Gnal (G protein subunit alpha L) - Rat Genome Database

Name: Gnal
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Gnal (G protein subunit alpha L) Rattus norvegicus

Analyze

Symbol:

Gnal

Name:

G protein subunit alpha L

RGD ID:

2715

Description:

Predicted to enable G protein-coupled receptor binding activity; G-protein beta/gamma-subunit complex binding activity; and GTPase activity. Involved in cellular response to dopamine and regulation of long-term synaptic depression. Predicted to be located in plasma membrane. Predicted to be part of heterotrimeric G-protein complex. Used to study dystonia. Biomarker of traumatic brain injury. Human ortholog(s) of this gene implicated in dystonia 25. Orthologous to human GNAL (G protein subunit alpha L); PARTICIPATES IN dopamine signaling pathway via D1 family of receptors; endothelin signaling pathway; G protein mediated signaling pathway via Galphas family; INTERACTS WITH 6-propyl-2-thiouracil; ammonium chloride; atrazine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

adenylate cyclase-stimulating G alpha protein, olfactory type; Golf; guanine nucleotide binding protein, alpha activating activity polypeptide, olfactory type; guanine nucleotide binding protein, alpha stimulating, olfactory type; guanine nucleotide-binding protein G(olf) subunit alpha; guanine nucleotide-binding protein G(olf), alpha subunit; LOC361343; Olf; Olf-alpha protein (olfactory neuron-specific G protein); RGD1305940; similar to RIKEN cDNA 9630020G10 gene

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GNAL (G protein subunit alpha L)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, Panther
Mus musculus (house mouse):	Gnal (guanine nucleotide binding protein, alpha stimulating, olfactory type)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Gnal (G protein subunit alpha L)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GNAL (G protein subunit alpha L)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GNAL (G protein subunit alpha L)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Gnal (G protein subunit alpha L)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GNAL (G protein subunit alpha L)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GNAL (G protein subunit alpha L)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Gnal (G protein subunit alpha L)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	GNAS (GNAS complex locus)	HGNC	OrthoDB
Homo sapiens (human):	TDRD3 (tudor domain containing 3)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Gnal (guanine nucleotide binding protein, alpha stimulating, olfactory type)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	GNAL (G protein subunit alpha L)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	gnal (guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Galphas	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	gsa-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	gnal	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PhylomeDB)

Allele / Splice:

Gnal^em1Hpng

Genetic Models:

SD-Gnal^em1Hpng-/- SD-Gnal^em1Hpng+/-

Is Marker For:

Strains: BB.SHR-(Gnal-D18Mit9)/K
QTLs: Iddm4 Bp48 Iddm15 Sprol1

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	18	60,622,311 - 60,762,599 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	60,622,311 - 60,762,599 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	18	62,697,583 - 62,835,273 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	63,396,310 - 63,534,014 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	61,243,031 - 61,383,188 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	62,805,406 - 62,946,133 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	62,805,410 - 62,944,630 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	18	61,991,738 - 62,131,420 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	18	63,595,606 - 63,735,803 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	18	63,668,806 - 63,809,004 (+)	NCBI
Celera	18	58,730,137 - 58,870,361 (+)	NCBI		Celera
Cytogenetic Map	18	q12.1	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

chromosome 18p deletion syndrome (ISO)

Dysarthria (ISO)

dystonia (IMP,ISO)

dystonia 25 (ISO)

genetic disease (ISO)

intellectual disability (ISO)

Parkinsonism (ISO)

traumatic brain injury (IEP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

(S)-amphetamine (ISO)

1,2-dichloroethane (ISO)

17beta-hydroxy-5alpha-androstan-3-one (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

3',5'-cyclic AMP (ISO)

3,4-methylenedioxymethamphetamine (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

atrazine (EXP)

benzo[a]pyrene (EXP,ISO)

bisphenol A (EXP)

C60 fullerene (EXP)

caffeine (ISO)

cannabidiol (ISO)

cannabigerol (ISO)

carbon nanotube (ISO)

citronellal (ISO)

copper atom (ISO)

copper(0) (ISO)

crocidolite asbestos (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

decanal (ISO)

diarsenic trioxide (ISO)

dibutyl phthalate (EXP,ISO)

dorsomorphin (ISO)

epoxiconazole (ISO)

ethanol (EXP,ISO)

ethylene glycol bis(2-aminoethyl)tetraacetic acid (ISO)

gallic acid (ISO)

genistein (ISO)

gentamycin (EXP)

geraniol (ISO)

heptan-2-one (ISO)

inulin (ISO)

isoprenaline (ISO)

lead(0) (ISO)

lipopolysaccharide (ISO)

maneb (ISO)

methylmercury chloride (ISO)

N-nitrosodiethylamine (EXP)

nickel sulfate (ISO)

nonanedioic acid (ISO)

octanal (ISO)

paracetamol (ISO)

paraquat (ISO)

PCB138 (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenethyl caffeate (EXP)

pirinixic acid (ISO)

potassium dichromate (ISO)

rifampicin (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

Soman (EXP)

sunitinib (ISO)

testosterone (EXP)

thimerosal (ISO)

triptonide (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adenylate cyclase-activating dopamine receptor signaling pathway (ISO)

adenylate cyclase-activating G protein-coupled receptor signaling pathway (ISO)

adenylate cyclase-modulating G protein-coupled receptor signaling pathway (IBA)

cellular response to dopamine (IMP)

G protein-coupled receptor signaling pathway (IEA)

regulation of long-term synaptic depression (IMP)

response to amphetamine (ISO)

response to caffeine (ISO)

sensory perception of smell (ISO)

Cellular Component

heterotrimeric G-protein complex (IBA)

plasma membrane (IEA,TAS)

Molecular Function

G protein-coupled receptor binding (IBA)

G-protein beta/gamma-subunit complex binding (IBA,IEA)

GTP binding (IEA)

GTPase activity (IBA,IEA)

metal ion binding (IEA)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

calcium/calcium-mediated signaling pathway (IEA)

Chagas disease pathway (IEA)

dopamine signaling pathway via D1 family of receptors (ISO)

endothelin signaling pathway (ISO)

Entamoebiasis pathway (IEA)

G protein mediated signaling pathway via Galphas family (ISO)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

abnormal locomotor behavior (IMP)

abnormal motor learning (IMP)

decreased synaptic depression (IMP)

postnatal growth retardation (IMP)

postnatal lethality (IMP)

reduced long-term depression (IMP)

References

References - curated

#	Reference Title	Reference Citation
1.	Ga(olf) mutation allows parsing the role of cAMP-dependent and extracellular signal-regulated kinase-dependent signaling in L-3,4-dihydroxyphenylalanine-induced dyskinesia.	Alcacer C, etal., J Neurosci. 2012 Apr 25;32(17):5900-10. doi: 10.1523/JNEUROSCI.0837-12.2012.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	New genetic insights highlight 'old' ideas on motor dysfunction in dystonia.	Goodchild RE, etal., Trends Neurosci. 2013 Dec;36(12):717-25. doi: 10.1016/j.tins.2013.09.003. Epub 2013 Oct 18.
5.	Molecular analysis of the multiple Golf alpha subunit mRNAs in the rat brain.	Herve D, etal., Brain Res Mol Brain Res 1995 Aug;32(1):125-34.
6.	Alpha-latrotoxin receptor, latrophilin, is a novel member of the secretin family of G protein-coupled receptors.	Lelianova VG, etal., J Biol Chem 1997 Aug 22;272(34):21504-8.
7.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
8.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
10.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
11.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
12.	GOA pipeline	RGD automated data pipeline
13.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
14.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
15.	Comprehensive gene review and curation	RGD comprehensive gene curation
16.	Quantitative Proteomic Study Reveals Up-Regulation of cAMP Signaling Pathway-Related Proteins in Mild Traumatic Brain Injury.	Song H, etal., J Proteome Res. 2018 Feb 2;17(2):858-869. doi: 10.1021/acs.jproteome.7b00618. Epub 2017 Dec 27.
17.	Gene-based anchoring of the rat genetic linkage and cytogenetic maps: new regional localizations, orientation of the linkage groups, and insights into mammalian chromosome evolution.	Szpirer C, etal., Mamm Genome 1998 Sep;9(9):721-34
18.	Impaired dopamine- and adenosine-mediated signaling and plasticity in a novel rodent model for DYT25 dystonia.	Yu-Taeger L, etal., Neurobiol Dis. 2020 Feb;134:104634. doi: 10.1016/j.nbd.2019.104634. Epub 2019 Oct 31.

Additional References at PubMed

PMID:2499043	PMID:9459443	PMID:11404425	PMID:12488442	PMID:12832082	PMID:15908736	PMID:16310044	PMID:17194762	PMID:21171433	PMID:23533145	PMID:26934374

Genomics

Comparative Map Data

Gnal
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	18	60,622,311 - 60,762,599 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	60,622,311 - 60,762,599 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	18	62,697,583 - 62,835,273 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	63,396,310 - 63,534,014 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	61,243,031 - 61,383,188 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	62,805,406 - 62,946,133 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	62,805,410 - 62,944,630 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	18	61,991,738 - 62,131,420 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	18	63,595,606 - 63,735,803 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	18	63,668,806 - 63,809,004 (+)	NCBI
Celera	18	58,730,137 - 58,870,361 (+)	NCBI		Celera
Cytogenetic Map	18	q12.1	NCBI

GNAL
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	18	11,689,264 - 11,885,685 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	18	11,689,264 - 11,885,685 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	18	11,689,263 - 11,885,684 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	18	11,679,263 - 11,871,922 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	18	11,679,264 - 11,871,919	NCBI
Celera	18	11,568,478 - 11,764,014 (+)	NCBI		Celera
Cytogenetic Map	18	p11.21	NCBI
HuRef	18	11,644,058 - 11,840,338 (+)	NCBI		HuRef
CHM1_1	18	11,688,387 - 11,885,176 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	18	11,851,607 - 12,048,391 (+)	NCBI		T2T-CHM13v2.0

Gnal
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	18	67,221,369 - 67,359,863 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	18	67,221,287 - 67,359,863 (+)	Ensembl		GRCm39 Ensembl
GRCm38	18	67,088,298 - 67,226,792 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	18	67,088,216 - 67,226,792 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	18	67,247,990 - 67,386,446 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	18	67,213,705 - 67,349,624 (+)	NCBI		MGSCv36	mm8
Celera	18	68,356,933 - 68,494,863 (+)	NCBI		Celera
Cytogenetic Map	18	E1	NCBI
cM Map	18	39.85	NCBI

Gnal
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955402	1,181,133 - 1,248,616 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955402	1,182,515 - 1,249,301 (-)	NCBI	ChiLan1.0	ChiLan1.0

GNAL
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	18	11,835,143 - 12,026,963 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	18	2,420,578 - 2,615,947 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	18	4,684,622 - 4,818,026 (-)	NCBI	panpan1.1	PanPan1.1	panPan2

GNAL
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	7	77,378,134 - 77,521,215 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	7	77,413,986 - 77,521,042 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	7	76,779,701 - 76,925,568 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	7	77,435,802 - 77,579,609 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	7	77,435,223 - 77,581,670 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	7	77,133,536 - 77,276,782 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	7	77,179,815 - 77,323,366 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	7	77,466,820 - 77,610,501 (+)	NCBI		UU_Cfam_GSD_1.0

Gnal
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404944	1,140,980 - 1,232,788 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936626	373,433 - 460,788 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936626	372,893 - 460,884 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GNAL
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	97,342,474 - 97,429,364 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	97,342,468 - 97,429,334 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	90,674,125 - 90,703,582 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GNAL
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	18	69,508,254 - 69,699,628 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	18	69,510,512 - 69,635,000 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666050	44,505,410 - 44,707,045 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gnal
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624770	19,433,660 - 19,504,698 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624770	19,433,614 - 19,504,759 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Gnal
957 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	50
Count of miRNA genes:	46
Interacting mature miRNAs:	50
Transcripts:	ENSRNOT00000025172
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2293708	Bss46	Bone structure and strength QTL 46	8.8	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	18	11791518	63636873	Rat
1578661	Bss20	Bone structure and strength QTL 20	3.7		femur morphology trait (VT:0000559)	femoral neck cross-sectional area (CMO:0001697)	18	11791518	83218561	Rat
1578667	Bss21	Bone structure and strength QTL 21	3.5		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	18	11791518	83218561	Rat
1358193	Emca2	Estrogen-induced mammary cancer QTL 2	1.6		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	18	18007599	63571040	Rat
1600373	Mamtr6	Mammary tumor resistance QTL 6			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	18	19278901	83218561	Rat
1331741	Bp232	Blood pressure QTL 232	3.59112		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	21372893	83213037	Rat
1331733	Bp233	Blood pressure QTL 233	3.97196		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	24796977	79788953	Rat
2325839	Bp348	Blood pressure QTL 348		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	25570985	70570985	Rat
2293704	Bss35	Bone structure and strength QTL 35	4.59	0.0002	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	18	28964853	73964853	Rat
2300157	Bmd66	Bone mineral density QTL 66	13.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	18	28964853	73964853	Rat
2300177	Bmd65	Bone mineral density QTL 65	19.7	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	18	28964853	73964853	Rat
9589816	Gluco68	Glucose level QTL 68	7.25	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	18	29792965	74792965	Rat
8694378	Bw157	Body weight QTL 157	3.59	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	18	29792965	74792965	Rat
9590318	Scort22	Serum corticosterone level QTL 22	7.64	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	18	29792965	74792965	Rat
1331754	Bp230	Blood pressure QTL 230	4.61609		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	29792965	74792965	Rat
738005	Anxrr11	Anxiety related response QTL 11	3.4		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	18	30039813	75039813	Rat
1331727	Bp237	Blood pressure QTL 237	3.053		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31359408	61698465	Rat
61429	Cia17	Collagen induced arthritis QTL 17	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	18	31359408	70263868	Rat
2303120	Mamtr8	Mammary tumor resistance QTL 8		0.001	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	18	31359408	83218561	Rat
631274	Sprol1	Serum protein level QTL 1	5.3		blood total protein amount (VT:0005567)	serum total protein level (CMO:0000661)	18	31393320	77209694	Rat
631518	Bw11	Body weight QTL 11	2.8		body mass (VT:0001259)	body weight (CMO:0000012)	18	35870723	80870723	Rat
61367	Iddm4	Insulin dependent diabetes mellitus QTL 4	2.33	0.0074	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	18	38192455	83192455	Rat
1598826	Anxrr20	Anxiety related response QTL 20	3.04		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	18	41432971	83828827	Rat
6893683	Bw110	Body weight QTL 110	2.7	0.002	body mass (VT:0001259)	body weight (CMO:0000012)	18	43345022	83828827	Rat
8694366	Abfw8	Abdominal fat weight QTL 8	6.38	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	18	46640675	83828827	Rat
8694432	Bw165	Body weight QTL 165	3.81	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	18	46640675	83828827	Rat
9589041	Epfw12	Epididymal fat weight QTL 12	17.08	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	18	46640675	83828827	Rat
2303571	Bw92	Body weight QTL 92	3		body mass (VT:0001259)	body weight (CMO:0000012)	18	48520044	83828827	Rat
2303584	Gluco55	Glucose level QTL 55	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	18	48520044	83828827	Rat
7411719	Strs5	Sensitivity to stroke QTL 5	9.4		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	18	49999958	65845095	Rat
2293658	Bmd23	Bone mineral density QTL 23	7.3	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	18	51464733	63636873	Rat
738008	Hcar14	Hepatocarcinoma resistance QTL 14	4.3		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion number (CMO:0001462)	18	51464733	83218561	Rat
1331752	Bw27	Body weight QTL 27	2.963		body mass (VT:0001259)	body weight (CMO:0000012)	18	52292875	65845095	Rat
1359020	Ppulsi2	Prepulse inhibition QTL 2	2.71		prepulse inhibition trait (VT:0003088)	acoustic startle response measurement (CMO:0001519)	18	52292875	73997283	Rat
1600375	Mcs22	Mammary carcinoma susceptibility QTL 22	3.3		mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	18	52539763	63933058	Rat
631509	Sald2	Serum aldosterone level QTL 2	2.9		blood aldosterone amount (VT:0005346)	serum aldosterone level (CMO:0000487)	18	52539763	69140759	Rat
12880368	Bw187	Body weight QTL 187		0.045	body mass (VT:0001259)	body weight (CMO:0000012)	18	52539763	76104388	Rat
12904067	Cm122	Cardiac mass QTL 122		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	18	52539763	76104388	Rat
12904069	Cm123	Cardiac mass QTL 123		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	18	52539763	76104388	Rat
12904070	Cm124	Cardiac mass QTL 124		0.01	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	18	52539763	76104388	Rat
12904071	Am18	Aortic mass QTL 18		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	18	52539763	76104388	Rat
12904073	Kidm71	Kidney mass QTL 71		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	18	52539763	76104388	Rat
2301417	Bp319	Blood pressure QTL 319		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	52539763	76104388	Rat
1300125	Rf26	Renal function QTL 26	3.2		urine potassium amount (VT:0010539)	urine potassium excretion rate (CMO:0000761)	18	52539863	65844950	Rat
1298072	Cia26	Collagen induced arthritis QTL 26	3.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	18	54709769	83828827	Rat
631834	Sach3	Saccharin preference QTL 3	3.9	0.01	consumption behavior trait (VT:0002069)	calculated saccharin drink intake volume (CMO:0001600)	18	58805687	63636873	Rat
724542	Kidm2	Kidney mass QTL 2	2.6		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	18	59172115	83828827	Rat
2312600	Bp341	Blood pressure QTL 341		0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	59330409	70263868	Rat
2301969	Bp324	Blood pressure QTL 324	4.05		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	59712417	76477814	Rat
70185	BpQTLcluster15	Blood pressure QTL cluster 15	4.61		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	59712417	76477814	Rat
70185	BpQTLcluster15	Blood pressure QTL cluster 15	4.61		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	59712417	76477814	Rat
70185	BpQTLcluster15	Blood pressure QTL cluster 15	4.61		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	18	59712417	76477814	Rat
70185	BpQTLcluster15	Blood pressure QTL cluster 15	4.61		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	18	59712417	76477814	Rat
1331770	Bp234	Blood pressure QTL 234	3.807		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	59796478	71893566	Rat
6903353	Bp353	Blood pressure QTL 353	2.8		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	59796478	83828827	Rat
6903356	Bp354	Blood pressure QTL 354	4.6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	59796478	83828827	Rat
61384	Bp48	Blood pressure QTL 48	19.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	60622311	77209844	Rat
631675	Iddm15	Insulin dependent diabetes mellitus QTL 15			urine glucose amount (VT:0001758)	percentage of study population developing diabetes mellitus during a period of time (CMO:0001114)	18	60622311	77209844	Rat

Markers in Region

D18Wox11

Rat Assembly	Chr	Position (strand)	Source	JBrowse
RGSC_v3.4	18	63,737,840 - 63,737,956	UniSTS	RGSC3.4
RGSC_v3.4	18	63,737,839 - 63,737,956	RGD	RGSC3.4
RGSC_v3.1	18	63,811,040 - 63,811,157	RGD
Celera	18	58,870,895 - 58,871,011	UniSTS
RH 3.4 Map	18	616.3	RGD
RH 2.0 Map	18	298.8	RGD

D18Mit17

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	60,763,132 - 60,763,249 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	62,946,667 - 62,946,783	NCBI	Rnor6.0
Rnor_5.0	18	62,133,457 - 62,133,573	UniSTS	Rnor5.0
RGSC_v3.4	18	32,458,754 - 32,458,974	RGD	RGSC3.4
RGSC_v3.4	18	63,737,840 - 63,737,956	UniSTS	RGSC3.4
RGSC_v3.1	18	63,811,040 - 63,811,157	RGD
Celera	18	58,870,895 - 58,871,011	UniSTS
RH 3.4 Map	18	616.3	UniSTS
Cytogenetic Map	18	q12.1	UniSTS
Cytogenetic Map	18	q12.1-q12.2	UniSTS

D18Rat89

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	60,722,286 - 60,722,497 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	62,905,559 - 62,905,769	NCBI	Rnor6.0
Rnor_5.0	18	62,092,349 - 62,092,559	UniSTS	Rnor5.0
RGSC_v3.4	18	63,697,004 - 63,697,215	RGD	RGSC3.4
RGSC_v3.4	18	63,697,005 - 63,697,215	UniSTS	RGSC3.4
RGSC_v3.1	18	63,770,206 - 63,770,416	RGD
Celera	18	58,830,032 - 58,830,242	UniSTS
RH 3.4 Map	18	610.5	RGD
RH 3.4 Map	18	610.5	UniSTS
RH 2.0 Map	18	300.8	RGD
SHRSP x BN Map	18	35.3999	RGD
Cytogenetic Map	18	q12.1-q12.2	UniSTS

D18Arb5

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	60,763,053 - 60,763,320 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	62,946,588 - 62,946,854	NCBI	Rnor6.0
Rnor_5.0	18	62,133,378 - 62,133,644	UniSTS	Rnor5.0
RGSC_v3.4	18	63,737,760 - 63,738,027	RGD	RGSC3.4
RGSC_v3.4	18	63,737,761 - 63,738,027	UniSTS	RGSC3.4
RGSC_v3.1	18	63,810,961 - 63,811,228	RGD
Celera	18	58,870,816 - 58,871,082	UniSTS
FHH x ACI Map	18	41.94	RGD
FHH x ACI Map	18	41.94	UniSTS
Cytogenetic Map	18	q12.1	UniSTS
Cytogenetic Map	18	q12.1-q12.2	UniSTS

RH129239

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	60,741,670 - 60,741,886 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	62,924,942 - 62,925,157	NCBI	Rnor6.0
Rnor_5.0	18	62,111,732 - 62,111,947	UniSTS	Rnor5.0
RGSC_v3.4	18	63,716,388 - 63,716,603	UniSTS	RGSC3.4
Celera	18	58,849,449 - 58,849,664	UniSTS
RH 3.4 Map	18	615.3	UniSTS
Cytogenetic Map	18	q12.1	UniSTS
Cytogenetic Map	18	q12.1-q12.2	UniSTS

RH129499

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	60,741,670 - 60,741,878 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	62,924,942 - 62,925,149	NCBI	Rnor6.0
Rnor_5.0	18	62,111,732 - 62,111,939	UniSTS	Rnor5.0
RGSC_v3.4	18	63,716,388 - 63,716,595	UniSTS	RGSC3.4
Celera	18	58,849,449 - 58,849,656	UniSTS
RH 3.4 Map	18	616.3	UniSTS
Cytogenetic Map	18	q12.1	UniSTS
Cytogenetic Map	18	q12.1-q12.2	UniSTS

RH144614

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	60,737,983 - 60,738,174 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	62,921,255 - 62,921,445	NCBI	Rnor6.0
Rnor_5.0	18	62,108,045 - 62,108,235	UniSTS	Rnor5.0
RGSC_v3.4	18	63,712,701 - 63,712,891	UniSTS	RGSC3.4
Celera	18	58,845,762 - 58,845,952	UniSTS
RH 3.4 Map	18	614.4	UniSTS
Cytogenetic Map	18	q12.1-q12.2	UniSTS

BF417987

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	60,672,584 - 60,672,731 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	62,855,889 - 62,856,035	NCBI	Rnor6.0
Rnor_5.0	18	62,042,184 - 62,042,330	UniSTS	Rnor5.0
RGSC_v3.4	18	63,646,962 - 63,647,108	UniSTS	RGSC3.4
Celera	18	58,780,404 - 58,780,550	UniSTS
RH 3.4 Map	18	611.4	UniSTS
Cytogenetic Map	18	q12.1-q12.2	UniSTS

UniSTS:237833

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	60,740,919 - 60,741,119 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	62,924,191 - 62,924,390	NCBI	Rnor6.0
Rnor_5.0	18	62,110,981 - 62,111,180	UniSTS	Rnor5.0
RGSC_v3.4	18	63,715,637 - 63,715,836	UniSTS	RGSC3.4
Celera	18	58,848,698 - 58,848,897	UniSTS
Cytogenetic Map	18	q12.1	UniSTS
Cytogenetic Map	18	q12.1-q12.2	UniSTS

Related Rat Strains

The following Strains have been annotated to Gnal

BB.SHR-(Gnal-D18Mit9)/K

Genetic Models

This gene Gnal is modified in the following models/strains

SD-Gnal^em1Hpng-/-

SD-Gnal^em1Hpng+/-

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium								1	60			5
Low	3	30	36	20	19	20	8	9	14	35	35	6	8
Below cutoff		13	21	21		21		1			5

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001191836	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473971	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000301	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	S80330	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	S80376	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000025172 ⟹ ENSRNOP00000025172

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	18	60,622,311 - 60,762,599 (+)	Ensembl
Rnor_6.0 Ensembl	18	62,850,588 - 62,944,627 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000086679 ⟹ ENSRNOP00000073266

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	18	60,622,311 - 60,724,082 (+)	Ensembl
Rnor_6.0 Ensembl	18	62,805,410 - 62,944,630 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000087673 ⟹ ENSRNOP00000074114

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	18	60,666,501 - 60,762,599 (+)	Ensembl
Rnor_6.0 Ensembl	18	62,852,303 - 62,944,627 (+)	Ensembl

RefSeq Acc Id:

NM_001191836 ⟹ NP_001178765

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	18	60,622,311 - 60,762,599 (+)	NCBI
Rnor_6.0	18	62,805,406 - 62,946,133 (+)	NCBI
Rnor_5.0	18	61,991,738 - 62,131,420 (+)	NCBI
Celera	18	58,730,137 - 58,870,361 (+)	NCBI

Sequence:

show sequence

GTTCGGAGGATGCACAATGGCCCCTCCGGGCAGTGAGGGGCCGTGGCCCCGGAGCCGGACCTAC
CGCAGCCACGCCCCGCAGCCGGACCCCCGGGGTCCGAGTGCAGCGCTGCCTTCGGAGTCGGCCA
GAGCTCCGGTCTGACCCGCGGGGACTTGCCCGCGCCCCGCGCCTCGATGGGCCTGTGCTACAGC
CTACGGCCGCTGCTCTTCGGGAGCTCGGGGGACGCCCCCTGTGAGGACTCTGAGCCGTGCGCTG
AGGATGCTCAGCCCAGCGCCGCCCGGGCCCCGGCCCCGGCCCCGATCCCAGCCCCGGCTCCGGT
GGGGACCCTGCTCCGGCGAGGCGACGGCCGGATCCCCGCAAGCGCGAGGTCGCCAGTCGAGCTG
CAGAACCGCCGGCGACAGGAGCAGCTGCGAGCCGAGGAGCGCGAGGCAGCTAAGGAGGCGAGGA
AAGTAAGCCGGGGTATCGACCGCATGCTGCGCGAACAGAAGCGCGACCTGCAGCAGACGCACCG
GCTCCTGCTCTTGGGGGCTGGTGAGTCCGGGAAAAGCACTATAGTCAAACAGATGAGGATCCTA
CACGTCAATGGCTTCAACCCCGAGGAAAAGAAGCAGAAAATTCTGGACATCAGGAAAAATGTCA
AAGATGCTATTGTGACAATCGTTTCAGCAATGAGTACCATAATACCTCCAGTTCCACTGGCCAA
CCCTGAGAACCAGTTTCGGTCAGATTACATCAAGAGCATAGCCCCTATCACTGACTTTGAATAT
TCCCAGGAGTTCTTTGACCACGTGAAGAAGCTGTGGGATGATGAGGGAGTGAAGGCCTGCTTTG
AGAGATCCAACGAGTACCAGCTGATCGACTGTGCACAATACTTCCTGGAAAGGATTGACAGCGT
GAGTCTGGTTGACTACACACCCACAGACCAGGACCTACTCAGATGCAGAGTGCTGACATCAGGG
ATCTTTGAGACACGATTCCAAGTGGACAAAGTGAACTTTCACATGTTTGACGTTGGAGGCCAGA
GGGATGAGAGAAGAAAATGGATCCAGTGTTTTAACGATGTCACTGCCATCATCTATGTGGCAGC
CTGCAGCAGCTACAACATGGTGATCCGGGAAGATAACAACACCAACAGACTCCGGGAGTCGCTG
GACCTGTTTGAAAGCATCTGGAATAACAGGTGGTTACGAACCATTTCCATCATCCTGTTCTTGA
ACAAACAAGATATGCTGGCAGAAAAAGTCTTGGCAGGGAAGTCAAAAATTGAAGACTATTTCCC
GGAGTATGCCAACTATACTGTCCCTGAAGATGCAACACCAGATGCAGGAGAAGATCCCAAAGTT
ACAAGAGCCAAGTTCTTTATCCGGGATCTGTTCTTGAGGATCAGCACAGCCACGGGTGATGGCA
AACATTACTGCTACCCTCACTTCACCTGCGCCGTGGACACAGAGAACATCCGCAGAGTGTTCAA
CGATTGTCGTGACATCATCCAGAGAATGCACCTCAAGCAGTACGAACTCTTGTGAGGGCCACCC
ACCCACCCCTCCTCCTCCTCACTGCTGCCTTTCCTCCCTCTTGACCACCCCATGAGGCAGCATA
TCCCCCTAGCCTGCGTGTCTGTCCACCCCGAGCCAAGGTAGGGAGTAGTGAGTGTCTAGTGTCA
TCGGACTGCCGTCTGTCCTGTCCTAGGTATGCCTATGTGTGACCACCAAGCCTCTGGCTACCTC
TGTTCCCCAAGGTTTGGTTCTGTGACTTTGTTTTCACTGGACAAAACAGCCTCCCACCACCAAT
TTGTATCCCCGTATCACCCTCTGGGTGGTACTGCAGTGGATTTTCTCTGGGTGGGAATCTATTT
ATTCTTTGATGGAATGGTTGATGGGTTGAATCATCAAAGACAGCTTGGTGAACGGGGGAAATAC
ATTGTTTTCAAGTTATCAAGCATGATCACAAAACTGTCCGGACAGTGCCACGCACTTGGTTTTT
CCCTTTATAAAAGGTTGGGCTACCCAGTGTCTGCCCCTTCTGGTCTGCATTGGCCCAGGGCTTA
AAGCAGATCCACGTCAGCAACAGAAGACGAGGACCTTTTTCAGCCACAGTTGCAATGGCTATAA
GCCTTGGGCATTTGGGTTAGAGCACTTCTGGGAGCCTTTTACACTTGGGCAGAAAGCCGGCCAC
ATTCACTACTAATGGTGTCCTGTCTATAAACAAGGGGTCCTCTACACCTTCCTGATAGCTGGGC
ATAGTCCTTCCTGTCTTCTTTCTGTTGTTGCTTTACCAGACTGTACAGACCACAAGATGTACTA
CTCTTTTCTGTGGCTACTCCAGAAGCCTCCTTGTAGAGTTCCGTGCCTTGGTGGCGGCTATACC
TGTAAGGAAACGTGTCCCTCCTGTGCCAAGCAGCCTGCAGTCCACACAGCCTGCTGCTTCACAG
TGGGGAATCAGTAGTATCTGCCCATCTTAGGATATTTTTATCAGGTTGGCACTTATGGAAGACT
CGGTGATTTTAGAATCATCCACTTTACCAGCAGTATCTTCCCAACACTGAAACTGTTGCAGCCA
CCCGCTTTTACTGCTCCAAACCTGAGCTGCTGCACACATTGGGATGACCCGCTTTCAAGGCTTA
AATTACAATCAATTCTTTTTTCAGGGTTCTAAGGGGTTCCCCCCCACTCCCCTCTCAAGGTGAT
CAGTTTTCAATGACCCCTTCAAGTTCTGTAGTCAGGAGCAGGCCAACCATCCCTTAGTTAAGTT
CTACACACAGGCCACCAAACAAGAAACCGGTGGTCAGAGGAAAGCACAGGGGTGTCCATGTTGT
ATATGGCTGAGGACAATAAGGATGATGTCATCTGAAGATGAAATATACAAAACTACTTATTTAT
TATCTGTCTCTCTATTTGCTAGGGATGAGCCCAGCACCTAGTGCATGCTAGGCAAGCACTCTAC
AGCTAGTCCATATCCCCAGCCACAACTCCAGCCCTCACAAAAACCTTTATTTTAAATATAAAGA
CAAAATAAATGGCTTCTCCTCA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001178765	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAP32222	(Get FASTA)	NCBI Sequence Viewer
	AAP32223	(Get FASTA)	NCBI Sequence Viewer
	EDM14716	(Get FASTA)	NCBI Sequence Viewer
	P38406	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001178765 ⟸ NM_001191836

- UniProtKB:

Q64711 (UniProtKB/Swiss-Prot), P38406 (UniProtKB/Swiss-Prot), G3V8E8 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MGLCYSLRPLLFGSSGDAPCEDSEPCAEDAQPSAARAPAPAPIPAPAPVGTLLRRGDGRIPASA
RSPVELQNRRRQEQLRAEEREAAKEARKVSRGIDRMLREQKRDLQQTHRLLLLGAGESGKSTIV
KQMRILHVNGFNPEEKKQKILDIRKNVKDAIVTIVSAMSTIIPPVPLANPENQFRSDYIKSIAP
ITDFEYSQEFFDHVKKLWDDEGVKACFERSNEYQLIDCAQYFLERIDSVSLVDYTPTDQDLLRC
RVLTSGIFETRFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIYVAACSSYNMVIREDNNTN
RLRESLDLFESIWNNRWLRTISIILFLNKQDMLAEKVLAGKSKIEDYFPEYANYTVPEDATPDA
GEDPKVTRAKFFIRDLFLRISTATGDGKHYCYPHFTCAVDTENIRRVFNDCRDIIQRMHLKQYE
LL

hide sequence

RefSeq Acc Id:

ENSRNOP00000074114 ⟸ ENSRNOT00000087673

RefSeq Acc Id:

ENSRNOP00000073266 ⟸ ENSRNOT00000086679

RefSeq Acc Id:

ENSRNOP00000025172 ⟸ ENSRNOT00000025172

Protein Domains

G-alpha

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P38406-F1-model_v2	AlphaFold	P38406	1-381	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2715	AgrOrtholog
BioCyc Gene	G2FUF-7160	BioCyc
Ensembl Genes	ENSRNOG00000010440	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000025172	ENTREZGENE
	ENSRNOP00000025172.8	UniProtKB/TrEMBL
	ENSRNOP00000073266.2	UniProtKB/TrEMBL
	ENSRNOP00000074114.2	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000025172	ENTREZGENE
	ENSRNOT00000025172.8	UniProtKB/TrEMBL
	ENSRNOT00000086679.2	UniProtKB/TrEMBL
	ENSRNOT00000087673.2	UniProtKB/TrEMBL
Gene3D-CATH	1.10.400.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	3.40.50.300	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	Gprotein_alpha_S	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Gprotein_alpha_su	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GproteinA_insert	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	P-loop_NTPase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:24611	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene	24611	ENTREZGENE
PANTHER	GUANINE NUCLEOTIDE-BINDING PROTEIN G(OLF) SUBUNIT ALPHA	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR10218	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	G-alpha	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Gnal	PhenoGen
PRINTS	GPROTEINA	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPROTEINAS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	G_ALPHA	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	G_alpha	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF47895	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SSF52540	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A0G2K526_RAT	UniProtKB/TrEMBL
	A0A0G2K795_RAT	UniProtKB/TrEMBL
	A6IXT5_RAT	UniProtKB/TrEMBL
	G3V8E8	ENTREZGENE, UniProtKB/TrEMBL
	GNAL_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q64711	ENTREZGENE
UniProt Secondary	Q64711	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-05-20	Gnal	G protein subunit alpha L	Gnal	guanine nucleotide binding protein, alpha activating activity polypeptide, olfactory type	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2015-05-18	Gnal	guanine nucleotide binding protein, alpha activating activity polypeptide, olfactory type	Gnal	guanine nucleotide binding protein, alpha stimulating, olfactory type	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2009-01-07	Gnal	guanine nucleotide binding protein, alpha stimulating, olfactory type	RGD1305940	similar to RIKEN cDNA 9630020G10 gene	Data Merged	737654	APPROVED
2008-04-30	RGD1305940	similar to RIKEN cDNA 9630020G10 gene	RGD1305940_predicted	similar to RIKEN cDNA 9630020G10 gene (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-20	RGD1305940_predicted	similar to RIKEN cDNA 9630020G10 gene (predicted)	LOC361343_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-20	Gnal	guanine nucleotide binding protein, alpha stimulating, olfactory type			Symbol and Name status set to approved	1299863	APPROVED
2005-01-12	LOC361343_predicted	similar to RIKEN cDNA 9630020G10 gene (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL
2002-06-10	Gnal	guanine nucleotide binding protein, alpha stimulating, olfactory type			Name updated	70585	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed primarily in brain tissue, olfactory neurons but not in liver, eye, kidney or testis	61489
gene_process	activates adenylate cyclase

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Mammalian Phenotype

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Mammalian Phenotype