Advanced Search (OLGA)

Gene: Dlx5 (distal-less homeobox 5) Rattus norvegicus

Analyze

Symbol:

Dlx5

Name:

distal-less homeobox 5

RGD ID:

2506

Description:

Predicted to enable DNA-binding transcription activator activity, RNA polymerase II-specific; HMG box domain binding activity; and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Involved in cellular response to zinc ion starvation and positive regulation of osteoblast differentiation. Predicted to be located in chromatin; cytoplasm; and nucleus. Human ortholog(s) of this gene implicated in split hand-foot malformation 1 and split hand-foot malformation 1 with sensorineural hearing loss. Orthologous to human DLX5 (distal-less homeobox 5); INTERACTS WITH 1,2,4-trimethylbenzene; 17alpha-ethynylestradiol; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Distal-less homeobox; DLX-3; homeobox protein DLX-3; homeobox protein DLX-5; RDLX

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	DLX5 (distal-less homeobox 5)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Dlx5 (distal-less homeobox 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Dlx5 (distal-less homeobox 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	DLX5 (distal-less homeobox 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	DLX5 (distal-less homeobox 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Dlx5 (distal-less homeobox 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	DLX5 (distal-less homeobox 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	LOC103226510 (uncharacterized LOC103226510)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Dlx5 (distal-less homeobox 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	DLX3 (distal-less homeobox 3)	HGNC	OrthoDB
Homo sapiens (human):	PRKACA (protein kinase cAMP-activated catalytic subunit alpha)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Dlx5 (distal-less homeobox 5)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	DLX5 (distal-less homeobox 5)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	dlx5a (distal-less homeobox 5a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Dll	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER)
Caenorhabditis elegans (roundworm):	ceh-43	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	dlx5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	35,965,579 - 35,969,973 (-)	NCBI		GRCr8
mRatBN7.2	4	34,999,139 - 35,003,504 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	34,999,139 - 35,003,407 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	39,958,038 - 39,962,304 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	35,884,208 - 35,888,474 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	34,304,193 - 34,308,455 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	32,387,741 - 32,392,085 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	32,387,741 - 32,392,007 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	32,255,323 - 32,259,589 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	31,778,500 - 31,782,767 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	31,897,039 - 31,901,307 (-)	NCBI
Celera	4	30,515,648 - 30,519,914 (-)	NCBI		Celera
Cytogenetic Map	4	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Birth Weight (ISO)

bone development disease (ISO)

Craniofacial Abnormalities (ISO)

genetic disease (ISO)

pleomorphic xanthoastrocytoma (ISO)

split hand-foot malformation (ISO)

split hand-foot malformation 1 (ISO,ISS)

split hand-foot malformation 1 with sensorineural hearing loss (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2,4-trimethylbenzene (EXP)

1,2-dichloroethane (ISO)

1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO)

17alpha-ethynylestradiol (EXP,ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

4,4'-sulfonyldiphenol (ISO)

5-aza-2'-deoxycytidine (ISO)

5-azacytidine (ISO)

6-propyl-2-thiouracil (EXP)

acetohydrazide (ISO)

all-trans-retinoic acid (EXP,ISO)

alpha-Zearalanol (EXP)

amitrole (EXP)

ammonium chloride (EXP)

antirheumatic drug (ISO)

benzo[a]pyrene (EXP,ISO)

bisphenol A (EXP,ISO)

butanal (ISO)

C60 fullerene (EXP)

cadmium atom (ISO)

cannabidiol (ISO)

carbamazepine (ISO)

carbonyl sulfide (EXP)

CGP 52608 (ISO)

clofibrate (ISO)

Cuprizon (EXP)

cyproconazole (ISO)

DDT (ISO)

decabromodiphenyl ether (ISO)

dexamethasone (ISO)

dorsomorphin (ISO)

fenvalerate (EXP)

flusilazole (EXP)

fonofos (ISO)

genistein (EXP)

gentamycin (EXP)

hexaconazole (ISO)

ketamine (EXP)

mercury dibromide (ISO)

methimazole (EXP)

methylmercury chloride (ISO)

monosodium L-glutamate (EXP)

morphine (ISO)

naphthalenes (EXP)

ochratoxin A (ISO)

okadaic acid (ISO)

oxaliplatin (EXP)

p-chloromercuribenzoic acid (ISO)

parathion (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP)

progesterone (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

tamoxifen (ISO)

terbufos (ISO)

