Hsd17b1 (hydroxysteroid (17-beta) dehydrogenase 1)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Hsd17b1 (hydroxysteroid (17-beta) dehydrogenase 1) Rattus norvegicus

Analyze

Symbol:

Hsd17b1

Name:

hydroxysteroid (17-beta) dehydrogenase 1

RGD ID:

2836

Description:

Enables estradiol 17-beta-dehydrogenase [NAD(P)] activity and testosterone dehydrogenase (NAD+) activity. Involved in bone development; cellular response to metal ion; and steroid biosynthetic process. Predicted to be active in cytosol. Orthologous to human HSD17B1 (hydroxysteroid 17-beta dehydrogenase 1); PARTICIPATES IN estradiol biosynthetic pathway; steroid hormone biosynthetic pathway; INTERACTS WITH (+)-taxifolin; (S)-nicotine; 17alpha-ethynylestradiol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

17-beta-HSD 1; 17-beta-hydroxysteroid dehydrogenase type 1; 17BHD1; estradiol 17-beta-dehydrogenase 1; hydroxysteroid 17-beta dehydrogenase 1; Hydroxysteroid dehydrogenase 17 beta type 1; Hydroxysteroid dehydrogenase 17 beta, type 1

RGD Orthologs

Alliance Genes

More Info

more info ...

Candidate Gene For:

Eau3 Pia10 Ciaa2

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	10	86,009,728 - 86,011,928 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	86,009,728 - 86,011,927 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	91,046,170 - 91,048,370 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	90,524,986 - 90,527,186 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	85,918,153 - 85,920,353 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	88,987,558 - 88,989,758 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	88,987,558 - 88,989,757 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	88,786,054 - 88,788,254 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	90,094,249 - 90,096,451 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	90,108,618 - 90,110,820 (+)	NCBI
Celera	10	84,727,443 - 84,729,643 (+)	NCBI		Celera
Cytogenetic Map	10	q31	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autism spectrum disorder (ISO)

endometriosis (ISO)

genetic disease (ISO)

invasive ductal carcinoma (ISO)

mucopolysaccharidosis type IIIB (ISO)

Prostatic Neoplasms (ISO)

Spontaneous Abortions (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-taxifolin (EXP)

(S)-nicotine (EXP,ISO)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (EXP)

17beta-estradiol (EXP,ISO)

17beta-hydroxy-5alpha-androstan-3-one (EXP)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dibromophenol (ISO)

2,6-dibromophenol (ISO)

2-bromophenol (ISO)

3,3',4,4',5-pentachlorobiphenyl (EXP,ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (EXP,ISO)

6-propyl-2-thiouracil (EXP)

8-Br-cAMP (ISO)

9-cis-retinoic acid (ISO)

acetaldehyde (ISO)

acetamiprid (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

aminoglutethimide (ISO)

amitrole (EXP)

ammonium chloride (EXP)

androst-5-ene-3beta,17beta-diol (ISO)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

Aroclor 1254 (EXP)

atrazine (EXP)

benzo[a]pyrene diol epoxide I (ISO)

benzofurans (ISO)

beta-naphthoflavone (ISO)

bifenthrin (ISO)

bis(2-ethylhexyl) phthalate (EXP,ISO)

bisphenol A (EXP,ISO)

bisphenol F (EXP)

bucladesine (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

chlorpyrifos (ISO)

chromium(6+) (EXP)

colforsin daropate hydrochloride (ISO)

copper atom (ISO)

copper(0) (ISO)

coumarin (ISO)

Cuprizon (EXP)

cyhexatin (ISO)

cypermethrin (ISO)

DDT (ISO)

decabromodiphenyl ether (EXP,ISO)

dehydroepiandrosterone (ISO)

dexamethasone (EXP)

dextran sulfate (ISO)

dibutyl phthalate (EXP,ISO)

diethylstilbestrol (EXP,ISO)

dutasteride (ISO)

endosulfan (EXP,ISO)

Enterolactone (ISO)

epoxiconazole (ISO)

estrone (ISO)

fentin chloride (ISO)

fentin hydroxide (ISO)

fenvalerate (EXP,ISO)

flufenoxuron (ISO)

flutamide (EXP)

fluvastatin (EXP)

formaldehyde (ISO)

formestane (ISO)

fulvestrant (ISO)

gamma-hexachlorocyclohexane (EXP)

genistein (ISO)

glutathione (EXP)

HT-2 toxin (ISO)

iodoacetic acid (ISO)

isoliquiritigenin (ISO)

L-ascorbic acid (EXP)

lead diacetate (ISO)

methimazole (EXP)

methoxychlor (EXP,ISO)

methylmercury chloride (ISO)

metyrapone (ISO)

mono(2-ethylhexyl) phthalate (ISO)

monobenzyl phthalate (ISO)

Monobutylphthalate (ISO)

monoethyl phthalate (ISO)

NADP zwitterion (ISO)

NADP(+) (ISO)

naphthalenes (ISO)

nicotine (EXP,ISO)

ochratoxin A (EXP)

paracetamol (EXP,ISO)

perflubron (ISO)

perfluorododecanoic acid (EXP)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

pregnenolone (ISO)

procymidone (ISO)

resveratrol (ISO)

silicon dioxide (ISO)

sodium arsenite (EXP,ISO)

sulfadimethoxine (EXP)

sunitinib (ISO)

taurine (EXP)

testosterone (ISO)

tetracycline (ISO)

titanium dioxide (ISO)

tributylstannane (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

triclosan (EXP)

triptonide (ISO)

urethane (ISO)

valproic acid (ISO)

vinclozolin (EXP)

zearalenone (ISO)

zinc oxide (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adipose tissue development (ISO)

bone development (IEP)

cellular response to metal ion (IEP)

estrogen biosynthetic process (IBA,IDA,IEA,ISO)

gene expression (ISO)

lipid metabolic process (ISO)

lysosome organization (ISO)

skeletal muscle tissue development (ISO)

testosterone biosynthetic process (IDA,ISO)

Cellular Component

cytosol (IBA,ISO)

Molecular Function

17-beta-hydroxysteroid dehydrogenase (NADP+) activity (ISO)

estradiol 17-beta-dehydrogenase [NAD(P)] activity (IBA,IDA,ISO)

estradiol binding (ISO)

NADP binding (ISO)

NADP+ binding (ISO)

protein binding (ISO)

protein homodimerization activity (ISO)

small molecule binding (ISO)

steroid binding (ISO)

testosterone dehydrogenase (NAD+) activity (IDA)

testosterone dehydrogenase [NAD(P)] activity (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

estradiol biosynthetic pathway (ISO,TAS)

steroid hormone biosynthetic pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Cloning of rat 17 beta-hydroxysteroid dehydrogenase type 2 and characterization of tissue distribution and catalytic activity of rat type 1 and type 2 enzymes.	Akinola LA, etal., Endocrinology 1996 May;137(5):1572-9.
2.	Characterization of rat 17 beta-hydroxysteroid dehydrogenase type 1 gene and mRNA transcripts.	Akinola LA, etal., Gene 1998 Feb 27;208(2):229-38.
3.	Lactational exposure to hexavalent chromium delays puberty by impairing ovarian development, steroidogenesis and pituitary hormone synthesis in developing Wistar rats.	Banu SK, etal., Toxicol Appl Pharmacol. 2008 Oct 15;232(2):180-9. Epub 2008 Jun 17.
4.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.	Rat 17 beta-hydroxysteroid dehydrogenase type 1: primary structure and regulation of enzyme expression in rat ovary by diethylstilbestrol and gonadotropins in vivo.	Ghersevich S, etal., Endocrinology 1994 Oct;135(4):1477-87.
6.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
7.	Aging reduces the efficacy of estrogen substitution to attenuate cardiac hypertrophy in female spontaneously hypertensive rats.	Jazbutyte V, etal., Hypertension. 2006 Oct;48(4):579-86. Epub 2006 Aug 28.
8.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
9.	FSH and FOXO1 regulate genes in the sterol/steroid and lipid biosynthetic pathways in granulosa cells.	Liu Z, etal., Mol Endocrinol. 2009 May;23(5):649-61. Epub 2009 Feb 5.
10.	Androgen synthesis in adrenarche.	Miller WL Rev Endocr Metab Disord. 2009 Mar;10(1):3-17.
11.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
12.	Overview of steroidogenic enzymes in the pathway from cholesterol to active steroid hormones.	Payne AH and Hales DB, Endocr Rev. 2004 Dec;25(6):947-70.
13.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
14.	GOA pipeline	RGD automated data pipeline
15.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
16.	Identification of genomic regions controlling experimental autoimmune uveoretinitis in rats.	Sun SH, etal., Int Immunol 1999 Apr;11(4):529-34
17.	17Beta-hydroxysteroid dehydrogenase type 1 and type 2 in human breast carcinoma: a correlation to clinicopathological parameters.	Suzuki T, etal., Br J Cancer. 2000 Feb;82(3):518-23.
18.	Expression of estrogen receptors and enzymes involved in sex steroid metabolism in the rat tibia during sexual maturation.	van der Eerden BC, etal., J Endocrinol. 2004 Mar;180(3):457-67.
19.	Disruption in the expression and immunolocalisation of steroid receptors and steroidogenic enzymes in letrozole-induced polycystic ovaries in rat.	Zurvarra FM, etal., Reprod Fertil Dev. 2009;21(7):827-39.

Additional References at PubMed

PMID:4396689	PMID:8805577	PMID:9525918	PMID:10625652	PMID:12477932	PMID:15489334	PMID:34038751

Genomics

Comparative Map Data

Hsd17b1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	10	86,009,728 - 86,011,928 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	86,009,728 - 86,011,927 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	91,046,170 - 91,048,370 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	90,524,986 - 90,527,186 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	85,918,153 - 85,920,353 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	88,987,558 - 88,989,758 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	88,987,558 - 88,989,757 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	88,786,054 - 88,788,254 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	90,094,249 - 90,096,451 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	90,108,618 - 90,110,820 (+)	NCBI
Celera	10	84,727,443 - 84,729,643 (+)	NCBI		Celera
Cytogenetic Map	10	q31	NCBI

HSD17B1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	42,552,923 - 42,555,214 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	42,552,922 - 42,555,214 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	17	40,704,941 - 40,707,232 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	37,957,510 - 37,960,757 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	17	37,957,509 - 37,960,757	NCBI
Celera	17	37,359,920 - 37,363,168 (+)	NCBI		Celera
Cytogenetic Map	17	q21.2	NCBI
HuRef	17	36,468,996 - 36,472,244 (+)	NCBI		HuRef
CHM1_1	17	40,939,828 - 40,943,076 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	17	43,410,112 - 43,412,403 (+)	NCBI		T2T-CHM13v2.0

Hsd17b1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	100,968,792 - 100,972,014 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	100,969,237 - 100,971,353 (+)	Ensembl		GRCm39 Ensembl
GRCm38	11	101,077,968 - 101,081,188 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	101,078,411 - 101,080,527 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	100,939,725 - 100,941,819 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	100,894,501 - 100,896,595 (+)	NCBI		MGSCv36	mm8
Celera	11	112,374,513 - 112,376,607 (+)	NCBI		Celera
Cytogenetic Map	11	D	NCBI
cM Map	11	64.17	NCBI

Hsd17b1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955451	16,449,683 - 16,451,945 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955451	16,449,333 - 16,452,036 (+)	NCBI	ChiLan1.0	ChiLan1.0

HSD17B1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	17	24,319,367 - 24,325,778 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	14,760,856 - 14,763,584 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	14,986,538 - 14,989,741 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	17	14,986,814 - 14,988,820 (-)	Ensembl	panpan1.1		panPan2

HSD17B1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	20,402,124 - 20,407,143 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	9	20,405,019 - 20,406,792 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	19,866,871 - 19,868,985 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	21,123,971 - 21,126,087 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	21,123,971 - 21,125,745 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	19,909,803 - 19,911,916 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	20,175,037 - 20,177,147 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	20,279,091 - 20,281,208 (-)	NCBI		UU_Cfam_GSD_1.0

Hsd17b1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	19,760,718 - 19,762,826 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936490	17,312,390 - 17,314,409 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936490	17,312,390 - 17,314,423 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

HSD17B1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	12	20,269,056 - 20,271,548 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	12	20,269,468 - 20,271,349 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	12	20,482,373 - 20,484,253 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

HSD17B1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	63,730,303 - 63,733,974 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	16	63,728,777 - 63,732,411 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666077	34,525,962 - 34,529,030 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Hsd17b1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624795	1,551,311 - 1,553,493 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624795	1,551,311 - 1,553,432 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Hsd17b1
5 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	182
Count of miRNA genes:	132
Interacting mature miRNAs:	147
Transcripts:	ENSRNOT00000026878
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6357896	96121100	Rat
2303118	Mamtr7	Mammary tumor resistance QTL 7		0.003	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	9658275	104670812	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14487011	89062041	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14487011	104060283	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14487011	107057807	Rat
1554317	Bmd4	Bone mineral density QTL 4	9.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	19816042	99406971	Rat
724556	Pur2	Proteinuria QTL 2	5.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	22427500	90627625	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
1298069	Bp168	Blood pressure QTL 168	5.5		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	10	26521957	98003205	Rat
631542	Bp82	Blood pressure QTL 82	6.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	26521957	98952741	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29299504	107211142	Rat
1576308	Schws1	Schwannoma susceptibility QTL 1		0.0041	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	40035094	102359817	Rat
631269	Cia22	Collagen induced arthritis QTL 22	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
631270	Cia23	Collagen induced arthritis QTL 23	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
631552	Vetf2	Vascular elastic tissue fragility QTL 2	4.5	0.0002	aorta elastic tissue integrity trait (VT:0010556)	artery internal elastic lamina non-tumorous lesion count (CMO:0001913)	10	41142633	86142633	Rat
61463	Bp12	Blood pressure QTL 12	6.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	41333258	86333258	Rat
1298078	Stresp5	Stress response QTL 5	2.99	0.00025	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	42045676	104670812	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	42323132	87323132	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	42323132	87323132	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	42323132	87323132	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	42323132	87323132	Rat
70198	BpQTLcluster9	Blood pressure QTL cluster 9	2.94		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	42323132	87323132	Rat
9589030	Epfw9	Epididymal fat weight QTL 9	19.24	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	10	44441699	89441699	Rat
7411614	Foco18	Food consumption QTL 18		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	10	44441699	89441699	Rat
8694173	Bw149	Body weight QTL 149	4.38	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	10	44441699	89441699	Rat
2300218	Hpcl2	Hepatic cholesterol level QTL 2			liver cholesterol amount (VT:0010498)	liver cholesterol level (CMO:0001597)	10	45029650	95600334	Rat
631547	Bp87	Blood pressure QTL 87	4.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	47369470	92369470	Rat
1549846	Scl47	Serum cholesterol level QTL 47	3.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	10	50574707	95574707	Rat
70364	Bp72	Blood pressure QTL 72			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	51121100	96121100	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	51770177	107211142	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	51770177	107211142	Rat
1359017	Hrtrt21	Heart rate QTL 21	2.4		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	10	51772940	96772940	Rat
631530	Tls3	T-lymphoma susceptibility QTL 3	0	0.0001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	10	51774612	95600334	Rat
631535	Cm51	Cardiac mass QTL 51	3		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	10	51786282	91669536	Rat
70171	Cari1	Carrageenan-induced inflammation QTL 1	4.9	0.0005	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	10	53797385	107211142	Rat
70164	Bw21	Body weight QTL 21	4.36	0.00005	body mass (VT:0001259)	body weight (CMO:0000012)	10	53797494	98952626	Rat
1354608	Cm33	Cardiac mass QTL 33	2.8		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	10	54809292	99809292	Rat
2312662	Slep8	Serum leptin concentration QTL 8		0.05	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	10	57134272	102134272	Rat
2312668	Scl65	Serum cholesterol level QTL 65		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	10	57134272	102134272	Rat
2312672	Insul15	Insulin level QTL 15		0.01	blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	10	57134272	102134272	Rat
1549831	Bss6	Bone structure and strength QTL 6	4		lumbar vertebra strength trait (VT:0010574)	vertebra ultimate force (CMO:0001678)	10	57576521	102576521	Rat
2293698	Bss43	Bone structure and strength QTL 43	5.33	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra cross-sectional area (CMO:0001689)	10	59209888	104209888	Rat
2306970	Anxrr22	Anxiety related response QTL 22	5.95		fear/anxiety-related behavior trait (VT:1000241)	number of periods of voluntary immobility (CMO:0001045)	10	61345276	98211570	Rat
6893336	Cm75	Cardiac mass QTL 75	0.1	0.87	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	10	61345276	99703528	Rat
1558643	Cm44	Cardiac mass QTL 44	4.8	0.0000368	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	61345276	99703528	Rat
2313103	Bss80	Bone structure and strength QTL 80	2	0.0001	tibia strength trait (VT:1000284)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	10	62057807	107057807	Rat
2313105	Bss79	Bone structure and strength QTL 79	1.8	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	62057807	107057807	Rat
61449	Ciaa2	CIA Autoantibody QTL 2	7.1		blood autoantibody amount (VT:0003725)	calculated serum anti-type 2 collagen antibody titer (CMO:0001279)	10	63221094	107211142	Rat
1357344	Bp249	Blood pressure QTL 249		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	66743655	98003205	Rat
2317029	Aia19	Adjuvant induced arthritis QTL 19	2.98		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	10	66978955	107211142	Rat
2317039	Aia6	Adjuvant induced arthritis QTL 6	4.31		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	10	66978955	107211142	Rat
10450498	Bp384	Blood pressure QTL 384		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	67750049	107211142	Rat
1642980	Bp300	Blood pressure QTL 300			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	68383129	107211142	Rat
61396	Bp9	Blood pressure QTL 9	4.8	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	68420376	107211142	Rat
2300172	Bmd57	Bone mineral density QTL 57	9.8	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	10	69738412	107211142	Rat
2293646	Bss25	Bone structure and strength QTL 25	10.96	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	10	69738412	107211142	Rat
2293663	Bss33	Bone structure and strength QTL 33	9.34	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	10	69738412	107211142	Rat
6893366	Bw106	Body weight QTL 106	0.3	0.47	body mass (VT:0001259)	body weight (CMO:0000012)	10	70199100	107211142	Rat
70193	Mcs7	Mammary carcinoma susceptibility QTL 7	2.38		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	10	72224939	107211142	Rat
2298548	Neuinf7	Neuroinflammation QTL 7	3.4		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	10	72224939	107211142	Rat
2306793	Ean5	Experimental allergic neuritis QTL 5	4.7		nervous system integrity trait (VT:0010566)	IFNG-secreting splenocyte count (CMO:0002122)	10	72552416	93995749	Rat
1358188	Ept9	Estrogen-induced pituitary tumorigenesis QTL 9	3.9		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	10	73453136	96120911	Rat
2292617	Ept18	Estrogen-induced pituitary tumorigenesis QTL 18	3.9		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	10	73453136	96120911	Rat
1579919	Bp281	Blood pressure QTL 281		0.01	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	74372084	94965338	Rat
631537	Oia4	Oil induced arthritis QTL 4			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	75631887	87055282	Rat
10450495	Bp383	Blood pressure QTL 383		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	76246085	94965338	Rat
2292438	Bp311	Blood pressure QTL 311			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	76246085	107211142	Rat
1302404	Cia27	Collagen induced arthritis QTL 27	2.6	0.0045	joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	10	76452683	107211142	Rat
4889492	Pancm2	Pancreatic morphology QTL 2	3.2		pancreatic beta cell morphology trait (VT:0005217)	ratio of insulin-positive cell area to total area of splenic region of pancreas (CMO:0001814)	10	76748906	107211142	Rat
1300107	Rf18	Renal function QTL 18	3.41		urine output (VT:0003620)	timed urine volume (CMO:0000260)	10	78775516	98279596	Rat
1358915	Stresp7	Stress response QTL 7	3.52		blood norepinephrine amount (VT:0005663)	plasma norepinephrine level (CMO:0001010)	10	78899655	87307728	Rat
631555	Bp134	Blood pressure QTL 134		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	80515287	91230079	Rat
6893357	Bw102	Body weight QTL 102	0.5	0.36	body mass (VT:0001259)	body weight (CMO:0000012)	10	80515287	101325465	Rat
2303589	Bw87	Body weight QTL 87	2		body mass (VT:0001259)	body weight (CMO:0000012)	10	81285008	107211142	Rat
4889948	Bss91	Bone structure and strength QTL 91	4		tibia area (VT:1000281)	tibia midshaft total cross-sectional area (CMO:0001715)	10	82564856	92369470	Rat
2317754	Glom25	Glomerulus QTL 25	3.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	82685200	107211142	Rat
12880055	Am11	Aortic mass QTL 11		0.004	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	84007272	95933025	Rat
2301398	Kidm38	Kidney mass QTL 38		0.002	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	10	84007272	95933025	Rat
2306792	Ean4	Experimental allergic neuritis QTL 4	4		nervous system integrity trait (VT:0010566)	IFNG-secreting splenocyte count (CMO:0002122)	10	84022321	93995963	Rat
1600367	Mcs15	Mammary carcinoma susceptibility QTL 15	4.5		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	10	85565469	103884409	Rat

Markers in Region

D10Wox46

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	86,012,200 - 86,012,394 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	88,990,031 - 88,990,224	NCBI	Rnor6.0
Rnor_5.0	10	88,788,527 - 88,788,720	UniSTS	Rnor5.0
RGSC_v3.4	10	90,096,724 - 90,096,917	UniSTS	RGSC3.4
Celera	10	84,729,916 - 84,730,103	UniSTS
Cytogenetic Map	10	q32.1	UniSTS

RH134495

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	86,008,718 - 86,008,899 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	88,986,549 - 88,986,729	NCBI	Rnor6.0
Rnor_5.0	10	88,785,045 - 88,785,225	UniSTS	Rnor5.0
RGSC_v3.4	10	90,093,240 - 90,093,420	UniSTS	RGSC3.4
Celera	10	84,726,434 - 84,726,614	UniSTS
RH 3.4 Map	10	877.1	UniSTS
Cytogenetic Map	10	q32.1	UniSTS

RH142272

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	86,008,746 - 86,008,938 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	88,986,577 - 88,986,768	NCBI	Rnor6.0
Rnor_5.0	10	88,785,073 - 88,785,264	UniSTS	Rnor5.0
RGSC_v3.4	10	90,093,268 - 90,093,459	UniSTS	RGSC3.4
Celera	10	84,726,462 - 84,726,653	UniSTS
RH 3.4 Map	10	875.29	UniSTS
Cytogenetic Map	10	q32.1	UniSTS

