Advanced Search (OLGA)

Gene: Aadat (aminoadipate aminotransferase) Rattus norvegicus

Analyze

Symbol:

Aadat

Name:

aminoadipate aminotransferase

RGD ID:

2948

Description:

Enables 2-aminoadipate transaminase activity; kynurenine-glyoxylate transaminase activity; and kynurenine-oxoglutarate transaminase activity. Predicted to be involved in 2-oxoglutarate metabolic process; glutamate metabolic process; and kynurenine metabolic process. Is active in cytosol and mitochondrial matrix. Orthologous to human AADAT (aminoadipate aminotransferase); PARTICIPATES IN tryptophan metabolic pathway; 2-aminoadipic 2-oxoadipic aciduria pathway; glutaric aciduria type I pathway; INTERACTS WITH (+)-schisandrin B; 1-naphthyl isothiocyanate; 17beta-estradiol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

2-aminoadipate aminotransferase; 2-aminoadipate transaminase; alpha-aminoadipate aminotransferase; glycine transaminase AADAT; KAT/AadAT; Kat2; kynurenine aminotransferase 2; kynurenine aminotransferase II; kynurenine--glyoxylate transaminase AADAT; kynurenine--oxoglutarate aminotransferase II; kynurenine--oxoglutarate transaminase 2; kynurenine--oxoglutarate transaminase II; kynurenine/alpha-aminoadipate aminotransferase, mitochondrial; methionine--glyoxylate transaminase AADAT

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	AADAT (aminoadipate aminotransferase)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Aadat (aminoadipate aminotransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	AADAT (aminoadipate aminotransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	AADAT (aminoadipate aminotransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Aadat (aminoadipate aminotransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	AADAT (aminoadipate aminotransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	AADAT (aminoadipate aminotransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Aadat (aminoadipate aminotransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Aadat (aminoadipate aminotransferase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	AADAT (aminoadipate aminotransferase)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	aadat (aminoadipate aminotransferase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	ARO8	Alliance	DIOPT (InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	ARO9	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector)
Drosophila melanogaster (fruit fly):	CG6321	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoInspector)
Xenopus tropicalis (tropical clawed frog):	aadat	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	34,520,236 - 34,566,388 (-)	NCBI		GRCr8
mRatBN7.2	16	29,509,392 - 29,544,332 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	29,509,394 - 29,544,332 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	16	33,104,268 - 33,139,214 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	36,538,015 - 36,572,956 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	32,738,925 - 32,773,893 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	32,832,001 - 32,868,680 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	32,832,061 - 32,868,702 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	32,665,727 - 32,705,543 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	16	32,845,006 - 32,885,600 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	16	32,845,082 - 32,885,675 (-)	NCBI
Celera	16	29,503,305 - 29,538,406 (-)	NCBI		Celera
Cytogenetic Map	16	p12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Experimental Liver Cirrhosis (ISO)

hepatocellular carcinoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

1,1-dichloroethene (ISO)

1-naphthyl isothiocyanate (EXP)

17beta-estradiol (EXP,ISO)

17beta-hydroxy-5alpha-androstan-3-one (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2,4-diaminotoluene (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2,6-dinitrotoluene (EXP)

3,3',4,4',5-pentachlorobiphenyl (EXP)

3,3',5-triiodo-L-thyronine (EXP)

4,4'-diaminodiphenylmethane (EXP)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

aflatoxin B1 (ISO)

aldrin (ISO)

amiodarone (EXP)

amitriptyline (EXP)

ammonium chloride (EXP)

aristolochic acid A (ISO)

Aroclor 1254 (EXP)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

buta-1,3-diene (ISO)

cadmium dichloride (ISO)

chlorpyrifos (ISO)

clofibrate (ISO)

clomipramine (EXP)

copper atom (EXP,ISO)

copper(0) (EXP,ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

dicrotophos (ISO)

doxorubicin (ISO)

endosulfan (EXP)

enzalutamide (ISO)

ethanol (ISO)

flutamide (EXP)

furan (EXP)

gabapentin (EXP)

gentamycin (EXP)

imipramine (EXP)

ketoconazole (EXP)

lead diacetate (EXP)

methapyrilene (EXP)

N-nitrosodiethylamine (ISO)

N-nitrosodimethylamine (EXP)

N-nitrosomorpholine (EXP)

nefazodone (EXP)

nitrofen (EXP)

paracetamol (EXP,ISO)

phenobarbital (ISO)

PhIP (EXP)

pirinixic acid (ISO)

pregnenolone 16alpha-carbonitrile (EXP)

quercetin (ISO)

rotenone (ISO)

sodium arsenite (EXP,ISO)

sotorasib (ISO)

sulfasalazine (ISO)

sunitinib (ISO)

tauroursodeoxycholic acid (EXP)

testosterone (EXP)

tetrachloromethane (EXP,ISO)

thalidomide (ISO)

thioacetamide (EXP)

thyroxine (EXP)

tiagabine (EXP)

toluene (EXP)

trametinib (ISO)

Tributyltin oxide (ISO)

trichloroethene (EXP)

uranium atom (ISO)

ursodeoxycholic acid (EXP)

valproic acid (ISO)

vancomycin (ISO)

vigabatrin (EXP)

vinclozolin (EXP)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

2-oxoglutarate metabolic process (IEA,ISO,ISS)

alpha-amino acid metabolic process (IBA)

biosynthetic process (IEA)

glutamate metabolic process (IEA,ISO,ISS)

kynurenine metabolic process (IEA,ISO,ISS)

L-lysine catabolic process to acetyl-CoA via saccharopine (IEA)

Cellular Component

cytosol (IDA)

mitochondrial matrix (IDA)

mitochondrion (ISO)

Molecular Function

2-aminoadipate transaminase activity (IDA,IEA,ISO,ISS)

glycine:2-oxoglutarate aminotransferase activity (IEA,ISO,ISS)

kynurenine-glyoxylate transaminase activity (IDA,IEA,ISO,ISS)

kynurenine-oxoglutarate transaminase activity (IBA,IDA,IEA,ISO,ISS)

methionine-glyoxylate transaminase activity (IEA,ISO,ISS)

protein homodimerization activity (IEA,ISO)

pyridoxal phosphate binding (IEA)

transaminase activity (TAS)

Molecular Pathway Annotations Click to see Annotation Detail View

2-aminoadipic 2-oxoadipic aciduria pathway (ISO)

glutaric aciduria type I pathway (ISO)

hyperlysinemia pathway (ISO)

kynurenine metabolic pathway (TAS)

lysine biosynthetic pathway (IEA)

lysine degradation pathway (IEA,ISO)

saccharopinuria pathway (ISO)

tryptophan metabolic pathway (IDA,IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Cloning and functional expression of a soluble form of kynurenine/alpha-aminoadipate aminotransferase from rat kidney.	Buchli R, etal., J Biol Chem 1995 Dec 8;270(49):29330-5.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Structure, expression, and function of kynurenine aminotransferases in human and rodent brains.	Han Q, etal., Cell Mol Life Sci. 2010 Feb;67(3):353-68. doi: 10.1007/s00018-009-0166-4. Epub 2009 Oct 15.
4.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	Enzymatic studies on tryptophan metabolism disorder in rats chronically exposed to carbon disulfide.	Okayama A, etal., Toxicol Appl Pharmacol. 1988 Jul;94(3):356-61.
8.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
9.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
10.	GOA pipeline	RGD automated data pipeline
11.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
13.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
14.	Kynurenine metabolism in vitamin-B-6-deficient rat liver after tryptophan injection.	Takeuchi F and Shibata Y, Biochem J. 1984 Jun 15;220(3):693-9.
15.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
16.	L-kynurenine aminotransferase and L-alpha-aminoadipate aminotransferase. I. Evidence for identity.	Tobes MC and Mason M, Biochem Biophys Res Commun. 1975 Jan 20;62(2):390-7. doi: 10.1016/s0006-291x(75)80151-3.

Additional References at PubMed

PMID:14651853	PMID:15489334	PMID:15880762	PMID:16258845	PMID:17024659	PMID:18056995	PMID:18056996	PMID:18614015	PMID:18620547	PMID:34800366

Genomics

Comparative Map Data

Aadat
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	34,520,236 - 34,566,388 (-)	NCBI		GRCr8
mRatBN7.2	16	29,509,392 - 29,544,332 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	29,509,394 - 29,544,332 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	16	33,104,268 - 33,139,214 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	36,538,015 - 36,572,956 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	32,738,925 - 32,773,893 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	32,832,001 - 32,868,680 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	32,832,061 - 32,868,702 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	32,665,727 - 32,705,543 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	16	32,845,006 - 32,885,600 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	16	32,845,082 - 32,885,675 (-)	NCBI
Celera	16	29,503,305 - 29,538,406 (-)	NCBI		Celera
Cytogenetic Map	16	p12	NCBI

AADAT
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	170,060,222 - 170,094,292 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	4	170,060,222 - 170,091,699 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	4	170,981,373 - 171,011,538 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	171,217,948 - 171,247,947 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	4	168,313,662 - 168,343,661 (-)	NCBI		Celera
Cytogenetic Map	4	q33	NCBI
HuRef	4	166,736,223 - 166,766,217 (-)	NCBI		HuRef
CHM1_1	4	170,957,912 - 170,987,911 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	4	173,420,406 - 173,454,472 (-)	NCBI		T2T-CHM13v2.0

Aadat
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	60,958,877 - 60,998,711 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	60,958,966 - 60,998,711 (+)	Ensembl		GRCm39 Ensembl
GRCm38	8	60,505,843 - 60,545,677 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	60,505,932 - 60,545,677 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	62,984,921 - 63,024,474 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	63,398,266 - 63,437,819 (+)	NCBI		MGSCv36	mm8
Celera	8	63,093,543 - 63,132,626 (+)	NCBI		Celera
Cytogenetic Map	8	B3.1	NCBI
cM Map	8	30.85	NCBI

AADAT
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	3	167,840,395 - 167,870,662 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	4	168,196,263 - 168,228,815 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	4	162,283,569 - 162,313,720 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	4	174,353,766 - 174,383,471 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	4	174,353,766 - 174,383,471 (-)	Ensembl	panpan1.1		panPan2

AADAT
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	25	20,920,118 - 20,944,251 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	25	20,920,139 - 20,945,387 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	25	21,552,316 - 21,578,183 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	25	21,095,996 - 21,122,120 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	25	21,095,909 - 21,122,348 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	25	20,979,787 - 21,005,336 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	25	20,916,219 - 20,941,386 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	25	21,013,862 - 21,039,554 (-)	NCBI		UU_Cfam_GSD_1.0

Aadat
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404943	21,612,298 - 21,637,776 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936516	2,029,715 - 2,052,041 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936516	2,030,032 - 2,052,025 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

AADAT
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	19,768,776 - 19,792,256 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	14	19,768,816 - 19,792,254 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	21,067,885 - 21,091,280 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