Tetrachlorobisphenol A (ISO)

tetrachloromethane (EXP)

thapsigargin (ISO)

titanium dioxide (ISO)

topotecan (EXP)

trichloroethene (EXP)

trichostatin A (ISO)

tunicamycin (ISO)

valproic acid (ISO)

zinc atom (EXP)

zinc(0) (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

anatomical structure formation involved in morphogenesis (IEA,ISO)

axon guidance (IEA,ISO)

axonogenesis (IEA,ISO)

BMP signaling pathway (IEA,ISO)

bone morphogenesis (IEA,ISO)

cell differentiation (IBA)

cell population proliferation (IEA,ISO,ISS)

cellular response to zinc ion starvation (IEP)

ear development (IEA,ISO)

embryonic limb morphogenesis (IEA,ISO)

embryonic skeletal system development (IBA)

endochondral ossification (IEA,ISO,ISS)

epithelial cell differentiation (IEA,ISO)

face morphogenesis (IEA,ISO)

head development (IEA,ISO)

inner ear morphogenesis (IEA,ISO)

interneuron axon guidance (IEA,ISO)

olfactory bulb interneuron differentiation (IEA,ISO)

olfactory pit development (IEA,ISO)

ossification (IEA)

osteoblast differentiation (IEA,ISO,ISS)

positive regulation of canonical Wnt signaling pathway (IEA,ISO)

positive regulation of DNA-templated transcription (IEA,ISO,ISS)

positive regulation of epithelial cell proliferation (IEA,ISO)

positive regulation of gene expression (IEA,ISO)

positive regulation of osteoblast differentiation (IMP)

positive regulation of transcription by RNA polymerase II (IEA,ISO)

regulation of DNA-templated transcription (IEA,ISO)

regulation of transcription by RNA polymerase II (IBA)

roof of mouth development (IEA,ISO)

Cellular Component

chromatin (IEA,ISO)

cytoplasm (IEA,ISO)

nucleus (IEA,ISO)

Molecular Function

DNA binding (IEA,ISO)

DNA-binding transcription activator activity, RNA polymerase II-specific (IEA,ISO)

DNA-binding transcription factor activity (TAS)

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA,IEA)

HMG box domain binding (IEA,ISO)

protein binding (ISO)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA,IEA,ISO)

sequence-specific double-stranded DNA binding (IEA,ISO)

transcription cis-regulatory region binding (IEA,ISO,ISS)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Zinc deficiency decreases osteoblasts and osteoclasts associated with the reduced expression of Runx2 and RANK.	Hie M, etal., Bone. 2011 Dec;49(6):1152-9. doi: 10.1016/j.bone.2011.08.019. Epub 2011 Aug 26.
4.	BMP-2-induced Runx2 expression is mediated by Dlx5, and TGF-beta 1 opposes the BMP-2-induced osteoblast differentiation by suppression of Dlx5 expression.	Lee MH, etal., J Biol Chem 2003 Sep 5;278(36):34387-94. Epub 2003 Jun 18.
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
8.	GOA pipeline	RGD automated data pipeline
9.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
11.	Molecular cloning and evolutional analysis of a mammalian homologue of the Distal-less 3 (Dlx-3) homeobox gene.	Shirasawa T, etal., FEBS Lett 1994 Sep 12;351(3):380-4.
12.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
13.	rDlx, a novel distal-less-like homeoprotein is expressed in developing cartilages and discrete neuronal tissues.	Zhao GQ, etal., Dev Biol 1994 Jul;164(1):37-51.

Additional References at PubMed

PMID:9415433	PMID:10516593	PMID:12112878	PMID:12142028	PMID:12533617	PMID:15306564	PMID:15383550	PMID:15456894	PMID:16115867	PMID:16330189	PMID:16582099	PMID:16900517
PMID:17420000	PMID:17804636	PMID:17878916	PMID:18326838	PMID:19497851	PMID:19956613	PMID:20843790	PMID:21503878	PMID:24042587	PMID:25937343	PMID:29901112

Genomics

Comparative Map Data

Dlx5
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	35,965,579 - 35,969,973 (-)	NCBI		GRCr8
mRatBN7.2	4	34,999,139 - 35,003,504 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	34,999,139 - 35,003,407 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	39,958,038 - 39,962,304 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	35,884,208 - 35,888,474 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	34,304,193 - 34,308,455 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	32,387,741 - 32,392,085 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	32,387,741 - 32,392,007 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	32,255,323 - 32,259,589 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	31,778,500 - 31,782,767 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	31,897,039 - 31,901,307 (-)	NCBI
Celera	4	30,515,648 - 30,519,914 (-)	NCBI		Celera
Cytogenetic Map	4	q21	NCBI

DLX5
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	97,020,396 - 97,024,831 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	97,020,396 - 97,024,950 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	7	96,649,708 - 96,654,143 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	96,487,638 - 96,492,079 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	7	96,294,358 - 96,298,794	NCBI
Celera	7	91,343,634 - 91,348,072 (-)	NCBI		Celera
Cytogenetic Map	7	q21.3	NCBI
HuRef	7	91,251,295 - 91,255,732 (-)	NCBI		HuRef
CHM1_1	7	96,579,739 - 96,584,181 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	7	98,250,072 - 98,254,502 (-)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	95,972,198 - 95,976,639 (-)	NCBI

Dlx5
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	6,877,801 - 6,882,068 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	6,877,805 - 6,882,085 (-)	Ensembl		GRCm39 Ensembl
GRCm38	6	6,877,801 - 6,882,068 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	6,877,805 - 6,882,085 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	6,827,805 - 6,832,068 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	6	6,827,805 - 6,832,068 (-)	NCBI		MGSCv36	mm8
Celera	6	7,023,868 - 7,028,132 (-)	NCBI		Celera
Cytogenetic Map	6	A1	NCBI
cM Map	6	2.83	NCBI

Dlx5
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955432	13,429,415 - 13,434,258 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955432	13,429,832 - 13,434,160 (-)	NCBI	ChiLan1.0	ChiLan1.0

DLX5
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	114,856,668 - 114,863,007 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	163,121,305 - 163,127,639 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	88,972,066 - 88,977,588 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	102,556,636 - 102,561,186 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	102,555,267 - 102,561,186 (-)	Ensembl	panpan1.1		panPan2

DLX5
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	14	22,080,351 - 22,085,188 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	14	22,080,699 - 22,084,867 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	14	21,648,083 - 21,652,478 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	14	21,897,429 - 21,901,826 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	14	21,897,417 - 21,902,078 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	14	22,044,142 - 22,048,532 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	14	21,779,484 - 21,783,873 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	14	22,043,227 - 22,047,620 (-)	NCBI		UU_Cfam_GSD_1.0

Dlx5
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	35,346,260 - 35,401,337 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936585	3,461,944 - 3,466,641 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936585	3,462,063 - 3,466,641 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

DLX5
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	9	76,639,561 - 76,643,884 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	9	76,639,915 - 76,643,689 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

LOC103226510
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	21	52,032,933 - 52,092,791 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	21	52,036,401 - 52,040,903 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666042	52,268,203 - 52,315,364 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Dlx5
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624813	3,760,661 - 3,765,517 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624813	3,760,890 - 3,765,309 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Dlx5
21 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	56
Count of miRNA genes:	48
Interacting mature miRNAs:	56
Transcripts:	ENSRNOT00000014946
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2302371	Stl22	Serum triglyceride level QTL 22	5.15		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	5218294	57114705	Rat
2303585	Bw86	Body weight QTL 86	4		body mass (VT:0001259)	body weight (CMO:0000012)	4	14678065	59678065	Rat
8552906	Pigfal3	Plasma insulin-like growth factor 1 level QTL 3			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	4	10084089	55084089	Rat
10755501	Bp390	Blood pressure QTL 390	2.5		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	4	26775591	168368347	Rat
8655949	Rf62	Renal function QTL 62	22		blood urea nitrogen amount (VT:0005265)	plasma urea nitrogen level (CMO:0000586)	4	34430119	44463908	Rat
6478766	Anxrr47	Anxiety related response QTL 47		0.09637	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	4	10084089	55084089	Rat
8552782	Vie1	Viral induced encephalitis QTL 1	26.4		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	4	34430484	82490359	Rat
70222	Eae2	Experimental allergic encephalomyelitis QTL 2	4.3		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	4	21333343	39505420	Rat
631642	Stl2	Serum triglyceride level QTL 2	3.3		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	5219178	56647776	Rat
6478769	Anxrr48	Anxiety related response QTL 48		0.02514	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	10084089	55084089	Rat
631261	Tcas3	Tongue tumor susceptibility QTL 3	6.88		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	4	10814170	91360527	Rat
634323	Hc2	Hypercalciuria QTL 2	2.15		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	4	210796	45210796	Rat
2313401	Anxrr27	Anxiety related response QTL 27			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	4	17933508	62933508	Rat
631209	Bw2	Body weight QTL2	4.2		retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	4	9940885	44463908	Rat
6909128	Pancm4	Pancreatic morphology QTL 4	11.35		pancreas mass (VT:0010144)	pancreas wet weight (CMO:0000626)	4	26907285	75585128	Rat
8694374	Bw155	Body weight QTL 155	3.39	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	4	10084089	55084089	Rat
2303168	Bp330	Blood pressure QTL 330	4.25	0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	5214602	146446691	Rat
8552801	Bw143	Body weight QTL 143	7.3		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	4	34430484	82490359	Rat
61412	Pia2	Pristane induced arthritis QTL 2	3.9		joint integrity trait (VT:0010548)	post-insult time to onset of experimental arthritis (CMO:0001450)	4	21333343	62278020	Rat
6478724	Anxrr35	Anxiety related response QTL 35		0.00449	defecation behavior trait (VT:0010462)	defecation measurement (CMO:0000997)	4	10084089	55084089	Rat
8655906	Rf60	Renal function QTL 60	3.8		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	4	29494195	81006281	Rat
61415	Eae11	Experimental allergic encephalomyelitis QTL 11	2.9		nervous system integrity trait (VT:0010566)	post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422)	4	1	39505420	Rat
619616	Bp79	Blood pressure QTL 79		0.0292	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	5214602	78882945	Rat
7387227	Uae40	Urinary albumin excretion QTL 40	2.9	0.0052	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	4	17946999	62946999	Rat
6909122	Insul22	Insulin level QTL 22	4.63		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	4	26907285	75585128	Rat
8552809	Vie5	Viral induced encephalitis QTL 5	25.3		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	4	34430484	82490359	Rat
1358203	Stl19	Serum triglyceride level QTL 19	2.8	0.002	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	5218294	65958103	Rat
9590304	Scort17	Serum corticosterone level QTL 17	4.96	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	10084089	55084089	Rat
12798520	Anxrr55	Anxiety related response QTL 55	4.45	0.01	locomotor behavior trait (VT:0001392)	number of rearing movements with lid-pushing in an experimental apparatus (CMO:0002715)	4	32583980	114627242	Rat
11530004	Niddm71	Non-insulin dependent diabetes mellitus QTL 71		0.001	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	4	32584199	52754138	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	11320076	180699135	Rat
1354665	Stl10	Serum triglyceride level QTL 10	3.57		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	21333343	44463908	Rat
1300141	Bp178	Blood pressure QTL 178			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	10024901	39524530	Rat

Markers in Region

AA998469

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	4	35,965,762 - 35,966,628 (+)	Marker Load Pipeline
Rnor_6.0	4	32,387,925 - 32,388,790	NCBI	Rnor6.0
Rnor_5.0	4	32,255,507 - 32,256,372	UniSTS	Rnor5.0
RGSC_v3.4	4	31,778,684 - 31,779,550	UniSTS	RGSC3.4
Celera	4	30,515,832 - 30,516,697	UniSTS
RH 3.4 Map	4	811.83	UniSTS
Cytogenetic Map	4	q13	UniSTS

AI385752

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	34,999,397 - 34,999,499 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	32,388,000 - 32,388,101	NCBI	Rnor6.0
Rnor_5.0	4	32,255,582 - 32,255,683	UniSTS	Rnor5.0
RGSC_v3.4	4	31,778,759 - 31,778,860	UniSTS	RGSC3.4
Celera	4	30,515,907 - 30,516,008	UniSTS
Cytogenetic Map	4	q13	UniSTS

MARC_9717-9718:996688547:1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	35,002,916 - 35,003,225 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	32,391,517 - 32,391,825	NCBI	Rnor6.0
Rnor_5.0	4	32,259,099 - 32,259,407	UniSTS	Rnor5.0
RGSC_v3.4	4	31,782,277 - 31,782,585	UniSTS	RGSC3.4
Celera	4	30,519,424 - 30,519,732	UniSTS
Cytogenetic Map	4	q13	UniSTS

Dlx5

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	34,999,262 - 34,999,813 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	32,387,865 - 32,388,415	NCBI	Rnor6.0
Rnor_5.0	4	32,255,447 - 32,255,997	UniSTS	Rnor5.0
RGSC_v3.4	4	31,778,624 - 31,779,174	UniSTS	RGSC3.4
Celera	4	30,515,772 - 30,516,322	UniSTS
Cytogenetic Map	4	q13	UniSTS

DLX5_2316

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	34,999,093 - 34,999,786 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	32,387,696 - 32,388,388	NCBI	Rnor6.0
Rnor_5.0	4	32,255,278 - 32,255,970	UniSTS	Rnor5.0
RGSC_v3.4	4	31,778,455 - 31,779,147	UniSTS	RGSC3.4
Celera	4	30,515,603 - 30,516,295	UniSTS
Cytogenetic Map	4	q13	UniSTS

Dlx5

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	34,999,182 - 34,999,598 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	32,387,785 - 32,388,200	NCBI	Rnor6.0
Rnor_5.0	4	32,255,367 - 32,255,782	UniSTS	Rnor5.0
RGSC_v3.4	4	31,778,544 - 31,778,959	UniSTS	RGSC3.4
Celera	4	30,515,692 - 30,516,107	UniSTS
Cytogenetic Map	4	q13	UniSTS

Dlx5

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	35,003,163 - 35,003,228 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	32,391,764 - 32,391,828	NCBI	Rnor6.0
Rnor_5.0	4	32,259,346 - 32,259,410	UniSTS	Rnor5.0
RGSC_v3.4	4	31,782,524 - 31,782,588	UniSTS	RGSC3.4
Celera	4	30,519,671 - 30,519,735	UniSTS
Cytogenetic Map	4	q13	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
7	3	46	106	36	33	11	10	11	6	120	73	89	26	48	22

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_012943	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017592486	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB073716	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473959	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D31734	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	L24443	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000014946 ⟹ ENSRNOP00000014946

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	34,999,139 - 35,003,407 (-)	Ensembl
Rnor_6.0 Ensembl	4	32,387,741 - 32,392,007 (-)	Ensembl

RefSeq Acc Id:

NM_012943 ⟹ NP_037075

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	35,965,579 - 35,969,845 (-)	NCBI
mRatBN7.2	4	34,999,139 - 35,003,407 (-)	NCBI
Rnor_6.0	4	32,387,741 - 32,392,007 (-)	NCBI
Rnor_5.0	4	32,255,323 - 32,259,589 (-)	NCBI
RGSC_v3.4	4	31,778,500 - 31,782,767 (-)	RGD
Celera	4	30,515,648 - 30,519,914 (-)	RGD

Sequence:

show sequence

GACAGAGCCTCCACGACTCCCAGCCTCCTCCTCCCCGCCGCCGCCGCCACCGCCGCCGCCTCCT
CTTCCTCCTCCTCCTCCCTCGCTCCCACAGCCATGTCTGCTTAGACCAGAGCAGCTCCACAGCC
AATTCTGGCAGCAGCGGCCGCCTCAATAGGACAGCCACCGCCCGGGAGCTATGACAGGAGTGTT
TGACAGAAGAGTCCCAAGCATCCGATCCGGCGACTTCCAAGCTCCGTTCCCGACGTCCGCCGCC
ATGCACCACCCGTCTCAGGAATCGCCAACTTTGCCGGAGTCCTCGGCCACCGATTCTGACTACT
ACAGTCCCGCGGGGGCCGCCCCTCATGGCTACTGCTCTCCTACCTCTGCTTCTTACCGCAAAGC
GCTCAACCCATACCAGTACCAGTATCACAGCGTGAACGGCTCCGCAGCCGGCTACCCGGCCAAG
GCTTATGCGGACTACGGCTACGCCAGCCCCTACCACCAGTACGGAGGCGCCTACAACCGAGTCC
CGAGTGCCACCAGCCAGCCAGAGAAAGAAGTGGCCGAGCCAGAGGTGAGGATGGTGAATGGTAA
ACCAAAGAAAGTTCGTAAACCCAGGACTATTTATTCCAGCTTTCAGCTGGCCGCTTTACAGAGA
AGGTTTCAGAAGACTCAGTACCTCGCCCTGCCAGAACGCGCGGAGTTGGCCGCCTCTCTAGGAC
TGACGCAAACACAGGTGAAAATCTGGTTTCAGAACAAAAGATCCAAGATCAAGAAGATCATGAA
AAACGGGGAGATGCCCCCGGAGCACAGTCCCAGCTCCAGCGACCCTATGGCGTGTAACTCGCCA
CAGTCACCAGCGGTGTGGGAGCCCCAGGGCTCATCCCGCTCTCTCAGCCACCACCCTCATGCCC
ACCCTACGACCTCCAACCAGTCCCCCGCGTCCAGCTACCTGGAGAACTCGGCTTCCTGGTACCC
AAGTGCAGCCAGCTCAATCAATTCCCACCTGCCACCGCCTGGCTCCCTGCAGCACCCGCTGGCA
CTGGCCTCCGGGACGCTTTATTAGATGGGCTACTCTCTCTTGCTCAGTTTTGGGACTACAGTGT
TTTCCTGTTTTAGAAATCAGAAAGAAAGGAATTCATACGGGGATGTTTGAACAATGGAAACAAA
GATTCATGTGTAAAGCTTTTTTTTTGCATGTAAGTTATTGCATTTCAAAGGACCCCGCCCCTTT
TTTTACGAAAAGAACCCTTTTTTGCGCAACTGTGGACACTATCAATGGTGCCTTGAAATCTATG
ACCTCAACTTTTCAAAAAGACTTTTTTCAATGTTATTTTAACCGTGTAAATAAGTGTAGATAGA
GGAATTAAACTGTATATTCTGGATAAATAAAATTATTTCGACCATG

hide sequence

RefSeq Acc Id:

XM_017592486 ⟹ XP_017447975

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	35,966,225 - 35,969,973 (-)	NCBI
mRatBN7.2	4	34,999,675 - 35,003,504 (-)	NCBI
Rnor_6.0	4	32,389,485 - 32,392,085 (-)	NCBI

Sequence:

show sequence

ACCCCGCTGTGCGTAAGCGCGCAATTAAGGATTTAACCAAGGCTGTGCTGCGCCTCAGCCAACA
GTCAGCCTGCGGGAGACAGAGCCTCCACGACTCCCAGCCTCCTCCTCCCCGCCGCCGCCGCCAC
CGCCGCCGCCTCCTCTTCCTCCTCCTCCTCCCTCGCTCCCACAGCCATGTCTGCTTAGACCAGA
GCAGCTCCACAGCCAATTCTGGCAGCAGCGGCCGCCTCAATAGGACAGCCACCGCCCGGGAGCT
ATGACAGGAGTGTTTGACAGAAGAGTCCCAAGCATCCGATCCGGCGACTTCCAAGCTCCGTTCC
CGACGTCCGCCGCCATGCACCACCCGTCTCAGGAATCGCCAACTTTGCCGGAGTCCTCGGCCAC
CGATTCTGACTACTACAGTCCCGCGGGGGCCGCCCCTCATGGCTACTGCTCTCCTACCTCTGCT
TCTTACCGCAAAGCGCTCAACCCATACCAGTACCAGTATCACAGCGTGAACGGCTCCGCAGCCG
GCTACCCGGCCAAGGCTTATGCGGACTACGGCTACGCCAGCCCCTACCACCAGTACGGAGGCGC
CTACAACCGAGTCCCGAGTGCCACCAGCCAGCCAGCTTTCAGCTGGCCGCTTTACAGAGAAGGT
TTCAGAAGACTCAGTACCTCGCCCTGCCAGAACGCGCGGAGTTGGCCGCCTCTCTAG

hide sequence

Protein Sequences


Protein RefSeqs	NP_037075	(Get FASTA)	NCBI Sequence Viewer
	XP_017447975	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA42026	(Get FASTA)	NCBI Sequence Viewer
	BAA06534	(Get FASTA)	NCBI Sequence Viewer
	BAB71722	(Get FASTA)	NCBI Sequence Viewer
	EDM15037	(Get FASTA)	NCBI Sequence Viewer
	EDM15038	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000014946
GenBank Protein	P50575	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_037075 ⟸ NM_012943

- UniProtKB:

A0A0G2JSK6 (UniProtKB/TrEMBL), A6IDV1 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MTGVFDRRVPSIRSGDFQAPFPTSAAMHHPSQESPTLPESSATDSDYYSPAGAAPHGYCSPTSA
SYRKALNPYQYQYHSVNGSAAGYPAKAYADYGYASPYHQYGGAYNRVPSATSQPEKEVAEPEVR
MVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNKRSKI
KKIMKNGEMPPEHSPSSSDPMACNSPQSPAVWEPQGSSRSLSHHPHAHPTTSNQSPASSYLENS
ASWYPSAASSINSHLPPPGSLQHPLALASGTLY

hide sequence

RefSeq Acc Id:	XP_017447975 ⟸ XM_017592486
- Peptide Label:	isoform X1
- Sequence:	show sequence MTGVFDRRVPSIRSGDFQAPFPTSAAMHHPSQESPTLPESSATDSDYYSPAGAAPHGYCSPTSA SYRKALNPYQYQYHSVNGSAAGYPAKAYADYGYASPYHQYGGAYNRVPSATSQPAFSWPLYREG FRRLSTSPCQNARSWPPL hide sequence

Ensembl Acc Id:

ENSRNOP00000014946 ⟸ ENSRNOT00000014946

Protein Domains

Homeobox

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P50575-F1-model_v2	AlphaFold	P50575	1-289	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692867

Promoter ID:

EPDNEW_R3391

Type:

single initiation site

Name:

Dlx5_1

Description:

distal-less homeobox 5

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	4	32,392,025 - 32,392,085	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2506	AgrOrtholog
BioCyc Gene	G2FUF-45680	BioCyc
Ensembl Genes	ENSRNOG00000010905	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000014946	ENTREZGENE
Gene3D-CATH	Homeodomain-like	UniProtKB/Swiss-Prot
InterPro	Distal-less_Homeobox_TF	UniProtKB/Swiss-Prot
	Distal-less_N	UniProtKB/Swiss-Prot
	Homeobox-like_sf	UniProtKB/Swiss-Prot
	Homeobox_CS	UniProtKB/Swiss-Prot
	Homeobox_dom	UniProtKB/Swiss-Prot
	Homeobox_metazoa	UniProtKB/Swiss-Prot
	HTH_motif	UniProtKB/Swiss-Prot
KEGG Report	rno:25431	UniProtKB/Swiss-Prot
NCBI Gene	25431	ENTREZGENE
PANTHER	HOMEOBOX PROTEIN	UniProtKB/Swiss-Prot
	HOMEOBOX PROTEIN DLX-5	UniProtKB/Swiss-Prot
Pfam	DLL_N	UniProtKB/Swiss-Prot
	Homeodomain	UniProtKB/Swiss-Prot
PhenoGen	Dlx5	PhenoGen
PRINTS	HOMEOBOX	UniProtKB/Swiss-Prot
	HTHREPRESSR	UniProtKB/Swiss-Prot
PROSITE	HOMEOBOX_1	UniProtKB/Swiss-Prot
	HOMEOBOX_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000010905	RatGTEx
SMART	HOX	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF46689	UniProtKB/Swiss-Prot
TIGR	TC219849
UniProt	A0A0G2JSK6	ENTREZGENE, UniProtKB/TrEMBL
	A6IDV0_RAT	UniProtKB/TrEMBL
	A6IDV1	ENTREZGENE, UniProtKB/TrEMBL
	DLX5_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q91WY7_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2002-06-10	Dlx5	Distal-less homeobox			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed specifically in osteogenic cells	1298882
gene_expression	expressed in developing skeletal and neuronal tissues	1298881
gene_expression	expressed in fibroblasts	1298881
gene_process	important mediator of BMP-2-induced Runx2 expression	1298882
gene_process	induces BMP-2 mediated osetoeblast differentiation and blocks TGFB1-mediated inhibition of osteoblast differentiation	1298882
gene_transcript	induced by bone morphogenic protein (BMP) 2 and 4 signaling	1298882
gene_transcript	suppressed by TGFB1	1298882

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM