBI
HuRef	10	75,522,689 - 75,525,630 (+)	NCBI		HuRef
CHM1_1	10	81,962,581 - 81,965,522 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	10	80,789,562 - 80,792,503 (+)	NCBI		T2T-CHM13v2.0

Mbl1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	14	40,873,413 - 40,885,861 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	14	40,873,415 - 40,881,558 (+)	Ensembl		GRCm39 Ensembl
GRCm38	14	41,151,456 - 41,163,904 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	14	41,151,458 - 41,159,601 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	14	41,964,745 - 41,972,248 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	14	40,060,169 - 40,067,672 (+)	NCBI		MGSCv36	mm8
Celera	14	37,311,454 - 37,318,966 (+)	NCBI		Celera
Cytogenetic Map	14	B	NCBI
cM Map	14	22.36	NCBI

Variants

Variants in Mbl1
24 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	426
Count of miRNA genes:	149
Interacting mature miRNAs:	163
Transcripts:	ENSRNOT00000015723, ENSRNOT00000072985
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631561	Hcuc2	Hepatic copper content QTL 2	2.8		liver copper amount (VT:0003065)	liver total copper weight (CMO:0001507)	16	1	39533949	Rat
1582235	Insul8	Insulin level QTL 8	3.3	0.0063	blood insulin amount (VT:0001560)	calculated serum insulin level (CMO:0000359)	16	1	26727669	Rat
2307172	Activ4	Activity QTL 4	3.71	0.00023	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	16	1	33418960	Rat
1354584	Despr6	Despair related QTL 6	3.1	0.0067	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	16	1	39533930	Rat
2302380	Slep6	Serum leptin concentration QTL 6	3.36		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	16	1	32139025	Rat
737819	Hcas4	Hepatocarcinoma susceptibility QTL 4	4.43		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	16	4227609	46975965	Rat
631517	Scl9	Serum cholesterol level QTL 9	3.3		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	16	15726433	21034895	Rat
1354625	Despr7	Despair related QTL 7	3.16	0.016	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	16	1	44977551	Rat
9590151	Scort8	Serum corticosterone level QTL 8	8.45	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	16	1	30836262	Rat
61338	Bp23	Blood pressure QTL 23	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	16	4227609	49227609	Rat
61405	Niddm6	Non-insulin dependent diabetes mellitus QTL 6	3.66	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	16	4227609	48972724	Rat
631830	Alc7	Alcohol consumption QTL 7	2.9		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	16	1	26727669	Rat
7411664	Foco30	Food consumption QTL 30	11	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	16	1	44588133	Rat
1600378	Arunc4	Aerobic running capacity QTL 4		0.03	exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	16	380245	80345693	Rat
70183	BpQTLcluster13	Blood pressure QTL cluster 13	3.654		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	16	4227609	43025077	Rat
737826	Alc11	Alcohol consumption QTL 11	3.2		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	16	4227609	60252231	Rat
1600369	Hcas8	Hepatocarcinoma susceptibility QTL 8			liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	16	1	22477621	Rat
2303566	Bw90	Body weight QTL 90	2		body mass (VT:0001259)	body weight (CMO:0000012)	16	1	39533930	Rat
2312663	Slep9	Serum leptin concentration QTL 9		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	16	832236	59492508	Rat
2306902	Bp339	Blood pressure QTL 339		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	16	3380150	43025077	Rat
1300133	Rf24	Renal function QTL 24	3.64		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	16	3380150	21361552	Rat
2312660	Bw95	Body weight QTL 95		0.05	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	16	832236	59492508	Rat
2312666	Insul16	Insulin level QTL 16		0.01	blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	16	832236	59492508	Rat
634355	Rends4	Renal damage susceptibility QTL 4		0.05	kidney blood vessel morphology trait (VT:0000530)	organ lesion measurement (CMO:0000677)	16	1	26727669	Rat
61372	Bp40	Blood pressure QTL 40	2.2		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	16	4227730	17696785	Rat
2293343	Glom16	Glomerulus QTL 16	7.4		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	16	832236	46053497	Rat
2312669	Stl23	Serum triglyceride level QTL 23		0.01	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	16	832236	59492508	Rat
6903319	Bw114	Body weight QTL 114	2.7	0.0037	body mass (VT:0001259)	body weight (CMO:0000012)	16	1	43534949	Rat

Markers in Region

D16Wox9

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	16	17,033,876 - 17,034,023 (+)	MAPPER	mRatBN7.2
Rnor_6.0	16	18,740,885 - 18,741,029	NCBI	Rnor6.0
Rnor_5.0	16	18,609,481 - 18,609,625	UniSTS	Rnor5.0
RGSC_v3.4	16	17,596,550 - 17,596,695	RGD	RGSC3.4
RGSC_v3.4	16	17,596,551 - 17,596,695	UniSTS	RGSC3.4
RGSC_v3.1	16	17,596,548 - 17,596,693	RGD
Celera	16	17,259,648 - 17,259,792	UniSTS
Cytogenetic Map	16	p14	UniSTS

D6Mit11

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	16	17,033,869 - 17,034,109 (+)	MAPPER	mRatBN7.2
Rnor_6.0	16	18,740,878 - 18,741,115	NCBI	Rnor6.0
Rnor_5.0	16	18,609,474 - 18,609,711	UniSTS	Rnor5.0
RGSC_v3.4	16	17,596,543 - 17,596,781	RGD	RGSC3.4
RGSC_v3.4	16	17,596,544 - 17,596,781	UniSTS	RGSC3.4
RGSC_v3.1	16	17,596,541 - 17,596,779	RGD
Celera	16	17,259,641 - 17,259,878	UniSTS
RH 3.4 Map	16	171.9	RGD
RH 3.4 Map	16	171.9	UniSTS
Cytogenetic Map	16	p14	UniSTS

D16Arb5

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	16	17,033,783 - 17,034,077 (+)	MAPPER	mRatBN7.2
Rnor_6.0	16	18,740,792 - 18,741,083	NCBI	Rnor6.0
Rnor_5.0	16	18,609,388 - 18,609,679	UniSTS	Rnor5.0
RGSC_v3.4	16	17,596,457 - 17,596,749	RGD	RGSC3.4
RGSC_v3.4	16	17,596,458 - 17,596,749	UniSTS	RGSC3.4
RGSC_v3.1	16	17,596,455 - 17,596,747	RGD
Celera	16	17,259,555 - 17,259,846	UniSTS
SHRSP x BN Map	16	5.64	UniSTS
SHRSP x BN Map	16	5.64	RGD
FHH x ACI Map	16	12.1799	RGD
Cytogenetic Map	16	p14	UniSTS

RH94874

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	16	17,034,959 - 17,035,087 (+)	MAPPER	mRatBN7.2
Rnor_6.0	16	18,741,966 - 18,742,093	NCBI	Rnor6.0
Rnor_5.0	16	18,610,562 - 18,610,689	UniSTS	Rnor5.0
RGSC_v3.4	16	17,597,632 - 17,597,759	UniSTS	RGSC3.4
Celera	16	17,260,729 - 17,260,856	UniSTS
RH 3.4 Map	16	167.5	UniSTS
Cytogenetic Map	16	p14	UniSTS

BI289113

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	16	17,034,959 - 17,035,174 (+)	MAPPER	mRatBN7.2
Rnor_6.0	16	18,741,966 - 18,742,180	NCBI	Rnor6.0
Rnor_5.0	16	18,610,562 - 18,610,776	UniSTS	Rnor5.0
RGSC_v3.4	16	17,597,632 - 17,597,846	UniSTS	RGSC3.4
Celera	16	17,260,729 - 17,260,943	UniSTS
RH 3.4 Map	16	166.71	UniSTS
Cytogenetic Map	16	p14	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
1	5	9	48	82	88	59	24	59	2	138	44	37	29	34	29

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_012599	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039094193	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AH003516	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC088159	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474031	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ209936	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ211562	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218582	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219044	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219753	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000016	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M14106	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000015723 ⟹ ENSRNOP00000015723

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	16	17,029,118 - 17,035,174 (+)	Ensembl
Rnor_6.0 Ensembl	16	18,736,154 - 18,742,193 (+)	Ensembl

RefSeq Acc Id:

NM_012599 ⟹ NP_036731

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	17,063,232 - 17,069,271 (+)	NCBI
mRatBN7.2	16	17,029,146 - 17,035,187 (+)	NCBI
Rnor_6.0	16	18,736,154 - 18,742,193 (+)	NCBI
Rnor_5.0	16	18,604,750 - 18,610,789 (+)	NCBI
RGSC_v3.4	16	17,591,820 - 17,597,859 (+)	RGD
Celera	16	17,254,917 - 17,260,956 (+)	RGD

Sequence:

show sequence

CCAGAAGCTGGGCTGGAGACACAGTTTCTCTTCCACTGCTCCTTTACTTTGACGAAACCCTAGG
AAGGGACCATGCTCCTGCTTCCACTGCTCGTCCTTCTCTGTGTAGTGAGCGTGTCCTCATCAGG
GTCACAAACCTGTGAGGAAACCCTGAAGACTTGCTCTGTGATAGCCTGCGGCAGAGACGGGAGA
GATGGGCCCAAAGGGGAGAAGGGAGAACCAGGTCAAGGGCTCAGGGGCTTGCAGGGCCCTCCAG
GGAAACTGGGGCCTCCAGGAAGTGTAGGAGCCCCTGGAAGTCAAGGACCAAAAGGCCAAAAAGG
GGATCGTGGAGACAGCAGAGCCATTGAGGTGAAGCTGGCAAATATGGAGGCAGAGATAAACACC
CTGAAGTCAAAACTGGAGCTAACCAACAAGTTGCATGCCTTCTCCATGGGTAAAAAGTCTGGGA
AGAAGTTCTTTGTGACCAACCATGAAAGGATGCCCTTTTCCAAAGTCAAGGCCCTGTGCTCAGA
GCTCCGAGGCACTGTGGCTATCCCCAGGAATGCTGAGGAGAACAAGGCCATCCAAGAAGTGGCT
AAAACCTCTGCCTTCCTAGGCATCACGGACGAGGTGACTGAAGGCCAATTCATGTATGTGACAG
GGGGGAGGCTCACCTACAGCAACTGGAAAAAGGATGAGCCCAATGACCATGGCTCTGGGGAAGA
CTGTGTCACTATAGTAGACAACGGTCTGTGGAATGACATCTCCTGCCAAGCTTCCCACACGGCT
GTCTGCGAGTTCCCAGCCTGAGGAAACCAGTGCCTCCATCGTCTCCTTGGCTCTCAGTCGCTTC
CAAAAAAAATTCAGTTACTGGTTTCTCAAGTTTAGTGTTAAGTGATTCTTTTGATGGGAGAGAA
TGTATTTGCTTGTGGCATGAGGACACGAATAGAAGCTGACCGGGAGGCACCAGGATCTGGTTGA
GCACGGAGCAAAGGTCACATCCATTTTGCTAGGAACACAGCAAGAAGTCAACTATGGAAAACCT
ACAATAAATATCCCCTGCCCTTTTCACCAGAGGACCAAAGGTGGTCCTTATCTGTGCCAGAGTG
GCAGCTGATCTCAGCCATAAAAGCACCCAATTCCCTTTCTCCATGAATTGTCACTAAGTGGTGT
CAAACGTGCCTGTTTGAAGTCATCCTCAGTCTACAAGGTGAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039094193 ⟹ XP_038950121

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	17,065,713 - 17,069,270 (+)	NCBI
mRatBN7.2	16	17,031,627 - 17,035,185 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_036731	(Get FASTA)	NCBI Sequence Viewer
	XP_038950121	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA98781	(Get FASTA)	NCBI Sequence Viewer
	AAH88159	(Get FASTA)	NCBI Sequence Viewer
	EDL90868	(Get FASTA)	NCBI Sequence Viewer
	EDL90869	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000015723.2
	ENSRNOP00055012421
	ENSRNOP00060013245
	ENSRNOP00065027602
GenBank Protein	P19999	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_036731 ⟸ NM_012599
- Peptide Label:	precursor
- UniProtKB:	P19999 (UniProtKB/Swiss-Prot), A6K9L8 (UniProtKB/TrEMBL)
- Sequence:	show sequence MLLLPLLVLLCVVSVSSSGSQTCEETLKTCSVIACGRDGRDGPKGEKGEPGQGLRGLQGPPGKL GPPGSVGAPGSQGPKGQKGDRGDSRAIEVKLANMEAEINTLKSKLELTNKLHAFSMGKKSGKKF FVTNHERMPFSKVKALCSELRGTVAIPRNAEENKAIQEVAKTSAFLGITDEVTEGQFMYVTGGR LTYSNWKKDEPNDHGSGEDCVTIVDNGLWNDISCQASHTAVCEFPA hide sequence