AADAT
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	7	116,268,241 - 116,299,509 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	7	116,268,253 - 116,298,336 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666037	96,208,477 - 96,238,271 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Aadat
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624769	1,581,727 - 1,610,793 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624769	1,586,036 - 1,611,092 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Aadat
248 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	340
Count of miRNA genes:	187
Interacting mature miRNAs:	211
Transcripts:	ENSRNOT00000015974
Prediction methods:	Microtar, Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631561	Hcuc2	Hepatic copper content QTL 2	2.8		liver copper amount (VT:0003065)	liver total copper weight (CMO:0001507)	16	1	39533949	Rat
70215	Niddm29	Non-insulin dependent diabetes mellitus QTL 29	3.54		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	16	19004435	75226532	Rat
2307172	Activ4	Activity QTL 4	3.71	0.00023	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	16	1	33418960	Rat
2302057	Pia29	Pristane induced arthritis QTL 29	3.6	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111)	16	21735975	66735975	Rat
1354584	Despr6	Despair related QTL 6	3.1	0.0067	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	16	1	39533930	Rat
2302380	Slep6	Serum leptin concentration QTL 6	3.36		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	16	1	32139025	Rat
737819	Hcas4	Hepatocarcinoma susceptibility QTL 4	4.43		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	16	4227609	46975965	Rat
9590151	Scort8	Serum corticosterone level QTL 8	8.45	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	16	1	30836262	Rat
1354625	Despr7	Despair related QTL 7	3.16	0.016	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	16	1	44977551	Rat
6903294	Stl30	Serum triglyceride level QTL 30	2.6	0.0013	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	16	25152793	70152793	Rat
61338	Bp23	Blood pressure QTL 23	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	16	4227609	49227609	Rat
61405	Niddm6	Non-insulin dependent diabetes mellitus QTL 6	3.66	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	16	4227609	48972724	Rat
7411664	Foco30	Food consumption QTL 30	11	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	16	1	44588133	Rat
1600378	Arunc4	Aerobic running capacity QTL 4		0.03	exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	16	380245	80345693	Rat
70183	BpQTLcluster13	Blood pressure QTL cluster 13	3.654		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	16	4227609	43025077	Rat
737826	Alc11	Alcohol consumption QTL 11	3.2		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	16	4227609	60252231	Rat
2303566	Bw90	Body weight QTL 90	2		body mass (VT:0001259)	body weight (CMO:0000012)	16	1	39533930	Rat
8694453	Bw172	Body weight QTL 172	8.33	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	16	24325513	69325513	Rat
2312663	Slep9	Serum leptin concentration QTL 9		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	16	832236	59492508	Rat
2306902	Bp339	Blood pressure QTL 339		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	16	3380150	43025077	Rat
2312660	Bw95	Body weight QTL 95		0.05	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	16	832236	59492508	Rat
2312666	Insul16	Insulin level QTL 16		0.01	blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	16	832236	59492508	Rat
70205	Gcr3	Gastric cancer resistance QTL 3	2.3		stomach morphology trait (VT:0000470)	stomach tumor diameter (CMO:0001889)	16	17696791	82635055	Rat
2293343	Glom16	Glomerulus QTL 16	7.4		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	16	832236	46053497	Rat
6903319	Bw114	Body weight QTL 114	2.7	0.0037	body mass (VT:0001259)	body weight (CMO:0000012)	16	1	43534949	Rat
2312669	Stl23	Serum triglyceride level QTL 23		0.01	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	16	832236	59492508	Rat

Markers in Region

AI746383

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	16	29,534,433 - 29,534,573 (+)	MAPPER	mRatBN7.2
Rnor_6.0	16	32,858,777 - 32,858,916	NCBI	Rnor6.0
Rnor_5.0	16	32,692,503 - 32,692,642	UniSTS	Rnor5.0
RGSC_v3.4	16	32,875,697 - 32,875,836	UniSTS	RGSC3.4
Celera	16	29,528,506 - 29,528,645	UniSTS
Cytogenetic Map	16	p12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	9	47	113	91	89	59	22	59	6	211	90	93	45	60	30

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_017193	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006253067	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063275270	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063275271	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC078864	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474053	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000016	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	Z50144	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000015974 ⟹ ENSRNOP00000015974

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	16	29,509,394 - 29,544,332 (-)	Ensembl
Rnor_6.0 Ensembl	16	32,832,061 - 32,868,680 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000082392 ⟹ ENSRNOP00000073124

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	16	32,832,611 - 32,868,702 (-)	Ensembl

RefSeq Acc Id:

NM_017193 ⟹ NP_058889

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	34,520,236 - 34,555,180 (-)	NCBI
mRatBN7.2	16	29,509,392 - 29,544,332 (-)	NCBI
Rnor_6.0	16	32,832,059 - 32,868,680 (-)	NCBI
Rnor_5.0	16	32,665,727 - 32,705,543 (-)	NCBI
RGSC_v3.4	16	32,845,006 - 32,885,600 (-)	RGD
Celera	16	29,503,305 - 29,538,406 (-)	RGD

Sequence:

show sequence

GTGGCACTCCGCAGCACTACCCGGAGACAGCTAACAGTGCAGCCCGAGTGATCTGGGAAGCCGT
TCTCAGTGACCGACTTTTCTAGTCCTGTTCCACGCGACCAGCAGAGACATGAATTACTCAAGGT
TCCTCACTGCAACGAGCCTGGCCAGAAAGACATCCCCTATCAGAGCTACAGTGGAGATAATGAG
TAGAGCACCCAAAGACATCATCTCCCTGGCTCCTGGATCTCCGAACCCGAAAGTGTTCCCCTTT
AAGTCAGCTGTCTTCACTGTGGAGAACGGAAGCACCATCCGGTTTGAAGGAGAGATGTTTCAAA
GGGCCCTCCAATATTCCTCAAGCTATGGAATTCCAGAACTTCTGTCCTGGCTAAAACAGTTGCA
AATAAAATTGCATAATCCTCCGACTGTCAACTACTCACCCAACGAAGGACAGATGGACCTCTGC
ATCACATCTGGCTGTCAAGACGGTCTCTGTAAGGTGTTTGAAATGCTCATCAATCCTGGAGACA
CTGTTCTGGTCAATGAACCACTGTATTCAGGAGCCCTTTTTGCAATGAAACCACTGGGCTGCAA
TTTTATTAGTGTCCCCAGTGATGACTGTGGGATTATTCCAGAGGGTCTCAAAAAAGTACTTTCC
CAGTGGAAACCAGAAGATTCCAAGGATCCCACAAAAAGGACTCCAAAATTTCTGTATACTATTC
CGAATGGCAACAACCCTACAGGCAACTCGTTGACTGGTGACCGCAAGAAAGAAATCTATGAGCT
TGCAAGAAAATATGACTTCCTCATAATAGAAGACGATCCTTACTATTTTCTCCAGTTCACCAAG
CCTTGGGAACCAACCTTTCTCTCCATGGATGTTGATGGGAGAGTTATCAGAGCTGACTCCCTTT
CAAAAGTTATCTCCTCAGGGCTGAGAGTGGGGTTTATAACTGGCCCCAAGTCCTTGATACAGAG
GATTGTTCTCCACACACAAATCTCATCACTGCATCCCTGTACTTTATCACAGCTCATGATATCG
GAGCTTCTATACCAGTGGGGAGAAGAGGGTTTCCTGGCCCATGTTGACAGAGCTATTGATTTCT
ACAAGAACCAGAGGGATTTTATATTGGCAGCTGCAGACAAGTGGTTACGTGGTTTGGCAGAGTG
GCATGTTCCCAAAGCTGGCATGTTTCTATGGATTAAAGTTAACGGAATCTCTGATGCAAAAAAA
CTAATTGAAGAAAAGGCTATTGAAAGAGAGATCTTGTTAGTTCCTGGAAATAGTTTCTTCGTCG
ATAATTCAGCCCCCTCCTCCTTCTTCAGAGCATCCTTCTCTCAGGTTACTCCAGCGCAGATGGA
CTTAGTCTTCCAGAGATTGGCCCAACTCATAAAAGACGTTTCATAAAGAAATCAAACTCAGCAT
TGAACTTATAATTTTAAAATAAATTTCCTATACTTTGCTGAAGAAATGGCTGACAGGATGGATC
CAGTTTGTGAAATATCTGTGGCAATTTCACTGAACAACTTTGAAGCCCCTTAAAATCCACCGCA
TTGCCAAAATAACTTTCTGATATACTTTTGCCCTTTGATTAATTATGAACTAACAAAACATCAA
ATTTCATTGTTAAAGACCTCTGTAGCTGCTTAATAATGTCCAATAAATTTTTTTGAGCCTAACA
TAGACTAACTAACATAGTAAATTGCAAGGGAATTAGTTAAAATGGCCTATAATATGCAGGTTTT
TTTCTACTTTAAGGAAATTTCATGAGCATTTACTGCAAAAATTGTTGTAATTTGACAATTATAA
ATTACTTTGTAACCGAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_063275270 ⟹ XP_063131340

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	34,520,236 - 34,554,913 (-)	NCBI

RefSeq Acc Id:

XM_063275271 ⟹ XP_063131341

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	34,520,236 - 34,566,388 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_058889	(Get FASTA)	NCBI Sequence Viewer
	XP_063131340	(Get FASTA)	NCBI Sequence Viewer
	XP_063131341	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH78864	(Get FASTA)	NCBI Sequence Viewer
	CAA90507	(Get FASTA)	NCBI Sequence Viewer
	EDL87183	(Get FASTA)	NCBI Sequence Viewer
	EDL87184	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000015974.4
GenBank Protein	Q64602	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_058889 ⟸ NM_017193

- UniProtKB:

Q64602 (UniProtKB/Swiss-Prot), A6KIT5 (UniProtKB/TrEMBL), A0A8L2Q812 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MNYSRFLTATSLARKTSPIRATVEIMSRAPKDIISLAPGSPNPKVFPFKSAVFTVENGSTIRFE
GEMFQRALQYSSSYGIPELLSWLKQLQIKLHNPPTVNYSPNEGQMDLCITSGCQDGLCKVFEML
INPGDTVLVNEPLYSGALFAMKPLGCNFISVPSDDCGIIPEGLKKVLSQWKPEDSKDPTKRTPK
FLYTIPNGNNPTGNSLTGDRKKEIYELARKYDFLIIEDDPYYFLQFTKPWEPTFLSMDVDGRVI
RADSLSKVISSGLRVGFITGPKSLIQRIVLHTQISSLHPCTLSQLMISELLYQWGEEGFLAHVD
RAIDFYKNQRDFILAAADKWLRGLAEWHVPKAGMFLWIKVNGISDAKKLIEEKAIEREILLVPG
NSFFVDNSAPSSFFRASFSQVTPAQMDLVFQRLAQLIKDVS

hide sequence

Ensembl Acc Id:

ENSRNOP00000073124 ⟸ ENSRNOT00000082392

Ensembl Acc Id:

ENSRNOP00000015974 ⟸ ENSRNOT00000015974

RefSeq Acc Id:	XP_063131341 ⟸ XM_063275271
- Peptide Label:	isoform X2
- UniProtKB:	A0A8L2Q812 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063131340 ⟸ XM_063275270
- Peptide Label:	isoform X1
- UniProtKB:	A0A8L2Q812 (UniProtKB/TrEMBL)

Protein Domains

Aminotransferase class I/classII large

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q64602-F1-model_v2	AlphaFold	Q64602	1-425	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13700074

Promoter ID:

EPDNEW_R10597

Type:

initiation region

Name:

Aadat_1

Description:

aminoadipate aminotransferase

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	16	32,868,695 - 32,868,755	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2948	AgrOrtholog
BioCyc Gene	G2FUF-11569	BioCyc
BioCyc Pathway	LYSINE-DEG1-PWY [L-lysine degradation XI (mammalian)]	BioCyc
BioCyc Pathway Image	LYSINE-DEG1-PWY	BioCyc
Ensembl Genes	ENSRNOG00000011861	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000015974.6	UniProtKB/TrEMBL
Gene3D-CATH	3.40.640.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7109210	IMAGE-MGC_LOAD
InterPro	Aminotransferase_I/II	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Class-I_PLP-Dep_Aminotransf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PyrdxlP-dep_Trfase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PyrdxlP-dep_Trfase_major	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:29416	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:93526	IMAGE-MGC_LOAD
NCBI Gene	29416	ENTREZGENE
PANTHER	AMINOTRANSFERASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	KYNURENINE_ALPHA-AMINOADIPATE AMINOTRANSFERASE, MITOCHONDRIAL	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Aminotran_1_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Aadat	PhenoGen
RatGTEx	ENSRNOG00000011861	RatGTEx
Superfamily-SCOP	SSF53383	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TIGR	TC230508
UniProt	A0A8L2Q812	ENTREZGENE, UniProtKB/TrEMBL
	A6KIT5	ENTREZGENE, UniProtKB/TrEMBL
	A6KIT6_RAT	UniProtKB/TrEMBL
	AADAT_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-09-10	Aadat	aminoadipate aminotransferase	Kat2	kynurenine aminotransferase 2	Symbol and Name updated	1299863	APPROVED
2002-06-10	Kat2	kynurenine aminotransferase 2			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_function	converts L-kynurenine into kynurenic acid	69866
gene_protein	soluble protein of 425 amino acid	69866

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways

Send us a Message

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways