Edn1 (endothelin 1) - Rat Genome Database

Name: Edn1
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Edn1 (endothelin 1) Rattus norvegicus

Analyze

Symbol:

Edn1

Name:

endothelin 1

RGD ID:

2532

Description:

Enables endothelin A receptor binding activity and endothelin B receptor binding activity. Involved in several processes, including cellular response to cytokine stimulus; regulation of secretion by cell; and response to corticosteroid. Located in several cellular components, including Weibel-Palade body; basal part of cell; and rough endoplasmic reticulum lumen. Used to study adult respiratory distress syndrome; coronary artery disease; membranoproliferative glomerulonephritis; metabolic acidosis; and portal hypertension. Biomarker of several diseases, including artery disease (multiple); heart disease (multiple); kidney failure (multiple); lung disease (multiple); and nephritis (multiple). Human ortholog(s) of this gene implicated in several diseases, including artery disease (multiple); bronchial disease (multiple); obesity; obstructive sleep apnea; and rheumatoid arthritis. Orthologous to human EDN1 (endothelin 1); PARTICIPATES IN inflammatory response pathway; endothelin signaling pathway; hypoxia inducible factor pathway; INTERACTS WITH (+)-catechin; (R)-noradrenaline; 1,3-dinitrobenzene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

endothelin-1; ET-1; Et1; PPET1; preproendothelin-1

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	EDN1 (endothelin 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Edn1 (endothelin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Edn1 (endothelin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	EDN1 (endothelin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	EDN1 (endothelin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Edn1 (endothelin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	EDN1 (endothelin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	EDN1 (endothelin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Edn1 (endothelin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Edn1 (endothelin 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	EDN1 (endothelin 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	edn1 (endothelin 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	edn1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)

Is Marker For:

Strains: SD F344.OLETF-(D17Mgh4-Edn1)/Tj
QTLs: Niddm32

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	17	22,454,924 - 22,460,812 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	22,454,420 - 22,460,885 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	17	22,330,779 - 22,336,694 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	23,934,458 - 23,940,375 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	22,266,095 - 22,271,993 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	22,136,814 - 22,143,745 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	22,137,324 - 22,143,324 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	17	24,117,499 - 24,124,188 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	17	28,303,886 - 28,309,775 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	17	28,306,726 - 28,312,616 (-)	NCBI
Celera	17	22,134,975 - 22,140,901 (-)	NCBI		Celera
Cytogenetic Map	17	p12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

acute kidney failure (ISO)

Acute Lung Injury (ISO)

adult respiratory distress syndrome (IDA,IEP,ISO)

Albuminuria (IEP)

angle-closure glaucoma (ISO)

anterolateral myocardial infarction (ISO)

aortic atherosclerosis (ISO)

aspiration pneumonia (IEP)

asthma (ISO)

atherosclerosis (ISO)

atrial fibrillation (ISO)

Auriculocondylar Syndrome (ISO)

Auriculocondylar Syndrome 3 (ISO)

autosomal dominant polycystic kidney disease (ISO)

Behcet's disease (ISO)

Bradycardia (ISO)

brain ischemia (IEP)

bronchiolitis obliterans (ISO)

bronchopulmonary dysplasia (IEP)

Cardiac Arrhythmias (ISO)

Cardiac Fibrosis (IDA)

Cardiomegaly (IEP,ISO)

cardiomyopathy (ISO)

Cardiovascular Abnormalities (ISO)

cardiovascular system disease (ISO)

cartilage disease (ISO)

cerebrovascular disease (ISO)

Chronic Bronchitis (ISO)

chronic obstructive pulmonary disease (ISO)

chronic rhinitis (ISO)

Chronic Tubulointerstitial Nephropathy (IEP)

congenital heart disease (ISO)

congestive heart failure (IEP,ISO)

coronary artery disease (IMP,ISO)

coronary stenosis (ISO)

Craniofacial Abnormalities (ISO)

cystic fibrosis (ISO)

Diabetic Nephropathies (ISO)

diabetic retinopathy (IEP,ISO)

Diaphragmatic Hernia (ISO)

dilated cardiomyopathy (ISO)

Dyspnea (ISO)

end stage renal disease (IEP)

Endotoxemia (IEP)

exfoliation syndrome (ISO)

Experimental Arthritis (ISO)

Experimental Diabetes Mellitus (IDA,IEP,ISO)

Experimental Liver Cirrhosis (ISO)

focal segmental glomerulosclerosis (ISO)

gastrointestinal system disease (ISO)

genetic disease (ISO)

heart disease (IEP)

hepatopulmonary syndrome (IEP)

hepatorenal syndrome (ISO)

Hyperalgesia (ISO)

Hypercapnia (IEP,ISO)

Hypercholesterolemia (ISO)

Hyperoxia (IEP)

hypertension (IEP,ISO)

hypertrophic cardiomyopathy (IEP)

Hypertrophy (ISO)

hypogonadism (IEP)

Hypotension (ISO)

impotence (IEP,ISO)

Inflammation (ISO)

intermediate coronary syndrome (ISO)

intracranial aneurysm (ISO)

kidney disease (ISO)

kidney failure (IEP,ISO)

Left Ventricular Hypertrophy (IDA,IEP,ISO)

Lewy body dementia (ISO)

liver cirrhosis (IEP)

low tension glaucoma (ISO)

major depressive disorder (ISO)

membranoproliferative glomerulonephritis (IEP,IMP)

metabolic acidosis (IDA)

middle cerebral artery infarction (ISO)

multiple sclerosis (ISO)

myocardial infarction (IEP,ISO)

Myocardial Ischemia (ISO)

Myocardial Reperfusion Injury (IEP,ISO)

Neoplasm Metastasis (ISO)

Neoplastic Cell Transformation (ISO)

neovascular glaucoma (ISO)

neovascular inflammatory vitreoretinopathy (ISO)

nephritis (IEP)

nephrosis (IEP,ISO)

nephrotic syndrome (ISO)

obesity (ISO)

obstructive sleep apnea (IEP,ISO)

optic nerve disease (ISO)

Optic Nerve Injuries (IEP)

Oral Ulcer (ISO)

ovarian carcinoma (ISO)

overactive bladder syndrome (ISO)

Pain (ISO)

Parkinson's disease (ISO)

peptic ulcer disease (ISO)

pneumonia (ISO)

Pneumoperitoneum (IEP)

portal hypertension (IDA)

pre-eclampsia (ISO)

Pregnancy-Induced Hypertension (ISO)

Premature Birth (ISO)

Presbycusis (ISO)

primary open angle glaucoma (ISO)

pulmonary embolism (IEP)

pulmonary fibrosis (IEP,ISO)

pulmonary hypertension (IEP,ISO)

Question Mark Ears, Isolated (ISO)

renal artery disease (IEP)

Reperfusion Injury (IEP,ISO)

retinal degeneration (ISO)

retinal detachment (ISO)

retinitis pigmentosa (ISO)

rheumatoid arthritis (ISO)

Sepsis (IEP)

Slow Coronary Flow (ISO)

Stroke (ISO)

Subarachnoid Hemorrhage (ISO)

systemic scleroderma (ISO)

type 1 diabetes mellitus (ISO)

type 2 diabetes mellitus (IEP,ISO)

uremia (IEP)

ureteral obstruction (IEP,ISO)

Urinary Retention (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-catechin (EXP,ISO)

(-)-epigallocatechin 3-gallate (ISO)

(R)-noradrenaline (EXP)

(S)-nicotine (ISO)

1,2-dimethylhydrazine (ISO)

1,3-dinitrobenzene (EXP)

11-deoxycorticosterone (EXP)

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (ISO)

1D-myo-inositol 1,4,5-trisphosphate (EXP,ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-(3,4-dimethoxyphenyl)-5-\{[2-(3,4-dimethoxyphenyl)ethyl](methyl)amino\}-2-(propan-2-yl)pentanenitrile (ISO)

2-acetyl-1-alkyl-sn-glycero-3-phosphocholine (EXP)

2-butoxyethanol (ISO)

2-tert-butylhydroquinone (ISO)

3',5'-cyclic GMP (EXP)

3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine (EXP)

3,3',4,4',5-pentachlorobiphenyl (EXP)

3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

3H-1,2-dithiole-3-thione (EXP)

4,4'-diaminodiphenylmethane (EXP)

4,4'-sulfonyldiphenol (ISO)

4-hydroxy-TEMPO (EXP,ISO)

4-hydroxynon-2-enal (ISO)

4-hydroxyphenyl retinamide (ISO)

5-fluorouracil (ISO)

5-formyltetrahydrofolic acid (ISO)

6-propyl-2-thiouracil (EXP)

6alpha-methylprednisolone (EXP)

7,9-dihydro-1H-purine-2,6,8(3H)-trione (ISO)

7-NITROINDAZOLE (EXP)

8-bromo-3',5'-cyclic GMP (EXP,ISO)

acetamide (EXP)

acetylcholine (EXP)

acrolein (ISO)

actinomycin D (ISO)

afimoxifene (ISO)

aflatoxin B1 (ISO)

agmatine (ISO)

aldehydo-D-glucose (EXP,ISO)

aldosterone (EXP)

all-trans-retinoic acid (EXP,ISO)

alpha-Zearalanol (ISO)

aminoguanidine (EXP)

amlodipine (ISO)

ammonium chloride (EXP)

ampicillin (ISO)

andrographolide (ISO)

anthra[1,9-cd]pyrazol-6(2H)-one (ISO)

apocynin (EXP,ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

asbestos (ISO)

atenolol (ISO)

atorvastatin calcium (ISO)

atrasentan (EXP)

atropine (ISO)

Bardoxolone methyl (ISO)

belinostat (ISO)

benazepril (EXP)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

beta-carotene (ISO)

bezafibrate (EXP,ISO)

bilirubin IXalpha (ISO)

bis(2-chloroethyl) sulfide (ISO)

bis(2-ethylhexyl) phthalate (EXP)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

bleomycin A2 (EXP)

bosentan (EXP,ISO)

BQ 123 (EXP,ISO)

BQ 485 (EXP)

buta-1,3-diene (ISO)

Butylbenzyl phthalate (EXP)

cadmium atom (EXP,ISO)

cadmium dichloride (ISO)

caesium chloride (ISO)

caffeine (EXP)

Calcimycin (EXP)

calcitriol (ISO)

calcium atom (EXP,ISO)

calcium(0) (EXP,ISO)

Candesartan cilexetil (EXP)

capsaicin (ISO)

carbon atom (EXP)

carbon monoxide (EXP,ISO)

carbon nanotube (ISO)

carvedilol (EXP,ISO)

chelerythrine (EXP)

chenodeoxycholic acid (EXP)

chetomin (ISO)

chlordecone (ISO)

chlorpyrifos (ISO)

choline (ISO)

chromium(6+) (ISO)

chrysin (ISO)

cicaprost (ISO)

cis-caffeic acid (ISO)

cisplatin (EXP,ISO)

clofibrate (EXP)

cobalt dichloride (EXP,ISO)

cocaine (EXP,ISO)

coenzyme Q10 (ISO)

colforsin daropate hydrochloride (ISO)

copper atom (EXP)

copper(0) (EXP)

copper(II) sulfate (ISO)

corticosterone (EXP)

coumestrol (ISO)

crocidolite asbestos (ISO)

cycloheximide (ISO)

cyclophosphamide (ISO)

cyclosporin A (EXP,ISO)

cylindrospermopsin (ISO)

cytarabine (ISO)

D-glucose (EXP,ISO)

dantrolene (EXP)

dapsone (ISO)

daunorubicin (EXP)