Ensembl Acc Id:

ENSRNOP00000015723 ⟸ ENSRNOT00000015723

RefSeq Acc Id:	XP_038950121 ⟸ XM_039094193
- Peptide Label:	isoform X1
- UniProtKB:	A6K9L9 (UniProtKB/TrEMBL)

Protein Domains

C-type lectin Collagen-like

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P19999-F1-model_v2	AlphaFold	P19999	1-238	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13699976

Promoter ID:

EPDNEW_R10498

Type:

initiation region

Name:

Mbl1_1

Description:

mannose-binding lectin 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	16	18,736,135 - 18,736,195	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3055	AgrOrtholog
BioCyc Gene	G2FUF-11905	BioCyc
Ensembl Genes	ENSRNOG00000011706	Ensembl, UniProtKB/Swiss-Prot
	ENSRNOG00055009165	UniProtKB/Swiss-Prot
	ENSRNOG00060010036	UniProtKB/Swiss-Prot
	ENSRNOG00065020393	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000015723.7	UniProtKB/Swiss-Prot
	ENSRNOT00055015506	UniProtKB/Swiss-Prot
	ENSRNOT00060016970	UniProtKB/Swiss-Prot
	ENSRNOT00065034454	UniProtKB/Swiss-Prot
Gene3D-CATH	3.10.100.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7326244	IMAGE-MGC_LOAD
InterPro	C-type_lectin-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	C-type_lectin-like/link_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	C-type_lectin_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ca-Dep_Lectins_ImmuneDev	UniProtKB/TrEMBL
	Ca-dependent_lectin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Collagen	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Collectin_CTLD	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	CTDL_fold	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:24548	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:108743	IMAGE-MGC_LOAD
NCBI Gene	24548	ENTREZGENE
PANTHER	C-TYPE LECTIN DOMAIN FAMILY 4 MEMBER F ISOFORM X1-RELATED	UniProtKB/TrEMBL
	LITHOSTATHINE	UniProtKB/TrEMBL
	MANNOSE-BINDING PROTEIN A	UniProtKB/TrEMBL, UniProtKB/Swiss-Prot
	PULMONARY SURFACTANT-ASSOCIATED PROTEIN A	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Collagen	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Lectin_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Mbl1	PhenoGen
PROSITE	C_TYPE_LECTIN_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	C_TYPE_LECTIN_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000011706	RatGTEx
	ENSRNOG00055009165	RatGTEx
	ENSRNOG00060010036	RatGTEx
	ENSRNOG00065020393	RatGTEx
SMART	CLECT	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	C-type lectin-like	UniProtKB/TrEMBL, UniProtKB/Swiss-Prot
	Triple coiled coil domain of C-type lectins	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TIGR	TC234245
UniProt	A6K9L8	ENTREZGENE, UniProtKB/TrEMBL
	A6K9L9	ENTREZGENE, UniProtKB/TrEMBL
	MBL1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2020-08-13	Mbl1	mannose binding lectin 1	Mbl1	mannose-binding lectin (protein A) 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-11-11	Mbl1	mannose-binding lectin (protein A) 1	Mbl1	mannose binding lectin (A)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-02-15	Mbl1	mannose binding lectin (A)	Mbl1	mannose binding lectin 1, protein A	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-09-12	Mbl1	mannose binding lectin 1, protein A	Mlb1	mannose binding lectin 2, protein C	Symbol and Name updated	1299863	APPROVED
2003-04-09	Mlb1	mannose binding lectin 2, protein C	Mbpa	Mannose binding protein A, serum	Symbol and Name updated	629477	APPROVED
2002-06-10	Mbpa	Mannose binding protein A, serum			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_disease	deficiency leads to increased susceptibility to infections	625609
gene_domains	N-terminus collagenous and cystine rich domain disrupts the interactions with associated proteases	625609
gene_physical_interaction	dimers bind with dimers of the serine proteases and the trimers and tetramers bind to multiple serine proteases	625609
gene_process	involved in reducing susceptibility to infections caused by a wide range of pathogenic microorganisms	625609
gene_product	member of the collecting family	625609
gene_product	member of the collectin family	625609

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Annotations - KEGG (archival)