Hsd17b1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	86,010,526 - 86,011,321 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	88,988,357 - 88,989,151	NCBI	Rnor6.0
Rnor_5.0	10	88,786,853 - 88,787,647	UniSTS	Rnor5.0
RGSC_v3.4	10	90,095,050 - 90,095,844	UniSTS	RGSC3.4
Celera	10	84,728,242 - 84,729,036	UniSTS
Cytogenetic Map	10	q32.1	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	1				3				1	2	4	2
Low	2	33	51	35	16	35	6	9	73	33	37	9	6
Below cutoff		10	6	6		6	2	2					2

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_012851	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC086365	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000220	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X78811	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X97754	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X98038	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000026878 ⟹ ENSRNOP00000026878

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	86,009,728 - 86,011,927 (+)	Ensembl
Rnor_6.0 Ensembl	10	88,987,558 - 88,989,757 (+)	Ensembl

RefSeq Acc Id:

NM_012851 ⟹ NP_036983

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	10	86,009,728 - 86,011,928 (+)	NCBI
Rnor_6.0	10	88,987,558 - 88,989,758 (+)	NCBI
Rnor_5.0	10	88,786,054 - 88,788,254 (+)	NCBI
RGSC_v3.4	10	90,094,249 - 90,096,451 (+)	RGD
Celera	10	84,727,443 - 84,729,643 (+)	RGD

Sequence:

show sequence

CTAGGACCCTTCATGCTCTGAGCATCAGTACCTTTTCACATGGACTCCACGGTAGTGCTCATTA
CCGGTTGCTCTTCTGGAATTGGCCTGCACTTGGCTGTTCGTCTGGCTTCCGACCGTTCCCAGAG
CTTCAAAGTTTATGCCACATTGCGGGATCTGAAGTCACAGGGACCATTGTTGGAGGCAGCCAGG
GCTCAAGGATGCCCTCCTGGCTCCCTGGAGATACTGGAATTGGATGTCAGAGACTCGGAATCTG
TGGCTGCTGCCCGGGCATGCGTGACGGAGGGTCGAGTGGATGTACTGGTCTGTAATGCTGGACG
CGGCTTGTTCGGGCCGCTGGAAGCGCATGAGTTGAACGCTGTGGGTGCTGTACTGGATGTGAAT
GTTCTTGGGACCATCCGGATGCTTCAGGCCTTTCTGCCAGACATGAAAAGGCGCCACTCCGGGC
GTGTGCTGGTGACTGCGAGTGTGGGAGGTTTGATGGGGCTGCCATTCCACGAAGTGTACTGTGC
CAGCAAGTTTGCGCTCGAAGGTCTGTGCGAGAGTCTGGCGATCCTGCTGCCGCTCTTTGGAGTC
CACGTGAGCCTCATCGAGTGCGGGGCAGTGCACACAGCCTTCCATGAAAAGCTGGAGGGCGGCC
CGGGCGGGGCTCTGGAGCGAGCAGATGCCCAGACCCGCCACCTCTTTGCCCACTATCAGCGTGG
TTATGAGCAAGCCCTGAGCGAGGCGCAGGACCCAGAGGAGGTGACGGAGCTCTTCTTGACTGCG
ATGCGAGCCCCGCAGCCTGCGCTGCGCTACTTCTCCACAAACCGCTTCCTGCCGCTGGCCCGAA
TGCGCACAGAGGACCCCAGTGGCAGCAGCTACGTCGAAGCCATGCACCGCGAGGCCTTCTCTGA
TCTGCAGGTCCAGGAGGGTGCCAAGGCTGGGGCCCAAGTTTCAGGGGATCCAGACACGCCCCCC
AGAGCCCTCATTTGTCTCCCCGAGTGTGCAATCCCTAGGGTGACAGCTGAATTGGGATGGTCTG
CATCAGATAAACCGGGTCAGAACAAATCATGTTACCAGCAAAAGATCTAAGCTAGAATCTCTTT
TTATTATTTTAGAATGTGTTTTGTTTTAAGACAAGGTTTCACTATGTAGCCCTGTCTGAACTGT
AACTCATAAAGATCCACCTGCTTCTCCTTCTGTGTGCAACCGCACACTTCTCAGAATCATTTGA
AATAGTGCAAACATCTTCATGGGTCAAGATAAGAGGGCTGTAGTCGGGGTTGGGGATTTAGCTC
AGTGGTAGAGCGCTTGCCTAGGAAGTGCAAGGCCCTGGGTTCGGTCCCCAGCTCCAGGGGGAAA
AAAAACCTAAAAAAAAAAAGAGGGCTGTAGTCAAGGTTAAGGGTTTTTCCTTCCAATAAATGTA
CTTATTAATTATTAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_036983	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH86365	(Get FASTA)	NCBI Sequence Viewer
	CAA55389	(Get FASTA)	NCBI Sequence Viewer
	CAA66349	(Get FASTA)	NCBI Sequence Viewer
	CAA66657	(Get FASTA)	NCBI Sequence Viewer
	EDM06082	(Get FASTA)	NCBI Sequence Viewer
	P51657	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_036983 ⟸ NM_012851

- UniProtKB:

P51657 (UniProtKB/Swiss-Prot), A6HJ77 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MDSTVVLITGCSSGIGLHLAVRLASDRSQSFKVYATLRDLKSQGPLLEAARAQGCPPGSLEILE
LDVRDSESVAAARACVTEGRVDVLVCNAGRGLFGPLEAHELNAVGAVLDVNVLGTIRMLQAFLP
DMKRRHSGRVLVTASVGGLMGLPFHEVYCASKFALEGLCESLAILLPLFGVHVSLIECGAVHTA
FHEKLEGGPGGALERADAQTRHLFAHYQRGYEQALSEAQDPEEVTELFLTAMRAPQPALRYFST
NRFLPLARMRTEDPSGSSYVEAMHREAFSDLQVQEGAKAGAQVSGDPDTPPRALICLPECAIPR
VTAELGWSASDKPGQNKSCYQQKI

hide sequence

RefSeq Acc Id:

ENSRNOP00000026878 ⟸ ENSRNOT00000026878

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P51657-F1-model_v2	AlphaFold	P51657	1-344	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2836	AgrOrtholog
BioCyc Gene	G2FUF-23203	BioCyc
Ensembl Genes	ENSRNOG00000019830	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Protein	ENSRNOP00000026878	ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000026878	ENTREZGENE, UniProtKB/Swiss-Prot
Gene3D-CATH	NAD(P)-binding Rossmann-like Domain	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7305002	IMAGE-MGC_LOAD
InterPro	17beta_DH	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	NAD(P)-bd_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Sc_DH/Rdtase_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SDR_fam	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:25322	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:105495	IMAGE-MGC_LOAD
NCBI Gene	25322	ENTREZGENE
PANTHER	17-BETA-HYDROXYSTEROID DEHYDROGENASE TYPE 1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RETINOL DEHYDROGENASE-RELATED	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	adh_short	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Hsd17b1	PhenoGen
PIRSF	17beta-HSD	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PRINTS	GDHRDH	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SDRFAMILY	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	ADH_SHORT	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	NAD(P)-binding Rossmann-fold domains	UniProtKB/TrEMBL, UniProtKB/Swiss-Prot
UniProt	A6HJ77	ENTREZGENE, UniProtKB/TrEMBL
	DHB1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Name	Description	Reference	Status
2004-09-10	Hsd17b1	hydroxysteroid (17-beta) dehydrogenase 1	hydroxysteroid 17-beta dehydrogenase 1	Name updated	1299863	APPROVED
2003-04-09	Hsd17b1	hydroxysteroid 17-beta dehydrogenase 1	Hydroxysteroid dehydrogenase 17 beta, type 1	Name updated	629478	APPROVED
2002-06-10	Hsd17b1	Hydroxysteroid dehydrogenase 17 beta, type 1		Symbol and Name status set to approved	70586	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - KEGG (archival)