Deoxycorticosterone acetate (EXP)

desferrioxamine B (EXP)

dexamethasone (ISO)

dextran sulfate (ISO)

diallyl disulfide (ISO)

diarsenic trioxide (ISO)

dibenziodolium (EXP,ISO)

dibenzo[a,l]pyrene (ISO)

dibutyl phthalate (EXP,ISO)

diclofenac (ISO)

diethyl phthalate (EXP)

diisobutyl phthalate (EXP)

diisononyl phthalate (EXP)

dimethylarsinic acid (ISO)

dimethylarsinous acid (ISO)

dioxygen (EXP,ISO)

diprotium oxide (ISO)

dorsomorphin (ISO)

doxorubicin (EXP,ISO)

dydrogesterone (ISO)

EC 3.4.15.1 (peptidyl-dipeptidase A) inhibitor (ISO)

elemental carbon (EXP)

enalapril (EXP)

enalaprilat dihydrate (ISO)

endosulfan (EXP)

entinostat (ISO)

ethanol (EXP,ISO)

etoposide (ISO)

fenofibrate (EXP,ISO)

fluoranthene (ISO)

folic acid (ISO)

formaldehyde (ISO)

fructose (EXP)

fulvestrant (ISO)

furan (EXP)

geldanamycin (ISO)

gemcitabine (ISO)

genistein (EXP,ISO)

gentamycin (EXP)

glucose (EXP,ISO)

glyburide (EXP)

glycidol (EXP)

glycoursodeoxycholic acid (ISO)

GW 4064 (EXP)

heparin (EXP,ISO)

hexadecanoic acid (ISO)

histamine (ISO)

homocysteine (ISO)

hydralazine (EXP)

hydrochlorothiazide (EXP)

hydrogen chloride (EXP)

hydrogen peroxide (EXP,ISO)

hydrogen sulfide (ISO)

hydroquinone (ISO)

ICI 118551 (ISO)

indometacin (EXP,ISO)

iodixanol (EXP)

iopromide (EXP)

irbesartan (ISO)

iron atom (EXP)

iron(0) (EXP)

iron(III) citrate (ISO)

isoprenaline (EXP)

isoquinoline-1,5-diol (EXP)

isorhamnetin (EXP)

isosorbide dinitrate (ISO)

ivermectin (ISO)

KT 5823 (EXP)

L-ascorbic acid (ISO)

L-mimosine (EXP,ISO)

lamivudine (ISO)

leflunomide (ISO)

leukotriene C4 (ISO)

levamisole (ISO)

linalool (ISO)

linoleic acid (ISO)

lipopolysaccharide (EXP,ISO)

lisinopril dihydrate (ISO)

losartan (EXP,ISO)

LY294002 (EXP)

Magnolol (EXP)

malathion (ISO)

manganese(II) chloride (EXP)

Meglumine sodium amidotrizoate (EXP)

melphalan (ISO)

menadione (ISO)

mercury dibromide (ISO)

mercury dichloride (EXP)

metformin (EXP,ISO)

methotrexate (ISO)

methoxychlor (EXP)

methyl 2-methylpropyl 2,6-dimethyl-4-(2-nitrophenyl)-1,4-dihydropyridine-3,5-dicarboxylate (ISO)

methyl beta-cyclodextrin (ISO)

methylarsonic acid (ISO)

methylisothiazolinone (ISO)

methylmercury chloride (ISO)

metoprolol (EXP)

mevalonic acid (ISO)

Mibefradil (EXP)

MK-2206 (ISO)

mono(2-ethylhexyl) phthalate (EXP)

monocrotaline (EXP)

montelukast (EXP)

N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide (EXP)

N-acetyl-L-cysteine (EXP,ISO)

N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO)

N-nitrosodiethylamine (EXP)

naphthalene (ISO)

nebivolol (ISO)

nickel atom (ISO)

nickel sulfate (ISO)

nicotine (ISO)

nicotinic acid-adenine dinucleotide phosphate (ISO)

nifedipine (EXP)

nimesulide (EXP)

nisoldipine (ISO)

nitric oxide (EXP,ISO)

nitrofen (EXP,ISO)

nitrogen dioxide (ISO)

nitroglycerin (EXP,ISO)

nitroprusside (EXP)

Nutlin-3 (ISO)

ochratoxin A (ISO)

octadecanoic acid (ISO)

oleic acid (ISO)

Olmesartan medoxomil (EXP)

olodaterol (ISO)

orotic acid (EXP)

oroxylin A (EXP)

ouabain (EXP,ISO)

Oxotremorine (ISO)

ozone (EXP,ISO)

panobinostat (ISO)

paracetamol (EXP,ISO)

paraquat (EXP,ISO)

paricalcitol (EXP)

PD123319 (EXP)

phenethyl caffeate (ISO)

phenethyl isothiocyanate (ISO)

phenobarbital (ISO)

phenylephrine (EXP,ISO)

phenylmercury acetate (ISO)

PhIP (EXP)

phosgene (EXP)

phosphoramide mustard (EXP)

phosphoramidon (EXP)

picrotoxin (EXP)

potassium atom (ISO)

potassium chloride (EXP)

potassium chromate (ISO)

pravastatin (EXP,ISO)

prazosin (EXP)

progesterone (EXP,ISO)

propofol (EXP,ISO)

prostaglandin E2 (EXP,ISO)

quartz (ISO)

quercetin (EXP,ISO)

quinapril hydrochloride (ISO)

reactive oxygen species (EXP,ISO)

rebaudioside A (ISO)

resveratrol (EXP,ISO)

rifampicin (ISO)

Ro 31-8220 (EXP)

rolipram (EXP)

rotenone (EXP,ISO)

ruxolitinib (EXP)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

S-methyl-L-thiocitrulline (EXP)

S-nitroso-N-acetyl-D-penicillamine (EXP)

SB 203580 (EXP,ISO)

SB 431542 (ISO)

sevoflurane (EXP)

sildenafil citrate (ISO)

silicon dioxide (ISO)

silver atom (ISO)

silver(0) (ISO)

simvastatin (EXP,ISO)

sirolimus (EXP)

sodium arsenate (ISO)

sodium arsenite (ISO)

sodium atom (ISO)

sodium chloride (EXP)

sodium dodecyl sulfate (ISO)

sorafenib (EXP)

stattic (EXP)

staurosporine (EXP)

steviol (ISO)

stevioside (ISO)

stilbene-4,4'-diol (ISO)

streptozocin (EXP,ISO)

Sucralfate (EXP)

sulfur dioxide (EXP,ISO)

sunitinib (ISO)

superoxide (EXP,ISO)

tacrolimus hydrate (EXP)

tamibarotene (ISO)

tamoxifen (ISO)

Tanshinone I (EXP)

tauroursodeoxycholic acid (ISO)

telmisartan (EXP)

temozolomide (ISO)

tenofovir disoproxil fumarate (ISO)

teprenone (EXP)

tert-butyl hydroperoxide (ISO)

testosterone (EXP,ISO)

tetrachloromethane (EXP,ISO)

tetracosanoic acid (ISO)

tetraphene (ISO)

theophylline (ISO)

thioacetamide (EXP)

thymidine (ISO)

tiotropium bromide (ISO)

Tiron (ISO)

titanium dioxide (ISO)

torcetrapib (EXP)

trans-caffeic acid (ISO)

trans-stilbene-4,4'-diol (ISO)

triadimefon (ISO)

tributylstannane (EXP)

trichloroethene (ISO)

trichostatin A (ISO)

triclosan (ISO)

troglitazone (ISO)

tropan-3alpha-yl 3-hydroxy-2-phenylpropanoate (ISO)

tyrphostin AG 1478 (EXP,ISO)

U-73122 (EXP)

urethane (ISO)

ursodeoxycholic acid (ISO)

ursolic acid (ISO)

valproic acid (ISO)

valsartan (EXP)

vanadyl sulfate (ISO)

verapamil (ISO)

vinclozolin (EXP)

water (ISO)

wortmannin (ISO)

Y-27632 (EXP)

zafirlukast (ISO)

zidovudine (ISO)

zinc atom (ISO)

zinc(0) (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway (ISO)

artery smooth muscle contraction (IDA,ISO)

axon extension (ISO)

axon guidance (ISO)

axonogenesis involved in innervation (ISO)

blood vessel morphogenesis (ISO)

body fluid secretion (ISO)

branching involved in blood vessel morphogenesis (ISO)

calcium ion transmembrane transport (ISO)

calcium-mediated signaling (ISO)

canonical NF-kappaB signal transduction (ISO)

canonical Wnt signaling pathway (ISO)

cardiac neural crest cell migration involved in outflow tract morphogenesis (ISO)

cartilage development (ISO)

cell surface receptor signaling pathway (ISO)

cell-cell signaling (ISO)

cellular response to calcium ion (IEP)

cellular response to fatty acid (IEP)

cellular response to follicle-stimulating hormone stimulus (ISO)

cellular response to glucocorticoid stimulus (IEP)

cellular response to human chorionic gonadotropin stimulus (ISO)

cellular response to hydrogen peroxide (ISO)

cellular response to hypoxia (IEP)

cellular response to interleukin-1 (IEP)

cellular response to luteinizing hormone stimulus (ISO)

cellular response to mineralocorticoid stimulus (IEP)

cellular response to organic substance (ISO)

cellular response to peptide hormone stimulus (IEP)

cellular response to transforming growth factor beta stimulus (IEP)

cellular response to tumor necrosis factor (IEP)

cellular response to type II interferon (IEP)

cellular response to xenobiotic stimulus (IEP)

dorsal/ventral pattern formation (ISO)

embryonic heart tube development (ISO)

endothelin receptor signaling pathway (ISO,ISS)

endothelin receptor signaling pathway involved in heart process (ISO)

epithelial fluid transport (IDA)

ERK1 and ERK2 cascade (ISO)

G protein-coupled receptor signaling pathway (ISO)

gene expression (ISO)

glomerular endothelium development (IEA,ISO)

glomerular filtration (IEA,ISO)

heart development (ISO)

heart process (ISO)

histamine secretion (IDA)

in utero embryonic development (ISO)

intracellular calcium ion homeostasis (IBA,ISO)

intracellular signal transduction (IDA)

MAPK cascade (ISO)

maternal process involved in parturition (IEP)

meiotic cell cycle process involved in oocyte maturation (ISO)

membrane depolarization (IMP)

middle ear morphogenesis (ISO)

mitochondrion organization (ISO)

negative regulation of gene expression (IDA)

negative regulation of hormone secretion (IDA)

negative regulation of nitric-oxide synthase biosynthetic process (ISO)

negative regulation of protein metabolic process (ISO)

negative regulation of smooth muscle cell apoptotic process (IDA)

negative regulation of transcription by RNA polymerase II (ISO)

neural crest cell development (ISO)

neural crest cell differentiation (ISO)

neural crest cell fate commitment (ISO)

neuron projection development (ISO)

neutrophil chemotaxis (ISO)

nitric oxide transport (ISO)

noradrenergic neuron differentiation (ISO)

peptide hormone secretion (ISO)

pharyngeal arch artery morphogenesis (ISO)

phosphatidylinositol 3-kinase/protein kinase B signal transduction (ISO)

phospholipase C-activating G protein-coupled receptor signaling pathway (ISO)

phospholipase D-activating G protein-coupled receptor signaling pathway (ISO)

podocyte differentiation (IEA,ISO)

positive regulation of calcium-mediated signaling (IEA,ISO)

positive regulation of cardiac muscle hypertrophy (ISO)

positive regulation of cell growth involved in cardiac muscle cell development (ISO)

positive regulation of cell migration (ISO)

positive regulation of cell population proliferation (IDA,ISO)

positive regulation of cell size (ISO)

positive regulation of chemokine-mediated signaling pathway (ISO)

positive regulation of cytosolic calcium ion concentration (IDA)

positive regulation of heart rate (ISO)

positive regulation of hormone secretion (ISO)

positive regulation of mitotic nuclear division (ISO)

positive regulation of neutrophil chemotaxis (IDA)

positive regulation of non-canonical NF-kappaB signal transduction (IDA)

positive regulation of odontogenesis (IDA)

positive regulation of prostaglandin secretion (IDA)

positive regulation of renal sodium excretion (ISO)

positive regulation of sarcomere organization (ISO)

positive regulation of smooth muscle cell proliferation (ISO)

positive regulation of smooth muscle contraction (IDA,IMP,ISO)

positive regulation of transcription by RNA polymerase II (IDA,ISO)

positive regulation of urine volume (ISO)

positive regulation of vascular associated smooth muscle cell proliferation (IDA)

prostaglandin biosynthetic process (ISO)

protein kinase A signaling (ISO)

protein kinase C deactivation (ISO)

protein kinase C-activating G protein-coupled receptor signaling pathway (ISO)

regulation of blood pressure (IMP,ISO)

regulation of glucose transmembrane transport (ISO)

regulation of pH (ISO)

regulation of systemic arterial blood pressure by endothelin (IBA,ISO)

regulation of vasoconstriction (IEA)

renal sodium ion absorption (ISO)

respiratory gaseous exchange by respiratory system (ISO)

response to activity (IEP)

response to amino acid (IEP)

response to amphetamine (ISO)

response to dexamethasone (IEP)

response to hypoxia (IEP,ISO)

response to leptin (IEP)

response to lipopolysaccharide (IEP)

response to muscle stretch (IEP)

response to nicotine (IEP)

response to ozone (IEP)

response to prostaglandin F (IEP)

response to salt (IEP)

response to testosterone (IEP)

response to transforming growth factor beta (IEP)

response to xenobiotic stimulus (IEP)

rhythmic excitation (ISO)

semaphorin-plexin signaling pathway involved in axon guidance (ISO)

skeletal system development (ISO)

smooth muscle contraction (ISO)

superoxide anion generation (IDA)

sympathetic neuron axon guidance (ISO)

thyroid gland development (ISO)

transcription by RNA polymerase II (ISO)

vasoconstriction (IDA,ISO)

vein smooth muscle contraction (IBA,ISO)

Cellular Component

basal part of cell (IDA)

cytoplasm (ISO)

extracellular space (IBA,IDA,ISO)

rough endoplasmic reticulum lumen (IDA)

Weibel-Palade body (IDA)

Molecular Function

cytokine activity (ISO)

endothelin A receptor binding (IBA,IMP,ISO)

endothelin B receptor binding (IBA,IMP,ISO)

hormone activity (IBA,ISO)

protein binding (ISO)

signaling receptor binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

endothelin signaling pathway (ISO)

hypoxia inducible factor pathway (ISO)

inflammatory response pathway (IDA)

References

References - curated

#	Reference Title	Reference Citation
1.	Increased levels of endothelin-1 and differential endothelin type A and B receptor expression in scleroderma-associated fibrotic lung disease.	Abraham DJ, etal., Am J Pathol. 1997 Sep;151(3):831-41.
2.	Maternal EDN1 G5665T polymorphism influences circulating endothelin-1 levels and plays a role in determination of preeclampsia phenotype.	Aggarwal PK, etal., J Hypertens. 2009 Oct;27(10):2044-50.
3.	Augmented endothelin vasoconstriction in intermittent hypoxia-induced hypertension.	Allahdadi KJ, etal., Hypertension. 2005 Apr;45(4):705-9. Epub 2005 Feb 28.
4.	Pneumoperitoneum upregulates preproendothelin-1 messenger RNA.	Ambrose JA, etal., Surg Endosc. 2001 Feb;15(2):183-8.
5.	Endothelin-1 and its binding sites are upregulated in pressure overload cardiac hypertrophy.	Arai M, etal., Am J Physiol. 1995 May;268(5 Pt 2):H2084-91.
6.	Telmisartan prevents the progression of renal injury in daunorubicin rats with the alteration of angiotensin II and endothelin-1 receptor expression associated with its PPAR-gamma agonist actions.	Arozal W, etal., Toxicology. 2010 Sep 29.
7.	Expression of endothelin 1 and endothelin A receptor in ovarian carcinoma: evidence for an autocrine role in tumor growth.	Bagnato A, etal., Cancer Res. 1999 Feb 1;59(3):720-7.
8.	Endothelin-1 gene and endothelial nitric oxide synthase gene polymorphisms in adolescents with juvenile and obesity-associated hypertension.	Barath A, etal., Acta Physiol Hung. 2007 Mar;94(1-2):49-66.
9.	Association between the endothelin-1 gene Lys198Asn polymorphism blood pressure and plasma endothelin-1 levels in normal and pre-eclamptic pregnancy.	Barden AE, etal., J Hypertens. 2001 Oct;19(10):1775-82.
10.	Endothelin levels increase in rat focal and global ischemia.	Barone FC, etal., J Cereb Blood Flow Metab. 1994 Mar;14(2):337-42.
11.	The genetic association database.	Becker KG, etal., Nat Genet. 2004 May;36(5):431-2.
12.	Major role for hypoxia inducible factor-1 and the endothelin system in promoting myocardial infarction and hypertension in an animal model of obstructive sleep apnea.	Belaidi E, etal., J Am Coll Cardiol. 2009 Apr 14;53(15):1309-17.
13.	Circulating levels of vasoactive peptides in patients with acute bacterial meningitis.	Berg RM, etal., Intensive Care Med. 2009 Sep;35(9):1604-8. Epub 2009 Jun 10.
14.	Modulation of ANP-C receptor signaling by endothelin-1 in A-10 smooth muscle cells.	Boumati M, etal., Arch Biochem Biophys 2002 May 15;401(2):178-86.
15.	Prior SO2 exposure promotes airway inflammation and subepithelial fibrosis following repeated ovalbumin challenge.	Cai C, etal., Clin Exp Allergy. 2008 Oct;38(10):1680-7. Epub 2008 Jun 23.
16.	Acute effects of endothelin receptor antagonists on hepatic hemodynamics of cirrhotic and noncirrhotic rats.	Cavasin MA, etal., Can J Physiol Pharmacol. 2010 Jun;88(6):636-43.
17.	Endothelin-1 plasma levels and vascular endothelial dysfunction in primary open angle glaucoma.	Cellini M, etal., Life Sci. 2012 Oct 15;91(13-14):699-702. doi: 10.1016/j.lfs.2012.02.013. Epub 2012 Mar 3.
18.	Sputum endothelin-1 is increased in cystic fibrosis and chronic obstructive pulmonary disease.	Chalmers GW, etal., Eur Respir J. 1999 Jun;13(6):1288-92.
19.	Adrenomedullin in the rat testis. I: Its production, actions on testosterone secretion, regulation by human chorionic gonadotropin, and its interaction with endothelin 1 in the leydig cell.	Chan YF, etal., Biol Reprod. 2008 Apr;78(4):773-9. Epub 2007 Dec 19.
20.	Adrenomedullin in the rat testis. II: Its production, actions on inhibin secretion, regulation by follicle-stimulating hormone, and its interaction with endothelin 1 in the Sertoli cell.	Chan YF, etal., Biol Reprod. 2008 Apr;78(4):780-5. Epub 2007 Dec 19.
21.	Association between plasma endothelin-1 and severity of different types of glaucoma.	Chen HY, etal., J Glaucoma. 2013 Feb;22(2):117-22. doi: 10.1097/IJG.0b013e31822e8c65.
22.	Oxidative stress-induced, poly(ADP-ribose) polymerase-dependent upregulation of ET-1 expression in chronic diabetic complications.	Chiu J, etal., Can J Physiol Pharmacol. 2008 Jun;86(6):365-72.
23.	Upregulation of endothelin-1 production by lysophosphatidic acid in rat aortic endothelial cells.	Chua CC, etal., Biochim Biophys Acta. 1998 Oct 21;1405(1-3):29-34.
24.	Endothelin-1 impairs alveolar epithelial function via endothelial ETB receptor.	Comellas AP, etal., Am J Respir Crit Care Med. 2009 Jan 15;179(2):113-22. Epub 2008 Oct 23.
25.	Hypoxia reduces endothelin production by rat alveolar type II cells in primary culture.	Crestani B, etal., Eur Respir J. 1998 Feb;11(2):392-9.
26.	Glomerular epithelial cells produce endothelin-1.	Cybulsky AV, etal., J Am Soc Nephrol. 1993 Jan;3(7):1398-404.
27.	Endothelin activation of reactive oxygen species mediates stress-induced pressor response in Dahl salt-sensitive prehypertensive rats.	D'Angelo G, etal., Hypertension. 2010 Aug;56(2):282-9. Epub 2010 Jun 14.
28.	Human big-endothelin-1 and endothelin-1 release prostacyclin via the activation of ET1 receptors in the rat perfused lung.	D'Orleans-Juste P, etal., Br J Pharmacol. 1992 Apr;105(4):773-5.
29.	Role of endothelin-1 in blood pressure regulation in a rat model of visceral obesity and hypertension.	da Silva AA, etal., Hypertension. 2004 Feb;43(2):383-7. Epub 2004 Jan 5.
30.	Endothelin-1 and -3 diminish neuronal NE release through an NO mechanism in rat anterior hypothalamus.	Di Nunzio AS, etal., Am J Physiol Regul Integr Comp Physiol 2002 Sep;283(3):R615-22.
31.	Endothelin-1 gene variant Lys198Asn and plasma endothelin level in obstructive sleep apnea.	Diefenbach K, etal., Cardiology. 2009;112(1):62-8. Epub 2008 Jun 26.
32.	Enhanced expression of endothelin-1 and endothelin-converting enzyme-1 in acute hypoxic rat aorta.	Doi Y, etal., Histol Histopathol 2002 Jan;17(1):97-105.
33.	Bosentan, an endothelin receptor antagonist, ameliorates collagen-induced arthritis: the role of TNF-alpha in the induction of endothelin system genes.	Donate PB, etal., Inflamm Res. 2012 Apr;61(4):337-48. doi: 10.1007/s00011-011-0415-5. Epub 2012 Jan 17.
34.	Blood pressure-independent effect of angiotensin AT1 receptor blockade on renal endothelin-1 production in hypertensive uremic rats.	Dumont Y, etal., J Hypertens. 2001 Aug;19(8):1479-87.
35.	Estradiol attenuates hypoxia-induced pulmonary endothelin-1 gene expression.	Earley S and Resta TC, Am J Physiol Lung Cell Mol Physiol 2002 Jul;283(1):L86-93.
36.	Effect of a specific endothelin receptor A antagonist and an angiotensin-converting enzyme inhibitor on glomerular mRNA levels for extracellular matrix components, metalloproteinases (MMP) and a tissue inhibitor of MMP in aminonucleoside nephrosis.	Ebihara I, etal., Nephrol Dial Transplant. 1997 May;12(5):1001-6.
37.	Identification of receptor binding and activation sites in endothelin-1 by use of site-directed mutagenesis.	Ergul A, etal., Circ Res. 1995 Dec;77(6):1087-94.
38.	Endothelin-1 as a central mediator of LPS-induced fever in rats.	Fabricio AS, etal., Brain Res. 2005 Dec 20;1066(1-2):92-100.
39.	Endothelin-A and -B receptors, superoxide, and Ca2+ signaling in afferent arterioles.	Fellner SK and Arendshorst W, Am J Physiol Renal Physiol. 2007 Jan;292(1):F175-84. Epub 2006 Jun 20.
40.	Strontium fructose 1,6-diphosphate rescues adenine-induced male hypogonadism and upregulates the testicular endothelin-1 system.	Feng Y, etal., Clin Exp Pharmacol Physiol. 2007 Nov;34(11):1131-7.
41.	Influence of salt loading on the cardiac and renal preproendothelin-1 mRNA expression in stroke-prone spontaneously hypertensive rats.	Feron O, etal., Biochem Biophys Res Commun. 1995 Apr 6;209(1):161-6.
42.	Endothelin as an autocrine factor in the regulation of parathyroid cells.	Fujii Y, etal., Proc Natl Acad Sci U S A. 1991 May 15;88(10):4235-9.
43.	Synthesis and receptor sites of endothelin-1 in the rat liver vasculature.	Fukushige H, etal., Anat Rec. 2000 Aug 1;259(4):437-45.
44.	Co-expression of endothelin-1 and endothelin-converting enzyme-1 in patients with chronic rhinitis.	Furukawa K, etal., Am J Respir Cell Mol Biol. 1996 Mar;14(3):248-53.
45.	NAADP-induced Ca(2+ signaling in response to endothelin is via the receptor subtype B and requires the integrity of lipid rafts/caveolae.	Gambara G, etal., J Cell Physiol. 2008 Aug;216(2):396-404.
46.	Endotoxin treatment causes an upregulation of the endothelin system in the liver: amelioration of increased portal resistance by endothelin receptor antagonism.	Gandhi CR, etal., J Gastroenterol Hepatol. 2001 Jan;16(1):61-9.
47.	Long Non-coding RNA MALAT1/microRNA-143/VEGFA Signal Axis Modulates Vascular Endothelial Injury-Induced Intracranial Aneurysm.	Gao G, etal., Nanoscale Res Lett. 2020 Jun 29;15(1):139. doi: 10.1186/s11671-020-03357-2.
48.	Transgenic expression of the endothelin-B receptor prevents congenital intestinal aganglionosis in a rat model of Hirschsprung disease.	Gariepy CE, etal., J Clin Invest 1998 Sep 15;102(6):1092-101.
49.	Null mutation of endothelin receptor type B gene in spotting lethal rats causes aganglionic megacolon and white coat color.	Gariepy CE, etal., Proc Natl Acad Sci U S A 1996 Jan 23;93(2):867-72.
50.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
51.	Expression of endothelin-1 in lungs of patients with cryptogenic fibrosing alveolitis.	Giaid A, etal., Lancet. 1993 Jun 19;341(8860):1550-4.
52.	Involvement of endothelin-1 and its receptors in PGF2alpha-induced luteolysis in the rat.	Girsh E and Dekel N, Mol Reprod Dev 2002 Sep;63(1):71-8.
53.	Cloprostenol, a prostaglandin F(2alpha) analog, induces hypoxia in rat placenta: BOLD contrast MRI.	Girsh E, etal., NMR Biomed. 2007 Feb;20(1):28-39.
54.	Abnormally increased endothelin-1 in plasma during the night in obstructive sleep apnea: relation to blood pressure and severity of disease.	Gjorup PH, etal., Am J Hypertens. 2007 Jan;20(1):44-52.
55.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
56.	Increased endothelial exocytosis and generation of endothelin-1 contributes to constriction of aged arteries.	Goel A, etal., Circ Res. 2010 Jul 23;107(2):242-51. Epub 2010 Jun 3.
57.	Increased MAPK Activation and Impaired Insulin Signaling in Subcutaneous Microvascular Endothelial Cells in Type 2 Diabetes-role of endothelin-1.	Gogg S, etal., Diabetes. 2009 Jul 6.
58.	Potent constrictor actions of endothelin-1, endothelin-2, and endothelin-3 in rat isolated portal vein.	Guimaraes CL, etal., Hypertension. 1992 Feb;19(2 Suppl):II79-86.
59.	Gene expression of ANP, BNP and ET-1 in the heart of rats during pulmonary embolism.	Gutte H, etal., PLoS One. 2010 Jun 14;5(6):e11111.
60.	Identification of early response genes and pathway activated by androgens in the initial segment and caput regions of the regressed rat epididymis.	Hamzeh M and Robaire B, Endocrinology. 2010 Sep;151(9):4504-14. Epub 2010 Jul 21.
61.	Increased sensitivity to acute and persistent pain in neuron-specific endothelin-1 knockout mice.	Hasue F, etal., Neuroscience. 2005;130(2):349-58.
62.	Normoalbuminuric type 1 diabetic patients with retinopathy have an impaired tubular response to desmopressin: its relationship with plasma endothelin-1.	Hernandez C, etal., J Clin Endocrinol Metab. 2009 Jun;94(6):2060-5. Epub 2009 Mar 17.
63.	Contributions of endothelin-1 and sodium hydrogen exchanger-1 in the diabetic myocardium.	Hileeto D, etal., Diabetes Metab Res Rev 2002 Sep-Oct;18(5):386-94.
64.	Endothelin-1 activates mesangial cell ERK1/2 via EGF-receptor transactivation and caveolin-1 interaction.	Hua H, etal., Am J Physiol Renal Physiol 2003 Feb;284(2):F303-12.
65.	Time course alteration of endothelin-1 gene expression in the heart during exercise and recovery from post-exercise periods in rats.	Iemitsu M, etal., J Cardiovasc Pharmacol. 2004 Nov;44 Suppl 1:S447-50.
66.	Effects of endothelin-1 on the membrane potential and slow waves in circular smooth muscle of rat gastric antrum.	Imaeda K, etal., J Smooth Muscle Res. 2004 Oct;40(4-5):199-210.
67.	Fine mapping and single nucleotide polymorphism association results of candidate genes for asthma and related phenotypes.	Immervoll T, etal., Hum Mutat. 2001 Oct;18(4):327-36.
68.	Gene Data File	Integration of LocusLink data, October 12, 2001
69.	Aqueous humor endothelin-1 (Et-1), vascular endothelial growth factor (VEGF) and cyclooxygenase-2 (COX-2) levels in Mexican glaucomatous patients.	Iwabe S, etal., Curr Eye Res. 2010 Apr;35(4):287-94. doi: 10.3109/02713680903545315.
70.	Intracellular signaling pathways for norepinephrine- and endothelin-1-mediated regulation of myocardial cell apoptosis.	Iwai-Kanai E and Hasegawa K, Mol Cell Biochem. 2004 Apr;259(1-2):163-8.
71.	Endothelin-1 inhibits apoptosis of pulmonary arterial smooth muscle in the neonatal rat.	Jankov RP, etal., Pediatr Res. 2006 Sep;60(3):245-51. Epub 2006 Jul 20.
72.	Mechanism of endothelin 1 production in the cochlea of rats.	Jinnouchi K ORL J Otorhinolaryngol Relat Spec. 2001 Jan-Feb;63(1):6-11.
73.	Myocardial expression of endothelin-2 is altered reciprocally to that of endothelin-1 during ischemia of cardiomyocytes in vitro and during heart failure in vivo.	Kakinuma Y, etal., Life Sci. 1999;65(16):1671-83.
74.	Role of endothelin in intermittent hypoxia-induced hypertension.	Kanagy NL, etal., Hypertension. 2001 Feb;37(2 Part 2):511-5.
75.	Decline in FEV1 related to genetic polymorphisms (+138insA/delA and Lys198Asn) of the endothelin-1 gene in COPD. A pilot study.	Kaparianos A, etal., Eur Rev Med Pharmacol Sci. 2010 Aug;14(8):705-19.
76.	Hypertension induced by the tyrosine kinase inhibitor sunitinib is associated with increased circulating endothelin-1 levels.	Kappers MH, etal., Hypertension. 2010 Oct;56(4):675-81. Epub 2010 Aug 23.
77.	Endothelin-1 induces organ-specific histamine liberation and neutrophil granulocyte accumulation in the rat.	Kaszaki J, etal., Inflamm Res. 2008 Aug;57(8):396-402.
78.	Peripheral mechanisms of erectile dysfunction in a rat model of chronic cocaine use.	Kendirci M, etal., Eur Urol. 2007 Aug;52(2):555-63. Epub 2007 Mar 20.
79.	C-terminal pro-endothelin-1 offers additional prognostic information in patients after acute myocardial infarction: Leicester Acute Myocardial Infarction Peptide (LAMP) Study.	Khan SQ, etal., Am Heart J. 2007 Oct;154(4):736-42.
80.	Endothelin activation of an inwardly rectifying K+ current in atrial cells.	Kim D Circ Res. 1991 Jul;69(1):250-5.
81.	Low blood pressure in endothelial cell-specific endothelin 1 knockout mice.	Kisanuki YY, etal., Hypertension. 2010 Jul;56(1):121-8. Epub 2010 Jun 1.
82.	Effects of cilnidipine on nitric oxide and endothelin-1 expression and extracellular signal-regulated kinase in hypertensive rats.	Kobayashi N, etal., Eur J Pharmacol. 2001 Jun 22;422(1-3):149-57.
83.	Expression of endothelin-1, ETA and ETB receptors, and ECE and distribution of endothelin-1 in failing rat heart.	Kobayashi T, etal., Am J Physiol. 1999 Apr;276(4 Pt 2):H1197-206.
84.	Endothelin-1 concentration is increased in the aqueous humour of patients with exfoliation syndrome.	Koliakos GG, etal., Br J Ophthalmol. 2004 Apr;88(4):523-7.
85.	Effects of combined hyperoxia and cyclooxygenase inhibition in neonatal rat lungs.	Kuniyoshi KM, etal., Am J Transl Res. 2010 Jun 8;2(3):332-44.
86.	Elevated blood pressure and craniofacial abnormalities in mice deficient in endothelin-1.	Kurihara Y, etal., Nature 1994 Apr 21;368(6473):703-10.
87.	Impaired ventilatory responses to hypoxia and hypercapnia in mutant mice deficient in endothelin-1.	Kuwaki T, etal., Am J Physiol. 1996 Jun;270(6 Pt 2):R1279-86.
88.	Plasma C-reactive protein and endothelin-1 level in patients with chronic obstructive pulmonary disease and pulmonary hypertension.	Kwon YS, etal., J Korean Med Sci. 2010 Oct;25(10):1487-91. Epub 2010 Sep 17.
89.	Endothelin-1 in acute lung injury and the adult respiratory distress syndrome.	Langleben D, etal., Am Rev Respir Dis. 1993 Dec;148(6 Pt 1):1646-50.
90.	Renal expression of parathyroid hormone-related protein (PTHrP) and PTH/PTHrP receptor in a rat model of tubulointerstitial damage.	Largo R, etal., Kidney Int. 1999 Jan;55(1):82-90.
91.	Effect of pyrrolidine dithiocarbamate on hepatic vascular stress gene expression during ischemia and reperfusion.	Lee CH, etal., Eur J Pharmacol. 2008 Oct 24;595(1-3):100-7. Epub 2008 Aug 9.
92.	Expression of endothelin-1 and its receptors in Cisplatin-induced acute renal failure in mice.	Lee S and Ahn D, Korean J Physiol Pharmacol. 2008 Aug;12(4):149-53. Epub 2008 Aug 31.
93.	Transforming growth factor-beta1 induces endothelin-1 in a bovine pulmonary artery endothelial cell line and rat lungs via cAMP.	Lee SD, etal., Pulm Pharmacol Ther. 2000;13(6):257-65.
94.	Effects of pravastatin on functional capacity in patients with chronic obstructive pulmonary disease and pulmonary hypertension.	Lee TM, etal., Clin Sci (Lond). 2009 Mar;116(6):497-505.
95.	EDN1 Lys198Asn is associated with diabetic retinopathy in type 2 diabetes.	Li H, etal., Mol Vis. 2008 Sep 15;14:1698-704.
96.	[Inhibition of mesangial cell proliferation and mesangial matrix expansion by antisense oligodeoxynucleotide targeting preproendothelin-1 mRNA in vivo].	Li M, etal., Zhonghua Yi Xue Za Zhi. 1999 Feb;79(2):133-5.
97.	Preproendothelin-1 expression is negatively regulated by IFNgamma during hepatic stellate cell activation.	Li T, etal., Am J Physiol Gastrointest Liver Physiol. 2012 May 1;302(9):G948-57. doi: 10.1152/ajpgi.00359.2011. Epub 2012 Feb 2.
98.	Involvement of tissue transglutaminase in endothelin 1-induced hypertrophy in cultured neonatal rat cardiomyocytes.	Li X, etal., Hypertension. 2009 Oct;54(4):839-44. Epub 2009 Jul 27.
99.	The role of endothelin-1 and the endothelin B receptor in the pathogenesis of hepatopulmonary syndrome in the rat.	Ling Y, etal., Hepatology. 2004 Jun;39(6):1593-602.
100.	Carvedilol and lacidipine prevent cardiac hypertrophy and endothelin-1 gene overexpression after aortic banding.	Massart PE, etal., Hypertension. 1999 Dec;34(6):1197-201.
101.	Involvement of NO and MEK/ERK pathway in enhancement of endothelin-1-induced mesenteric artery contraction in later-stage type 2 diabetic Goto-Kakizaki rat.	Matsumoto T, etal., Am J Physiol Heart Circ Physiol. 2009 May;296(5):H1388-97. Epub 2009 Mar 13.
102.	Exaggerated vascular and renal pathology in endothelin-B receptor-deficient rats with deoxycorticosterone acetate-salt hypertension.	Matsumura Y, etal., Circulation 2000 Nov 28;102(22):2765-73.
103.	Comparison of the cardiovascular and neural activity of endothelin-1, -2, -3 and respective proendothelins: effects of phosphoramidon and thiorphan.	Mattera GG, etal., Br J Pharmacol. 1993 Sep;110(1):331-7.
104.	Endothelins stimulate deoxyribonucleic acid synthesis and cell proliferation in rat adrenal zona glomerulosa, acting through an endothelin A receptor coupled with protein kinase C- and tyrosine kinase-dependent signaling pathways.	Mazzocchi G, etal., Endocrinology. 1997 Jun;138(6):2333-7.
105.	Regulation of endothelin-1 by angiopoietin-1: implications for inflammation.	McCarter SD, etal., Exp Biol Med (Maywood). 2006 Jun;231(6):985-91.
106.	Calcitonin gene-related peptide selectively relaxes contractile responses to endothelin-1 in rat mesenteric resistance arteries.	Meens MJ, etal., J Pharmacol Exp Ther. 2009 Oct;331(1):87-95. Epub 2009 Jul 23.
107.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
108.	Progressive retinal degeneration in transgenic mice with overexpression of endothelin-1 in vascular endothelial cells.	Mi XS, etal., Invest Ophthalmol Vis Sci. 2012 Jul 20;53(8):4842-51. doi: 10.1167/iovs.12-9999.
109.	Inhibitory effects of PPAR-gamma on endothelin-1-induced inflammatory pathways in vascular smooth muscle cells from normotensive and hypertensive rats.	Montezano AC, etal., J Am Soc Hypertens. 2007 Mar-Apr;1(2):150-60.
110.	Plasma endothelin-1 levels, pulmonary hypertension, and lung fibrosis in patients with systemic sclerosis.	Morelli S, etal., Am J Med. 1995 Sep;99(3):255-60.
111.	Transcriptional regulation of pre-pro-endothelin-1 gene by glucocorticoids in vascular smooth muscle cells.	Morin C, etal., Biochem Biophys Res Commun. 1998 Mar 17;244(2):583-7.
112.	Role of ET(A) and ET(B) endothelin receptors on endothelin-1-induced potentiation of nociceptive and thermal hyperalgesic responses evoked by capsaicin in rats.	Motta EM, etal., Neurosci Lett. 2009 Jul 3;457(3):146-50. Epub 2009 Mar 21.
113.	Endogenous plasma endothelin concentrations and coronary circulation in patients with mild dilated cardiomyopathy.	Mundhenke M, etal., Heart. 1999 Mar;81(3):278-84.
114.	Effects of unoprostone on phosphorylated extracellular signal-regulated kinase expression in endothelin-1-induced retinal and optic nerve damage.	Munemasa Y, etal., Vis Neurosci. 2008 Mar-Apr;25(2):197-208. doi: 10.1017/S095252380808053X.
115.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
116.	Anti-inflammatory and anti-atherogenic effects of cathechin, caffeic acid and trans-resveratrol in apolipoprotein E deficient mice.	Norata GD, etal., Atherosclerosis. 2007 Apr;191(2):265-71. Epub 2006 Jun 27.
117.	Contractile responses and myosin phosphorylation in reconstituted fibers of smooth muscle cells from the rat cerebral artery.	Oishi K, etal., Jpn J Pharmacol. 2002 Sep;90(1):36-50.
118.	Endothelin-1 (ET-1) is increased in rat retina after crushing optic nerve.	Oku H, etal., Curr Eye Res. 2008 Jul;33(7):611-20.
119.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
120.	Expression and cellular localisation of renal endothelin-1 and endothelin receptor subtypes in autosomal-dominant polycystic kidney disease.	Ong AC, etal., Nephron Exp Nephrol. 2003;93(2):e80.
121.	Inhibition of vascular contraction by intracisternal administration of preproendothelin-1 mRNA antisense oligoDNA in a rat experimental vasospasm model.	Onoda K, etal., J Neurosurg. 1996 Nov;85(5):846-52.
122.	Renal endothelin gene expression is increased in remnant kidney and correlates with disease progression.	Orisio S, etal., Kidney Int. 1993 Feb;43(2):354-8.
123.	The dissociation between upregulated endothelins and hemodynamic responses during polymicrobial sepsis.	Ornan DA, etal., Biochim Biophys Acta. 2000 Jun 15;1501(2-3):211-8.
124.	Endothelium-restricted endothelin-1 overexpression in type 1 diabetes worsens atherosclerosis and immune cell infiltration via NOX1.	Ouerd S, etal., Cardiovasc Res. 2021 Mar 21;117(4):1144-1153. doi: 10.1093/cvr/cvaa168.
125.	Extraocular blood flow and endothelin-1 plasma levels in patients with multiple sclerosis.	Pache M, etal., Eur Neurol. 2003;49(3):164-8.
126.	Increased endothelin-1 in bleomycin-induced pulmonary fibrosis and the effect of an endothelin receptor antagonist.	Park SH, etal., Am J Respir Crit Care Med. 1997 Aug;156(2 Pt 1):600-8.
127.	Hydrochloric acid aspiration increases right ventricular systolic pressure in rats.	Pawlik MT, etal., Eur J Anaesthesiol. 2009 Apr;26(4):285-92.
128.	Elevated plasma endothelin-1 levels in coronary sinus during rapid right atrial pacing in patients with slow coronary flow.	Pekdemir H, etal., Int J Cardiol. 2004 Oct;97(1):35-41.
129.	Plasma cytokines and portopulmonary hypertension in patients with cirrhosis waiting for orthotopic liver transplantation.	Pellicelli AM, etal., Angiology. 2010 Nov;61(8):802-6. Epub 2010 May 24.
130.	ET(B) receptor-deficient rats exhibit reduced contraction to ET-1 despite an increase in ET(A) receptors.	Perry MG, etal., Am J Physiol Heart Circ Physiol 2001 Dec;281(6):H2680-6.
131.	Inverse regulation of preproendothelin-1 and endothelin-converting enzyme-1beta genes in cardiac cells by mechanical load.	Pikkarainen S, etal., Am J Physiol Regul Integr Comp Physiol. 2006 Jun;290(6):R1639-45. Epub 2006 Jan 12.
132.	Endothelin-1-specific activation of B-type natriuretic peptide gene via p38 mitogen-activated protein kinase and nuclear ETS factors.	Pikkarainen S, etal., J Biol Chem 2003 Feb 7;278(6):3969-75.
133.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
134.	Endothelin-1 contributes to the Frank-Starling response in hypertrophic rat hearts.	Piuhola J, etal., Hypertension 2003 Jan;41(1):93-8.
135.	Differential effects of ET-1, ET-2, and ET-3 on pancreatic microcirculation, tissue integrity, and inflammation.	Plusczyk T, etal., Dig Dis Sci. 2001 Jun;46(6):1343-51.
136.	Impact of endothelin-1 Lys198Asn polymorphism on coronary artery disease and endorgan damage in hypertensives.	Popov AF, etal., Coron Artery Dis. 2008 Nov;19(7):429-34. doi: 10.1097/MCA.0b013e32830936e5.
137.	Glucocorticoids increase preproendothelin-1 expression in rat aorta.	Provencher PH, etal., Endocr Res. 1998 Aug-Nov;24(3-4):737-41.
138.	A novel endothelin receptor antagonist CPU0213 improves diabetic cardiac insufficiency attributed to up-regulation of the expression of FKBP12.6, SERCA2a, and PLB in rats.	Qi MY, etal., J Cardiovasc Pharmacol. 2006 Jun;47(6):729-35.
139.	Total triterpene acids, active ingredients from Fructus Corni, attenuate diabetic cardiomyopathy by normalizing ET pathway and expression of FKBP12.6 and SERCA2a in streptozotocin-rats.	Qi MY, etal., J Pharm Pharmacol. 2008 Dec;60(12):1687-94.
140.	Endothelin-1 antagonism and nitric oxide augmentation prevents cyclosporine-induced vasomotor impairment.	Ramzy D, etal., J Heart Lung Transplant. 2010 Sep 17.
141.	Insulin preincubation effects on rat vessel contractile responses: role of the endothelium.	Rebolledo A, etal., Endothelium 2001;8(4):269-76.
142.	GOA pipeline	RGD automated data pipeline
143.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
144.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
145.	Endothelin-1 as a potential marker of melatonin's therapeutic effects in smoking-induced vasculopathy.	Rodella LF, etal., Life Sci. 2010 Sep 18.
146.	Retinal detachment and proliferative vitreoretinopathy: central retinal artery blood velocities, intraocular pressure, and endothelin 1.	Roldan-Pallares M, etal., Retina. 2013 Sep;33(8):1528-39. doi: 10.1097/IAE.0b013e318285cbef.
147.	Quinapril decreases renal endothelin-1 expression and synthesis in a normotensive model of immune-complex nephritis.	Ruiz-Ortega M, etal., J Am Soc Nephrol. 1997 May;8(5):756-68.
148.	Autocrine regulation of the endothelin-1 gene in rat endothelial cells.	Saito S, etal., J Cardiovasc Pharmacol. 1995;26 Suppl 3:S84-7.
149.	cDNA cloning, sequence analysis and tissue distribution of rat preproendothelin-1 mRNA.	Sakurai T, etal., Biochem Biophys Res Commun 1991 Feb 28;175(1):44-7.
150.	Comparison of the pituitary effects of the mammalian endothelins: vasoactive intestinal contractor (endothelin-beta, rat endothelin-2) is a potent inhibitor of prolactin secretion.	Samson WK and Skala KD, Endocrinology. 1992 May;130(5):2964-70.
151.	Prohormones for prediction of adverse medical outcome in community-acquired pneumonia and lower respiratory tract infections.	Schuetz P, etal., Crit Care. 2010;14(3):R106. Epub 2010 Jun 8.
152.	The cardiac endothelin system in established pressure overload left ventricular hypertrophy.	Schunkert H, etal., J Mol Med (Berl). 1999 Aug;77(8):623-30.
153.	Local antinociception induced by endothelin-1 in the hairy skin of the rat's back.	Shrestha S, etal., J Pain. 2009 Jul;10(7):702-14.
154.	Release of endothelin in the oleic acid-induced respiratory distress syndrome in rats.	Simmet T, etal., Eur J Pharmacol. 1992 Feb 18;211(3):319-22.
155.	Effect of YM598, a selective endothelin ETA receptor antagonist, on endothelin-1-induced bone formation.	Someya A, etal., Eur J Pharmacol. 2006 Aug 14;543(1-3):14-20. Epub 2006 Jun 27.
156.	Pulmonary release and coronary and peripheral consumption of big endothelin and endothelin-1 in severe heart failure: acute effects of vasodilator therapy.	Stangl K, etal., Circulation. 2000 Sep 5;102(10):1132-8.
157.	Aldosterone modulates steroid receptor binding to the endothelin-1 gene (edn1).	Stow LR, etal., J Biol Chem. 2009 Oct 30;284(44):30087-96. doi: 10.1074/jbc.M109.030718. Epub 2009 Jul 28.
158.	Identification of two nuclear factor of activated T-cells (NFAT)-response elements in the 5'-upstream regulatory region of the ET-1 promoter.	Strait KA, etal., J Biol Chem. 2010 Sep 10;285(37):28520-8. Epub 2010 Jul 20.
159.	Endothelins induce Fos expression in neurons and glia in organotypic cultures of rat cerebellum.	Sullivan AM and Morton AJ, J Neurochem. 1996 Oct;67(4):1409-18.
160.	Plasma endothelin-1 and thrombomodulin levels in coronary sinus during right atrial pacing and percutaneous transluminal coronary angioplasty.	Suzuki H, etal., Int J Cardiol. 2000 Jun 12;74(1):15-23.
161.	Elevated plasma endothelin in patients with diabetes mellitus.	Takahashi K, etal., Diabetologia. 1990 May;33(5):306-10.
162.	Divergent expression of EtA and EtB receptors in response to cyclosporine in mesangial cells.	Takeda M, etal., Am J Pathol. 1994 Mar;144(3):473-9.
163.	Pulmonary disease models induced by in vivo hemagglutinating virus of Japan liposome-mediated endothelin-1 gene transfer.	Takeda S, etal., J Cardiovasc Pharmacol. 1998;31 Suppl 1:S336-8.
164.	BMPR2 mutation alters the lung macrophage endothelin-1 cascade in a mouse model and patients with heritable pulmonary artery hypertension.	Talati M, etal., Am J Physiol Lung Cell Mol Physiol. 2010 Sep;299(3):L363-73. Epub 2010 Jun 18.
165.	Role of endogenous endothelin-1 in post-ischemic cardiac dysfunction and norepinephrine overflow in rat hearts.	Tawa M, etal., Eur J Pharmacol. 2008 Sep 4;591(1-3):182-8. Epub 2008 Jun 14.
166.	Tissue-specific modulation of endothelin receptors in a rat model of hypertension.	Telemaque-Potts S, etal., J Cardiovasc Pharmacol. 2000 Nov;36(5 Suppl 1):S122-3.
167.	Vascular endothelin-1 gene expression and synthesis and effect on renal type I collagen synthesis and nephroangiosclerosis during nitric oxide synthase inhibition in rats.	Tharaux PL, etal., Circulation. 1999 Apr 27;99(16):2185-91.
168.	Differential regulation of the lung endothelin system by urban particulate matter and ozone.	Thomson E, etal., Toxicol Sci. 2005 Nov;88(1):103-13. Epub 2005 Aug 4.
169.	[Renoprotective effects of nonselective endothelin receptor antagonist bosentan on rats with interstitial fibrosis following unilateral ureteral obstruction].	Tian XF, etal., Zhonghua Yi Xue Za Zhi. 2003 Mar 25;83(6):510-4.
170.	The role of endothelin-1 and nitric oxide in the pathogenesis of hypertension in diabetic patients.	Tomic M, etal., Coll Antropol. 2008 Mar;32(1):93-8.
171.	Endothelin-1 and endothelin receptors in light-induced retinal degeneration.	Torbidoni V, etal., Exp Eye Res. 2005 Sep;81(3):265-75.
172.	Relationship between transcardiac gradient of endothelin-1 and left ventricular remodelling in patients with first anterior myocardial infarction.	Tsutamoto T, etal., Eur Heart J. 2003 Feb;24(4):346-55.
173.	Endothelin-1 gene polymorphism and hearing impairment in elderly Japanese.	Uchida Y, etal., Laryngoscope. 2009 May;119(5):938-43. doi: 10.1002/lary.20181.
174.	Plasma endothelin-1 levels in Behcet's disease.	Uslu T, etal., Clin Rheumatol. 1997 Jan;16(1):59-61.
175.	Despite similar reduction of blood pressure and renal ANG II and ET-1 levels aliskiren but not losartan normalizes albuminuria in hypertensive Ren-2 rats.	Vanourkova Z, etal., Physiol Res. 2010;59(3):339-45.
176.	Endothelin-1 plasma concentrations in patients with retinitis pigmentosa.	Vingolo EM, etal., Regul Pept. 2010 Feb 25;160(1-3):64-7. doi: 10.1016/j.regpep.2009.12.006. Epub 2009 Dec 11.
177.	The endothelin axis influences enteric glia cell functions.	von Boyen GB, etal., Med Sci Monit. 2010 Jun;16(6):BR161-7.
178.	Big endothelin-1 as a predictor of atrial fibrillation recurrence after primary ablation only in patients with paroxysmal atrial fibrillation.	Wang H, etal., Herz. 2012 Dec;37(8):919-25. doi: 10.1007/s00059-012-3626-9. Epub 2012 Jun 6.
179.	Contribution of endogenous endothelin to the extension of myocardial infarct size in rats.	Watanabe T, etal., Circ Res. 1991 Aug;69(2):370-7.
180.	Endothelin in human congestive heart failure.	Wei CM, etal., Circulation. 1994 Apr;89(4):1580-6.
181.	Adrenomedullin and adrenomedullin binding protein-1 prevent metabolic acidosis after uncontrolled hemorrhage in rats.	Wu R, etal., Crit Care Med. 2007 Mar;35(3):912-8.
182.	Glucose-induced endothelin-1 expression is regulated by ERK5 in the endothelial cells and retina of diabetic rats.	Wu Y, etal., Can J Physiol Pharmacol. 2010 Jun;88(6):607-15. doi: 10.1139/Y10-033.
183.	MicroRNA-27a/b mediates endothelin-1-induced PPAR¿ reduction and proliferation of pulmonary artery smooth muscle cells.	Xie X, etal., Cell Tissue Res. 2017 Sep;369(3):527-539. doi: 10.1007/s00441-017-2625-9. Epub 2017 May 8.
184.	PARP activation and the alteration of vasoactive factors and extracellular matrix protein in retina and kidney in diabetes.	Xu B, etal., Diabetes Metab Res Rev. 2008 Jul-Aug;24(5):404-12.
185.	Rescue Treatment with a Rho-Kinase Inhibitor Normalizes Right-Ventricular Function and Reverses Remodeling in Juvenile Rats with Chronic Pulmonary Hypertension.	Xu EZ, etal., Am J Physiol Heart Circ Physiol. 2010 Oct 1.
186.	Ex vivo blockade of endothelin-1 inhibits graft coronary artery disease in a rodent cardiac allograft model.	Yamaguchi A, etal., J Heart Lung Transplant. 2002 Apr;21(4):417-24.
187.	Role of Endothelin-1/Endothelin-A receptor-mediated signaling pathway in the aortic arch patterning in mice.	Yanagisawa H, etal., J Clin Invest 1998 Jul 1;102(1):22-33.
188.	Danshensu protects vascular endothelia in a rat model of hyperhomocysteinemia.	Yang RX, etal., Acta Pharmacol Sin. 2010 Oct;31(10):1395-400. Epub 2010 Sep 27.
189.	A causal role for endothelin-1 in the pathogenesis of osteoblastic bone metastases.	Yin JJ, etal., Proc Natl Acad Sci U S A 2003 Sep 16;100(19):10954-9. Epub 2003 Aug 26.
190.	Endothelin-1 and endothelin B type receptor are induced in mesangial proliferative nephritis in the rat.	Yoshimura A, etal., Kidney Int. 1995 Oct;48(4):1290-7.
191.	Endothelin-1 levels and albuminuria in patients with type 2 diabetes mellitus.	Zanatta CM, etal., Diabetes Res Clin Pract. 2008 May;80(2):299-304. Epub 2008 Mar 17.
192.	IL-33/ST2 signalling contributes to carrageenin-induced innate inflammation and inflammatory pain: role of cytokines, endothelin-1 and prostaglandin E2.	Zarpelon AC, etal., Br J Pharmacol. 2013 May;169(1):90-101. doi: 10.1111/bph.12110.
193.	Leptin induces vascular smooth muscle cell hypertrophy through angiotensin II- and endothelin-1-dependent mechanisms and mediates stretch-induced hypertrophy.	Zeidan A, etal., J Pharmacol Exp Ther. 2005 Dec;315(3):1075-84. Epub 2005 Sep 6.
194.	Increased tissue endothelin immunoreactivity in atherosclerotic lesions associated with acute coronary syndromes.	Zeiher AM, etal., Lancet. 1994 Nov 19;344(8934):1405-6.
195.	[Effect and mechanism of salvianolic acid B in attenuating elevated portal pressure in a rat model of portal hypertension induced by endothelin-1].	Zhou Y, etal., Zhong Xi Yi Jie He Xue Bao. 2007 Jan;5(1):61-4.
196.	Anti-IgE Therapy with Omalizumab Decreases Endothelin-1 in Exhaled Breath Condensate of Patients with Severe Persistent Allergic Asthma.	Zietkowski Z, etal., Respiration. 2010 Jun 26.
197.	Plasma endothelin-1 in patients with stable or unstable angina.	Zuk-Popiolek I, etal., Kardiol Pol. 2003 Jun;58(6):429-37; discussion 436-7.

Additional References at PubMed

PMID:1713452	PMID:1917960	PMID:2039460	PMID:2542249	PMID:2649896	PMID:7615798	PMID:8010105	PMID:8680799	PMID:8978712	PMID:8982507	PMID:9422810	PMID:9449664
PMID:9492062	PMID:9671575	PMID:9696419	PMID:10393673	PMID:10626068	PMID:10770212	PMID:11410113	PMID:11413164	PMID:11546805	PMID:11676479	PMID:11824480	PMID:11882629
PMID:11907823	PMID:11910302	PMID:12027406	PMID:12051519	PMID:12056555	PMID:12088756	PMID:12135753	PMID:12234805	PMID:12379507	PMID:12384469	PMID:12390946	PMID:12401340
PMID:12407540	PMID:12410847	PMID:12432226	PMID:12458661	PMID:12459879	PMID:12464391	PMID:12483544	PMID:12495225	PMID:12547713	PMID:12606528	PMID:12626328	PMID:12631065
PMID:12713865	PMID:12738614	PMID:12740215	PMID:12821678	PMID:12824290	PMID:12826908	PMID:12842454	PMID:12847114	PMID:12882904	PMID:12893655	PMID:12907462	PMID:12969895
PMID:14523027	PMID:14530261	PMID:14580371	PMID:14581409	PMID:14610324	PMID:14706678	PMID:14730207	PMID:14751390	PMID:14993193	PMID:15086471	PMID:15110048	PMID:15126926
PMID:15155819	PMID:15180921	PMID:15193775	PMID:15203192	PMID:15205172	PMID:15309721	PMID:15314687	PMID:15327783	PMID:15344879	PMID:15359394	PMID:15381254	PMID:15471983
PMID:15486027	PMID:15518706	PMID:15519534	PMID:15561758	PMID:15563533	PMID:15583218	PMID:15605384	PMID:15632412	PMID:15637126	PMID:15665062	PMID:15683715	PMID:15691296
PMID:15722189	PMID:15725412	PMID:15737330	PMID:15756563	PMID:15792994	PMID:15838251	PMID:15838256	PMID:15838272	PMID:15838274	PMID:15838281	PMID:15838297	PMID:15838314
PMID:15838316	PMID:15838317	PMID:15838320	PMID:15838322	PMID:15838342	PMID:15838347	PMID:15838348	PMID:15838356	PMID:15854664	PMID:15862157	PMID:15896361	PMID:15908460
PMID:15919662	PMID:16020391	PMID:16023617	PMID:16165095	PMID:16200958	PMID:16236710	PMID:16272206	PMID:16273641	PMID:16322351	PMID:16357303	PMID:16380457	PMID:16384835
PMID:16395254	PMID:16503991	PMID:16552365	PMID:16579936	PMID:16648610	PMID:16683693	PMID:16719791	PMID:16736156	PMID:16820593	PMID:16820940	PMID:16906041	PMID:16934677
PMID:17071121	PMID:17078114	PMID:17178876	PMID:17213481	PMID:17218419	PMID:17333248	PMID:17369464	PMID:17379848	PMID:17382552	PMID:17406057	PMID:17468135	PMID:17526654
PMID:17533154	PMID:17533428	PMID:17597010	PMID:17644565	PMID:17670915	PMID:17707940	PMID:17719141	PMID:17720771	PMID:17892518	PMID:17892519	PMID:18065659	PMID:18072084
PMID:18209478	PMID:18243553	PMID:18326921	PMID:18436224	PMID:18472024	PMID:18518881	PMID:18593636	PMID:18667482	PMID:18677292	PMID:18682267	PMID:18684528	PMID:18700189
PMID:18806627	PMID:18823320	PMID:18850267	PMID:18935914	PMID:18945502	PMID:19029977	PMID:19033447	PMID:19086031	PMID:19104001	PMID:19106820	PMID:19111553	PMID:19111903
PMID:19176890	PMID:19192484	PMID:19193866	PMID:19258664	PMID:19286939	PMID:19302591	PMID:19326569	PMID:19391127	PMID:19463745	PMID:19474389	PMID:19528809	PMID:19537925
PMID:19546173	PMID:19559390	PMID:19576044	PMID:19576886	PMID:19704104	PMID:19748488	PMID:19767294	PMID:19799911	PMID:19962413	PMID:20003820	PMID:20026366	PMID:20036082
PMID:20083630	PMID:20086041	PMID:20134037	PMID:20144075	PMID:20338996	PMID:20393598	PMID:20501440	PMID:20510028	PMID:20531225	PMID:20587945	PMID:20594472	PMID:20628433
PMID:20638037	PMID:20725139	PMID:20725141	PMID:20943854	PMID:20959139	PMID:20978008	PMID:21035524	PMID:21084678	PMID:21084714	PMID:21085652	PMID:21129429	PMID:21162225
PMID:21162281	PMID:21180137	PMID:21186584	PMID:21189559	PMID:21192421	PMID:21216243	PMID:21520072	PMID:21555119	PMID:21613578	PMID:21640709	PMID:21742016	PMID:21778413
PMID:21801588	PMID:21801591	PMID:21818684	PMID:21824440	PMID:22007724	PMID:22016368	PMID:22153010	PMID:22183953	PMID:22365956	PMID:22365958	PMID:22384254	PMID:22390138
PMID:22406300	PMID:22431579	PMID:22521290	PMID:22569294	PMID:22569295	PMID:22727794	PMID:22906761	PMID:22927341	PMID:22936708	PMID:22956308	PMID:23041290	PMID:23086942
PMID:23220478	PMID:23428131	PMID:23436727	PMID:23537435	PMID:23555567	PMID:23592126	PMID:23662699	PMID:23898483	PMID:23941276	PMID:23995100	PMID:24040253	PMID:24117217
PMID:24140435	PMID:24291639	PMID:24304569	PMID:24392990	PMID:24447812	PMID:24499246	PMID:24641950	PMID:24657892	PMID:24731444	PMID:24735959	PMID:24854661	PMID:25014910
PMID:25088996	PMID:25091502	PMID:25228257	PMID:25243430	PMID:25425077	PMID:25446983	PMID:25517973	PMID:25587122	PMID:25692855	PMID:25824048	PMID:25873305	PMID:25939574
PMID:26438559	PMID:26631506	PMID:26682937	PMID:26898123	PMID:27322312	PMID:27322388	PMID:27470334	PMID:27581840	PMID:27697218	PMID:27760762	PMID:27765761	PMID:28012855
PMID:28273940	PMID:28302570	PMID:28432001	PMID:28468962	PMID:28508833	PMID:30470661	PMID:30579678	PMID:30911278	PMID:31012341	PMID:31541683	PMID:31766450	PMID:31858571
PMID:31926404	PMID:32107448	PMID:32496159	PMID:32875489	PMID:33279571	PMID:33339902	PMID:34021781	PMID:36450128	PMID:36942826

Genomics

Comparative Map Data

Edn1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	17	22,454,924 - 22,460,812 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	22,454,420 - 22,460,885 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	17	22,330,779 - 22,336,694 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	23,934,458 - 23,940,375 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	22,266,095 - 22,271,993 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	22,136,814 - 22,143,745 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	22,137,324 - 22,143,324 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	17	24,117,499 - 24,124,188 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	17	28,303,886 - 28,309,775 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	17	28,306,726 - 28,312,616 (-)	NCBI
Celera	17	22,134,975 - 22,140,901 (-)	NCBI		Celera
Cytogenetic Map	17	p12	NCBI

EDN1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	12,230,516 - 12,297,194 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	12,290,361 - 12,297,194 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	12,290,594 - 12,297,427 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	12,398,515 - 12,405,413 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	6	12,398,644 - 12,404,761	NCBI
Celera	6	13,518,582 - 13,525,484 (+)	NCBI		Celera
Cytogenetic Map	6	p24.1	NCBI
HuRef	6	12,222,160 - 12,229,052 (+)	NCBI		HuRef
CHM1_1	6	12,292,671 - 12,299,570 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	6	12,098,871 - 12,165,580 (+)	NCBI		T2T-CHM13v2.0

Edn1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	13	42,454,952 - 42,461,466 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	13	42,454,952 - 42,461,466 (+)	Ensembl		GRCm39 Ensembl
GRCm38	13	42,301,476 - 42,307,990 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	13	42,301,476 - 42,307,990 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	13	42,396,639 - 42,403,358 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	13	42,312,448 - 42,318,962 (+)	NCBI		MGSCv36	mm8
Celera	13	43,379,939 - 43,386,658 (+)	NCBI		Celera
Cytogenetic Map	13	A4	NCBI
cM Map	13	20.82	NCBI

Edn1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955465	2,287,798 - 2,314,753 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955465	2,287,906 - 2,314,945 (-)	NCBI	ChiLan1.0	ChiLan1.0

EDN1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	6	22,843,513 - 22,941,706 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	12,076,312 - 12,142,861 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	12,405,538 - 12,503,545 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	12,462,718 - 12,503,545 (+)	Ensembl	panpan1.1		panPan2

EDN1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	35	11,808,892 - 11,815,383 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	35	11,808,892 - 11,815,383 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	35	11,760,401 - 11,766,891 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	35	11,907,692 - 11,914,182 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	35	11,907,494 - 11,914,179 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	35	11,736,723 - 11,743,212 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	35	11,786,346 - 11,792,841 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	35	13,110,983 - 13,117,475 (+)	NCBI		UU_Cfam_GSD_1.0

Edn1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	12,616,525 - 12,623,475 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936534	885,287 - 891,772 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936534	885,489 - 892,292 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

EDN1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	8,751,695 - 8,758,348 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	7	8,752,018 - 8,758,354 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	9,120,519 - 9,159,252 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3
Pig Cytomap	7	p1.3-p1.2	NCBI

EDN1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	17	59,854,186 - 59,861,319 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	17	59,853,699 - 59,861,198 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666044	12,341,006 - 12,348,096 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Edn1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624756	13,842,164 - 13,849,029 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624756	13,842,482 - 13,849,003 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Edn1
45 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	91
Count of miRNA genes:	75
Interacting mature miRNAs:	86
Transcripts:	ENSRNOT00000019361
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
9590316	Scort21	Serum corticosterone level QTL 21	4.75	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	17	1	22871563	Rat
10401807	Kidm52	Kidney mass QTL 52			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	17	1	31701463	Rat
70184	BpQTLcluster14	Blood pressure QTL cluster 14	3.38		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	1	31990913	Rat
631207	Niddm41	Non-insulin dependent diabetes mellitus QTL 41			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	17	1	37830672	Rat
1354658	Spl8	Serum phospholipid level QTL 8	3.8		blood VLDL phospholipid amount (VT:0010507)	blood very low density lipoprotein phospholipid level (CMO:0001571)	17	1	60781592	Rat
1354581	Bp247	Blood pressure QTL 247	4.5		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	17	1	69599340	Rat
1354662	Rf49	Renal function QTL 49	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	17	1	69599340	Rat
1300123	Bp194	Blood pressure QTL 194	2.82		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	2115149	34551001	Rat
631499	Stl1	Serum triglyceride level QTL 1	3.6		blood triglyceride amount (VT:0002644)	blood triglyceride level (CMO:0000118)	17	3271398	27389946	Rat
1354613	Kidm14	Kidney mass QTL 14	6.2		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	17	4299130	35837242	Rat
1354596	Bw32	Body weight QTL 32	4.5		body mass (VT:0001259)	body weight (CMO:0000012)	17	4299130	60781592	Rat
1354630	Cm34	Cardiac mass QTL 34	8.7		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	17	4299130	69599340	Rat
1354638	Insul1	Insulin level QTL 1	4.8		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	17	4299130	69599340	Rat
1354651	Lmblg2	Limb length QTL 2	6		tibia length (VT:0004357)	tibia length (CMO:0000450)	17	4299130	69599340	Rat
2293648	Bmd31	Bone mineral density QTL 31	4.5	0.0001	femur size trait (VT:1000369)	femoral neck cortical cross-sectional area (CMO:0001702)	17	4354487	27028127	Rat
2293664	Bmd28	Bone mineral density QTL 28	5.1	0.0001	femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	17	4354487	27028127	Rat
2303627	Vencon8	Ventilatory control QTL 8		0.001	respiration trait (VT:0001943)	tidal volume (CMO:0000222)	17	4528038	49528038	Rat
10054088	Scort28	Serum corticosterone level QTL 28	2.04	0.0102	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	17	4528038	49528038	Rat
2303561	Bw91	Body weight QTL 91	2		body mass (VT:0001259)	body weight (CMO:0000012)	17	8868462	53868462	Rat
1582199	Insul5	Insulin level QTL 5	3.4	0.0119	blood insulin amount (VT:0001560)	calculated serum insulin level (CMO:0000359)	17	9201365	23653323	Rat
1582208	Kidm32	Kidney mass QTL 32	3.9	0.0018	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	17	9201365	23653323	Rat
1582224	Epfw4	Epididymal fat weight QTL 4	3.5	0.0058	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	17	9201365	23653323	Rat
1582225	Bw67	Body weight QTL 67	6.2	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	17	9201365	23653323	Rat
1582226	Bw64	Body weight QTL 64	4.2	0.0017	body mass (VT:0001259)	body weight (CMO:0000012)	17	9201365	23653323	Rat
1582241	Bw70	Body weight QTL 70	4.6	0.0003	body mass (VT:0001259)	body weight (CMO:0000012)	17	9201365	23653323	Rat
1582245	Bw73	Body weight QTL 73	4.6	0.0004	body mass (VT:0001259)	body weight (CMO:0000012)	17	9201365	23653323	Rat
1582258	Bw76	Body weight QTL 76	4.6	0.0005	body mass (VT:0001259)	body weight (CMO:0000012)	17	9201365	23653323	Rat
2300002	Iddm36	Insulin dependent diabetes mellitus QTL 36	1.98		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	17	9991286	40540197	Rat
1331720	Rf43	Renal function QTL 43	2.881		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	17	15330613	23017269	Rat
1331765	Hrtrt15	Heart rate QTL 15	4.094		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	17	15330613	55836425	Rat
1354640	Scl32	Serum cholesterol level QTL 32	5.4		blood HDL cholesterol amount (VT:0000184)	blood high density lipoprotein cholesterol level (CMO:0000052)	17	15781592	60781592	Rat
1354659	Scl68	Serum cholesterol level QTL 68	3.9		blood VLDL cholesterol amount (VT:0005144)	blood very low density lipoprotein cholesterol level (CMO:0000648)	17	15781592	60781592	Rat
7394837	Memor18	Memory QTL 18			exploratory behavior trait (VT:0010471)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	17	18640182	63640182	Rat
1354628	Stl13	Serum triglyceride level QTL 13	3.8		blood triglyceride amount (VT:0002644)	blood triglyceride level (CMO:0000118)	17	21293039	60781592	Rat
70157	Niddm32	Non-insulin dependent diabetes mellitus QTL 32	4.34		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	17	22454924	50909196	Rat

Markers in Region

D17Mco5

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Rnor_5.0	17	24,122,311 - 24,122,488	NCBI	Rnor5.0
Rnor_5.0	17	24,122,310 - 24,122,487	NCBI	Rnor5.0
RGSC_v3.4	17	28,308,076 - 28,308,253	RGD	RGSC3.4
RGSC_v3.4	17	28,308,077 - 28,308,254	UniSTS	RGSC3.4
RGSC_v3.1	17	28,310,917 - 28,311,094	RGD
Celera	17	22,139,165 - 22,139,380	UniSTS
Cytogenetic Map	17	p12	UniSTS

Related Rat Strains

The following Strains have been annotated to Edn1

F344.OLETF-(D17Mgh4-Edn1)/Tj

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	1	2									11	11
Low	2	41	41	28	17	28	7	9	74	35	29		7
Below cutoff			16	13	2	13	1	2			1		1

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_012548	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017600453	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF122903	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473977	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000288	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M64711	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000019361 ⟹ ENSRNOP00000019361

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	17	22,454,420 - 22,460,885 (-)	Ensembl
Rnor_6.0 Ensembl	17	22,137,324 - 22,143,324 (-)	Ensembl

RefSeq Acc Id:

NM_012548 ⟹ NP_036680

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	17	22,454,924 - 22,460,812 (-)	NCBI
Rnor_6.0	17	22,137,324 - 22,143,324 (-)	NCBI
Rnor_5.0	17	24,117,499 - 24,124,188 (-)	NCBI
RGSC_v3.4	17	28,303,886 - 28,309,775 (-)	RGD
Celera	17	22,134,975 - 22,140,901 (-)	RGD

Sequence:

show sequence

CGCGACGCTTTCGCTCCGGTGAAGGGGCCACTTTTTGAAGACCGCGCTGAGATCTCCAAAAGCC
AGAGGCGATCAGAGCAACCAGACACCGTCCTCTTCGTTTTGCATTGAGTTCCATTTGCAACCGA
GTTTTCTTTCTTTCTTTTTTTTTTCTTTTTTTCCCTCCTCTTCTTCTGATCCCTTTGCAGAATG
GATTATTTTCCCGTGATCTTCTCTCTGCTGTTTGTGGCTTTCCAAGGAGCTCCAGAAACAGCTG
TCTTGGGAGCAGAGCTCAGCCCCCGAGCTGAGAAGGAAGTGCAGAGCCCCCCTCCCAGCACATC
CTGGAGACCCCGCAGGTCCAAGCGTTGCTCCTGCTCCTCCTTGATGGACAAGGAGTGTGTCTAC
TTCTGCCACCTGGACATCATCTGGGTCAACACTCCCGAGCGCGTCGTCCCGTATGGACTAGGAA
GCCCTTCTAGGTCTAAGCGATCCTTGAAAGACTTACTTCCCACAAAGACCACAGACCAAGGGAA
CAGATGCCAGTGTGCTCACCAAAAAGACAAGAAGTGCTGGAATTTCTGCCAAGCAGACAAAGAA
CTCCGAGCCCAAAGTACCATGCAGAAAGGCGTAAAAGACTTCAAGAAGGGAAAACCCTGTCCCA
AGCTGGGAAAGAAGTGTATCTATCAGCAGCTGGTGGAGGGAAGAAAACTAAGAAGGTTGGAGGC
CATCAGCAACAGCATCAAGACCTCCTTTCGAGTTGCAAAGTTGAAAGCGGAACTCTACAGAGAC
CAGAAGTTGATACACAACCGAGCACATTGACTACAGAGCCCCGTGGTGTTTTGGAAGCCATGAC
TTACATAGAGCGAGCCCTATGGCCAACTCTGCGCTCTCCATGCTGGCTGGGATCTTAGCAAGAA
CATCTGTCCGGCTTCTACAGTTTCTTGTTCAGACTGGCAGAGGACCAGCGTCCTTGTTCCAAAC
ATTCCAAGAGAGGTTGAGGTGTTCCCTAACCTGTCTTCGTTTGCATCCGCTGGTAGCAAGTGAT
TCTCTTGCCTCTTCTTGCTGTCTGGGGATGGCCTCGGACCTCTCGGAGAGCAGAGACACAGTGC
CATTCCTGAGTGGCATCATCCAGAGAGCCAGGAGATTCCATAGCAGGGCGGAGTTTCTGTAGAA
AGTCCTTAGGGAGTGTTCGTGTCTGACTCAGGCGCCTGGCACATTTCAGGGAGAAACTCCAAAG
TCCATGCAAAAAATTTTCTGAGGAATGCACAAATTGAAAACATACTCGAAGGACAAACACTTGA
GTTTTTTTTTTTTAAGGACTTTTTTTTAAGTTGTAAAATGCAAAACTCAAAGCAACTGTTACTA
CTGTACATTAGGATATGTTTCATGAATATGAGTCTACCTCACCTTT

hide sequence

Protein Sequences


Protein RefSeqs	NP_036680	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA41129	(Get FASTA)	NCBI Sequence Viewer
	AAF31762	(Get FASTA)	NCBI Sequence Viewer
	EDL98206	(Get FASTA)	NCBI Sequence Viewer
	P22388	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_036680 ⟸ NM_012548
- Peptide Label:	preproprotein
- UniProtKB:	P22388 (UniProtKB/Swiss-Prot), A6J756 (UniProtKB/TrEMBL)
- Sequence:	show sequence MDYFPVIFSLLFVAFQGAPETAVLGAELSPRAEKEVQSPPPSTSWRPRRSKRCSCSSLMDKECV YFCHLDIIWVNTPERVVPYGLGSPSRSKRSLKDLLPTKTTDQGNRCQCAHQKDKKCWNFCQADK ELRAQSTMQKGVKDFKKGKPCPKLGKKCIYQQLVEGRKLRRLEAISNSIKTSFRVAKLKAELYR DQKLIHNRAH hide sequence

RefSeq Acc Id:

ENSRNOP00000019361 ⟸ ENSRNOT00000019361

Protein Domains

Endothelin-like toxin

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P22388-F1-model_v2	AlphaFold	P22388	1-202	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2532	AgrOrtholog
BioCyc Gene	G2FUF-9785	BioCyc
Ensembl Genes	ENSRNOG00000014361	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Protein	ENSRNOP00000019361	ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000019361	ENTREZGENE, UniProtKB/Swiss-Prot
InterPro	Endothelin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Endothelin_toxin_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Endothln-like_toxin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:24323	UniProtKB/Swiss-Prot
NCBI Gene	24323	ENTREZGENE
PANTHER	ENDOTHELIN	UniProtKB/TrEMBL
	ENDOTHELIN-1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR13874	UniProtKB/Swiss-Prot
Pfam	Endothelin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Edn1	PhenoGen
PRINTS	ENDOTHELIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	ENDOTHELIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	END	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A6J756	ENTREZGENE, UniProtKB/TrEMBL
	EDN1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2002-06-10	Edn1	endothelin 1			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_disease	associated with chronic obstructive pulmonary disease (COPD), hypoxic pulmonary vasoconstriction (HPV), pulmonary arterial remodeling, and polycythemia	625753
gene_disease	contributes to cardiovascular diseases, participates in the pathogenesis of deoxycorticosterone acetate (DOCA)-salt-induced hypertension	625753
gene_drugs	DOCA treated rats had a higher levels of renal, urinary and aortic expression which was normalized by the treatment with Ednra antagonist ABT-627	625753
gene_expression	expressed in lung and cultured pulmonary artery endothelial cells	625753
gene_function	acts as a vasoactive and mitogenic peptide
gene_other	intravenous administration causes a decrease in the arterial pressure	625753
gene_process	acts as a vasoactive and mitogenic peptide	625753
gene_process	potent vasopressor found in the vascular endothelial cells	628459
gene_process	potent vasopressor found in the vascular endothelial cells	628515
gene_process	potent vasopressor found in the vascular endothelial cells	628516
gene_process	potent vasopressor found in the vascular endothelial cells	628517
gene_process	role in the development of chronic hypoxia induced pulmonary hypertension, acts as a vasoconstrictor to augment hypoxic pulmonary vasoconstriction [HPV]	625753
gene_regulation	lungs of ovariectomized (OVX) rats showed an increase in prepro- endothelin mRNA levels when exposed to hypoxia and increase was blocked by ovarian hormone 17-B-estradiol (E2B)	625753
gene_regulation	gene expression is mediated by transcription factor hypoxia-inducible factor 1 (HIF-1)	625753
gene_regulation	promoter activity was increased by transcriptional coactivator cAMP response element binding protein (CREB) binding protein (CBP)/p300	625753
gene_regulation	increase in the plasma endothelin levels has no effect on the arterial pressure in the homozygous spotting lethal rats	625753

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - PID (archival)