Cyp7b1 (cytochrome P450 family 7 subfamily B member 1)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Cyp7b1 (cytochrome P450 family 7 subfamily B member 1) Rattus norvegicus

Analyze

Symbol:

Cyp7b1

Name:

cytochrome P450 family 7 subfamily B member 1

RGD ID:

2483

Description:

Predicted to enable oxysterol 7-alpha-hydroxylase activity. Involved in several processes, including circadian rhythm; memory; and response to cAMP. Predicted to be located in endoplasmic reticulum membrane. Human ortholog(s) of this gene implicated in congenital bile acid synthesis defect 3 and hereditary spastic paraplegia 5A. Orthologous to human CYP7B1 (cytochrome P450 family 7 subfamily B member 1); PARTICIPATES IN bile acid biosynthetic pathway; cerebrotendinous xanthomatosis pathway; congenital bile acid synthesis defect pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 3',5'-cyclic AMP.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

25-hydroxycholesterol 7-alpha-hydroxylase; Cytochrom P450; cytochrome P450 7B1; cytochrome P450, family 7, subfamily b, polypeptide 1; cytochrome P450, subfamily 7B, polypeptide 1; HCT-1; hippocampal transcript 1 protein; oxysterol 7-alpha-hydroxylase

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

Allele / Splice:

Cyp7b1^{Tn(sb-T2/Bart3)2.306Mcwi}

Genetic Models:

F344-Cyp7b1^{Tn(sb-T2/Bart3)2.306Mcwi}

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	2	100,502,791 - 100,669,713 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	100,502,791 - 100,669,698 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	107,017,449 - 107,190,606 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	2	105,138,553 - 105,311,712 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	2	100,132,313 - 100,164,609 (-)	NCBI	Rnor_WKY
Rnor_6.0	2	102,701,903 - 102,871,257 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	102,701,903 - 102,871,257 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	122,442,002 - 122,610,354 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	103,102,679 - 103,271,273 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	103,048,320 - 103,073,714 (-)	NCBI
Celera	2	95,908,860 - 96,075,269 (-)	NCBI		Celera
RH 3.4 Map	2	606.1	RGD
Cytogenetic Map	2	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

adenocarcinoma (ISO)

cholestasis (ISO)

congenital bile acid synthesis defect (ISO)

congenital bile acid synthesis defect 3 (ISO)

fatty liver disease (ISO)

genetic disease (ISO)

hereditary spastic paraplegia (ISO)

hereditary spastic paraplegia 5A (ISO)

lipid metabolism disorder (ISO)

liver disease (ISO)

paraplegia (ISO)

Prostatic Neoplasms (ISO)

spastic ataxia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-dexrazoxane (ISO)

(2,4,5-trichlorophenoxy)acetic acid (ISO)

(25R)-cholest-5-ene-3beta,26-diol (ISO)

1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (ISO)

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (ISO)

1-naphthyl isothiocyanate (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP,ISO)

17beta-hydroxy-5alpha-androstan-3-one (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (ISO)

2-arachidonoylglycerol (ISO)

25-hydroxycholesterol (ISO)

26-hydroxycholesterol (ISO)

3',5'-cyclic AMP (EXP)

3,3',5,5'-tetrabromobisphenol A (ISO)

3-chloropropane-1,2-diol (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

3H-1,2-dithiole-3-thione (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

acetaldehyde (ISO)

aflatoxin B1 (ISO)

aldrin (ISO)

AM-251 (ISO)

amiodarone (ISO)

ammonium chloride (EXP)

androstane-3,17-diol (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (ISO)

atazanavir sulfate (ISO)

atorvastatin calcium (ISO)

atrazine (ISO)

benzene (ISO)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

benzo[e]pyrene (ISO)

beta-naphthoflavone (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cadmium dichloride (EXP,ISO)

caffeine (EXP)

calcitriol (ISO)

carbon nanotube (ISO)

cefaloridine (EXP)

cerium trichloride (ISO)

chenodeoxycholic acid (ISO)

cholesterol (EXP)

cholic acid (ISO)

choline (ISO)

ciprofibrate (ISO)

clofibrate (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

dehydroepiandrosterone (ISO)

deoxycholic acid (ISO)

dexamethasone (ISO)

dextran sulfate (ISO)

diarsenic trioxide (ISO)

dibenz[a,h]anthracene (ISO)

dichloroacetic acid (ISO)

dimethylarsinic acid (ISO)

dioxygen (ISO)

doxorubicin (ISO)

elemental selenium (ISO)

emodin (ISO)

endosulfan (EXP)

enilconazole (ISO)

ethanol (EXP,ISO)

fenofibrate (EXP)

flumequine (ISO)

flusilazole (ISO)

folic acid (ISO)

fulvestrant (ISO)

fumonisin B1 (ISO)

furan (EXP)

glycochenodeoxycholic acid (ISO)

glycocholic acid (ISO)

glycodeoxycholic acid (ISO)

griseofulvin (ISO)

hexachlorobenzene (EXP)

indole-3-methanol (EXP)

indometacin (ISO)

L-methionine (ISO)

lipopolysaccharide (ISO)

lithocholic acid (ISO)

lycopene (ISO)

MeIQx (ISO)

metacetamol (ISO)

metformin (ISO)

methamphetamine (ISO)

methapyrilene (ISO)

methoxyacetic acid (EXP)

methylmercury chloride (EXP)

Monobutylphthalate (EXP)

N-nitrosodiethylamine (EXP,ISO)

nefazodone (ISO)

nickel atom (ISO)

O-methyleugenol (ISO)

oleanolic acid (ISO)

ozone (ISO)

paracetamol (ISO)

paraquat (EXP)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

phenobarbital (ISO)

phenytoin (EXP)

phorbol 13-acetate 12-myristate (EXP,ISO)

phytosterols (ISO)

piperonyl butoxide (ISO)

pirinixic acid (ISO)

pregnenolone 16alpha-carbonitrile (EXP)

propiconazole (EXP)

resveratrol (ISO)

rifaximin (ISO)

rotenone (EXP)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

selenium atom (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

Soman (EXP)

streptozocin (ISO)

succimer (ISO)

sunitinib (ISO)

Sunset Yellow FCF (ISO)

tamoxifen (ISO)

tartrazine (ISO)

taurocholic acid (EXP)

taurodeoxycholic acid (EXP)

testosterone (EXP,ISO)

tetrachloromethane (ISO)

tetracycline (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trichloroethene (ISO)

urethane (ISO)

ursodeoxycholic acid (ISO)

valproic acid (ISO)

zaragozic acid A (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

B cell chemotaxis (IEA,ISO,ISS)

bile acid biosynthetic process (IBA,IEA,ISO,TAS)

cholesterol homeostasis (IBA)

cholesterol metabolic process (TAS)

circadian rhythm (IDA)

epithelial cell proliferation (IEA,ISO)

intracellular estrogen receptor signaling pathway (IEA,ISO)

memory (IDA)

negative regulation of intracellular estrogen receptor signaling pathway (IEA,ISO)

positive regulation of epithelial cell proliferation (IEA,ISO)

prostate gland epithelium morphogenesis (IEA,ISO)

response to cAMP (IEP)

response to xenobiotic stimulus (IEP)

Cellular Component

cellular_component (ND)

endoplasmic reticulum membrane (IEA)

Molecular Function

25-hydroxycholesterol 7alpha-hydroxylase activity (IEA)

27-hydroxycholesterol 7-alpha-monooxygenase activity (IEA)

heme binding (IEA)

iron ion binding (IEA)

monooxygenase activity (IEA)

oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen (IEA)

oxysterol 7-alpha-hydroxylase activity (IBA,IEA,ISO,ISS,TAS)

Molecular Pathway Annotations Click to see Annotation Detail View

bile acid biosynthetic pathway (IEA,ISO)

cerebrotendinous xanthomatosis pathway (ISO)

congenital bile acid synthesis defect pathway (ISO)

familial hypercholanemia pathway (ISO)

primary bile acid biosynthetic pathway (IEA)

steroid hormone biosynthetic pathway (IEA)

Zellweger syndrome pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.	Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
4.	Improved radiation hybrid map of rat chromosome 2: colocalization of the genes encoding corticotropin-releasing hormone and IL6-receptor with quantitative trait loci regulating the inflammatory response.	Laes JF, etal., Cytogenet Cell Genet 2001;92(1-2):130-3.
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
8.	Regulation of oxysterol 7alpha-hydroxylase (CYP7B1) in primary cultures of rat hepatocytes.	Pandak WM, etal., Hepatology 2002 Jun;35(6):1400-8.
9.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
10.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
11.	Regulation of oxysterol 7alpha-hydroxylase (CYP7B1) in the rat.	Ren S, etal., Metabolism 2003 May;52(5):636-42.
12.	GOA pipeline	RGD automated data pipeline
13.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
14.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
15.	Comprehensive gene review and curation	RGD comprehensive gene curation
16.	A novel cytochrome P450 expressed primarily in brain.	Stapleton G, etal., J Biol Chem 1995 Dec 15;270(50):29739-45.
17.	[Clinical consideration with special reference to autopsy cases of malignant tumor in the oral cavity, treated with Bleomycin (author's transl)]	Tanaka S, etal., Hiroshima Daigaku Shigaku Zasshi 1975;8(2):168-75.
18.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
19.	Central administration of a cytochrome P450-7B product 7 alpha-hydroxypregnenolone improves spatial memory retention in cognitively impaired aged rats.	Yau JL, etal., J Neurosci. 2006 Oct 25;26(43):11034-40.

Additional References at PubMed

PMID:10748047	PMID:12370428	PMID:12914530	PMID:18395092	PMID:21029595	PMID:22384504	PMID:22999953	PMID:25263657

Genomics

Comparative Map Data

Cyp7b1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	2	100,502,791 - 100,669,713 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	100,502,791 - 100,669,698 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	107,017,449 - 107,190,606 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	2	105,138,553 - 105,311,712 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	2	100,132,313 - 100,164,609 (-)	NCBI	Rnor_WKY
Rnor_6.0	2	102,701,903 - 102,871,257 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	102,701,903 - 102,871,257 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	122,442,002 - 122,610,354 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	103,102,679 - 103,271,273 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	103,048,320 - 103,073,714 (-)	NCBI
Celera	2	95,908,860 - 96,075,269 (-)	NCBI		Celera
RH 3.4 Map	2	606.1	RGD
Cytogenetic Map	2	q24	NCBI

CYP7B1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	8	64,586,575 - 64,798,737 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	8	64,587,763 - 64,798,737 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	8	65,499,132 - 65,711,294 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	8	65,671,246 - 65,873,902 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	8	65,671,245 - 65,873,902	NCBI
Celera	8	61,498,536 - 61,701,760 (-)	NCBI		Celera
Cytogenetic Map	8	q12.3	NCBI
HuRef	8	60,998,772 - 61,201,422 (-)	NCBI		HuRef
CHM1_1	8	65,562,219 - 65,765,057 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	8	65,011,997 - 65,224,254 (-)	NCBI		T2T-CHM13v2.0

Cyp7b1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	18,126,108 - 18,298,054 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	18,126,114 - 18,297,502 (-)	Ensembl		GRCm39 Ensembl
GRCm38	3	18,071,944 - 18,243,890 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	18,071,950 - 18,243,338 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	3	17,971,950 - 18,143,338 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	3	18,264,101 - 18,435,480 (-)	NCBI		MGSCv36	mm8
Celera	3	18,067,760 - 18,239,527 (-)	NCBI		Celera
Cytogenetic Map	3	A1	NCBI
cM Map	3	4.98	NCBI

LOC102022645
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955444	14,275,345 - 14,444,426 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955444	14,274,818 - 14,446,068 (+)	NCBI	ChiLan1.0	ChiLan1.0

CYP7B1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	8	62,806,129 - 63,006,450 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	8	62,806,637 - 63,006,386 (-)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	8	61,135,307 - 61,335,838 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

CYP7B1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	29	14,443,036 - 14,613,839 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	29	14,444,853 - 14,613,755 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	29	14,762,658 - 14,936,799 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	29	14,537,942 - 14,712,338 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	29	14,537,947 - 14,712,865 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	29	14,550,483 - 14,724,576 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	29	14,664,658 - 14,838,558 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	29	14,932,049 - 15,106,453 (-)	NCBI		UU_Cfam_GSD_1.0

LOC101955077
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	65,707,508 - 65,885,081 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936496	8,899,965 - 9,072,089 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936496	8,900,320 - 9,072,109 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CYP7B1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	69,616,049 - 69,806,496 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	4	69,615,953 - 69,793,131 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	75,915,950 - 75,973,962 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CYP7B1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	8	60,496,607 - 60,691,457 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	8	60,496,733 - 60,524,238 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666039	81,044,277 - 81,069,295 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

LOC101721563
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624744	26,792,890 - 26,991,425 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624744	26,791,829 - 26,999,584 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Cyp7b1
997 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	113
Count of miRNA genes:	87
Interacting mature miRNAs:	102
Transcripts:	ENSRNOT00000013116
Prediction methods:	Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61355	Bp36	Blood pressure QTL 36	2.9		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	2	5873687	102844969	Rat
1302794	Stl27	Serum triglyceride level QTL 27	4.4	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	2	25413423	143657569	Rat
1358894	Kidm24	Kidney mass QTL 24	4.03		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358899	Kidm23	Kidney mass QTL 23	3.88		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358901	Cm38	Cardiac mass QTL 38	2		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	157142209	Rat
1358904	Cm39	Cardiac mass QTL 39	2.26		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	157142209	Rat
1358910	Kidm27	Kidney mass QTL 27	5.77		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358911	Kidm28	Kidney mass QTL 28	5.42		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
1358887	Bw50	Body weight QTL 50	2.39		body mass (VT:0001259)	body weight (CMO:0000012)	2	25413652	157142078	Rat
1358908	Bw49	Body weight QTL 49	3.36		body mass (VT:0001259)	body weight (CMO:0000012)	2	25413652	157142078	Rat
1354603	Bp243	Blood pressure QTL 243	3.9		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	26917817	127469484	Rat
2290453	Scl55	Serum cholesterol level QTL 55	2.83		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	2	26917817	136917119	Rat
70174	BpQTLCluster2	Blood pressure QTL cluster 2	4.24		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	40067944	102785628	Rat
70174	BpQTLCluster2	Blood pressure QTL cluster 2	4.24		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	40067944	102785628	Rat
70174	BpQTLCluster2	Blood pressure QTL cluster 2	4.24		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	40067944	102785628	Rat
70174	BpQTLCluster2	Blood pressure QTL cluster 2	4.24		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	2	40067944	102785628	Rat
70174	BpQTLCluster2	Blood pressure QTL cluster 2	4.24		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	2	40067944	102785628	Rat
2293835	Kiddil5	Kidney dilation QTL 5	3.8		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	42804607	157142209	Rat
2293843	Kiddil6	Kidney dilation QTL 6	3.1		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	42804607	182042367	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	43154682	202446871	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	43154682	202446871	Rat
2293676	Bmd19	Bone mineral density QTL 19	10.7	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	2	43162366	111362592	Rat
2293682	Bmd24	Bone mineral density QTL 24	8.9	0.0001	femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	2	43162366	111362592	Rat
2293671	Bss44	Bone structure and strength QTL 44	10.97	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	2	43162366	148478373	Rat
1354601	Slep1	Serum leptin concentration QTL 1	5.39		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	2	43171017	184114403	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	46123260	202447032	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	56043031	202447032	Rat
1558648	Smcn1	Smooth muscle cell number QTL 1		0.039	blood vessel smooth muscle cell quantity (VT:0010525)	aorta smooth muscle cell count per unit vessel length (CMO:0001646)	2	59134147	127460910	Rat
5684990	Bmd82	Bone mineral density QTL 82	2.8		tibia mineral mass (VT:1000283)	bone mineral content (CMO:0001554)	2	59324377	103795077	Rat
5684996	Bmd85	Bone mineral density QTL 85	4.7	0.024	tibia mineral mass (VT:1000283)	bone mineral density (CMO:0001226)	2	59324377	103795077	Rat
61438	Cia7	Collagen induced arthritis QTL 7	4.6	0.0001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	2	59324377	141596857	Rat
631500	Bp99	Blood pressure QTL 99	2.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	59324719	102755241	Rat
1578777	Stresp15	Stress response QTL 15	2	0.05	blood aldosterone amount (VT:0005346)	plasma aldosterone level (CMO:0000551)	2	59846005	104846005	Rat
2306903	Bp336	Blood pressure QTL 336		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	64366971	109366971	Rat
1298080	Bp163	Blood pressure QTL 163		0.02	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118275	202447032	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118463	226797303	Rat
7411551	Bw131	Body weight QTL 131	29.6	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	2	67942638	112942638	Rat
1558653	Prcr1	Prostate cancer resistance QTL 1	5		prostate integrity trait (VT:0010571)	area of ventral prostate occupied by tumorous lesions to total ventral prostate area ratio (CMO:0000899)	2	72532993	157142209	Rat
1354605	Rf48	Renal function QTL 48	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	2	74786664	206665859	Rat
61465	Bp13	Blood pressure QTL 13	3.3		blood pressure trait (VT:0000183)	diastolic blood pressure (CMO:0000005)	2	76539322	102785628	Rat
61465	Bp13	Blood pressure QTL 13	3.3		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	2	76539322	102785628	Rat
631198	Cm22	Cardiac mass QTL 22	4.3	0.0008	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	76539322	150540526	Rat
61374	Edpm2	Estrogen-dependent pituitary mass QTL 2	4.42	0.86	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	76539322	202447032	Rat
2299162	Iddm32	Insulin dependent diabetes mellitus QTL 32	2.36		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	2	78665616	143657569	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	78665619	219826953	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	78665619	249053267	Rat
61392	Bp6	Blood pressure QTL 6	7		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	2	80270434	125270434	Rat
1598865	Bp296	Blood pressure QTL 296	2.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	81018907	126018907	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	81689826	221035911	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	81754530	222436696	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	81754530	227146641	Rat
1578772	Stresp14	Stress response QTL 14	5	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	2	82345893	130923501	Rat
7207808	Bmd89	Bone mineral density QTL 89	4.1		femur strength trait (VT:0010010)	femoral neck ultimate force (CMO:0001703)	2	88862519	133862519	Rat
2300165	Bmd49	Bone mineral density QTL 49	4.8	0.0001	lumbar vertebra mineral mass (VT:0010511)	bone mineral density (CMO:0001226)	2	88862519	133862519	Rat
2300170	Bmd45	Bone mineral density QTL 45	12.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	2	88862519	133862519	Rat
2300185	Bmd46	Bone mineral density QTL 46	8.4	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	2	88862519	133862519	Rat
1598862	Glom9	Glomerulus QTL 9	3.5		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	2	92337601	137337601	Rat
1598863	Cm65	Cardiac mass QTL 65	2.3		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	92337601	137337601	Rat

Markers in Region

D2Got54

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Rnor_6.0	2	102,774,990 - 102,775,099	NCBI	Rnor6.0
Rnor_5.0	2	122,515,089 - 122,515,198	UniSTS	Rnor5.0
RGSC_v3.4	2	103,176,564 - 103,176,680	UniSTS	RGSC3.4
RGSC_v3.4	2	103,176,563 - 103,176,680	RGD	RGSC3.4
RGSC_v3.1	2	103,121,526 - 103,121,642	RGD
Celera	2	95,981,934 - 95,982,050	UniSTS
RH 3.4 Map	2	623.3	RGD
RH 3.4 Map	2	623.3	UniSTS
RH 2.0 Map	2	506.9	RGD
Cytogenetic Map	2	q24	UniSTS

RH94670

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	100,503,471 - 100,503,635 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	102,702,584 - 102,702,747	NCBI	Rnor6.0
Rnor_5.0	2	122,442,683 - 122,442,846	UniSTS	Rnor5.0
RGSC_v3.4	2	103,103,573 - 103,103,736	UniSTS	RGSC3.4
Celera	2	95,909,541 - 95,909,704	UniSTS
RH 3.4 Map	2	606.1	UniSTS
Cytogenetic Map	2	q24	UniSTS

AU049273

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	100,554,056 - 100,554,228 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	102,753,172 - 102,753,343	NCBI	Rnor6.0
Rnor_5.0	2	122,493,271 - 122,493,442	UniSTS	Rnor5.0
RGSC_v3.4	2	103,154,747 - 103,154,918	UniSTS	RGSC3.4
Celera	2	95,960,122 - 95,960,293	UniSTS
Cytogenetic Map	2	q24	UniSTS

ECD14651

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Rnor_5.0	2	122,514,089 - 122,515,145	UniSTS	Rnor5.0
RGSC_v3.4	2	103,175,565 - 103,176,628	UniSTS	RGSC3.4
Celera	2	95,980,935 - 95,981,998	UniSTS
Cytogenetic Map	2	q24	UniSTS

Genetic Models

This gene Cyp7b1 is modified in the following models/strains

F344-Cyp7b1^{Tn(sb-T2/Bart3)2.306Mcwi}

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium			2	1	1	1			25		3	4
Low	3	42	55	40	18	40	8	11	49	35	33	7	8
Below cutoff		1									5

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_019138	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039101794	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BF283070	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB749347	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB760136	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB800565	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473961	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000067	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U36992	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000013116 ⟹ ENSRNOP00000013116

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	100,502,791 - 100,669,698 (-)	Ensembl
Rnor_6.0 Ensembl	2	102,701,903 - 102,871,257 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000082084 ⟹ ENSRNOP00000073111

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	100,502,791 - 100,535,586 (-)	Ensembl
Rnor_6.0 Ensembl	2	102,702,689 - 102,838,745 (-)	Ensembl

RefSeq Acc Id:

NM_019138 ⟹ NP_062011

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	2	100,502,791 - 100,669,698 (-)	NCBI
Rnor_6.0	2	102,701,903 - 102,871,257 (-)	NCBI
Rnor_5.0	2	122,442,002 - 122,610,354 (-)	NCBI
RGSC_v3.4	2	103,102,679 - 103,271,273 (-)	RGD
Celera	2	95,908,860 - 96,075,269 (-)	RGD

Sequence:

show sequence

GCTTTGGGGGCCGCTGTGACATTCTGCTCTGCACTGCGGGCAGGCCAGAGCCTCTGGTCTAGAA
GAGAGGGCACTTTGCAGAAGCCATCGCTCACTACAGAGCCGCCAGAGCGTCCGGATGGAGGGAG
CCACGACCCCAGATGCCGCTTCGCCCGGGCCTCTCTCCCTACTAGGCCTTCTCTTTGCGGTCAC
CTTGCTGCTCCCAGTCCTGTTCCTCCTCACCCGGCGCACAAGGCGTCCTTGTGAACCTCCCTTG
ATAAAAGGTTGGATTCCTTATCTTGGCATGGCCCTGAAATTCTGGAAGGATCCGTTAGCTTTCT
TGCAAACTCTTCAAAGGCAATGTGGTGACACTTTCACTGTCTTACTTGGAGGGAAGTATATAAC
ATTTGTTCTGAACCCTTTCCAGTACCAGTATGTAATGAAAAACCCAAAACAATTAAGCTTTGAG
AAGTTCAGCCGAAGATTATCAGCGAAAGCCTTCTCTGTCAAGAAGCTGCTAACTAATGACGACC
TTAGCAATGACATTCACAGAGGCTATCTTCTTTTACAAGGCAAATCTCTGGATGGTCTTCTGGA
AACCATGATCCAAGAAGTAAAAGAAATATTTGAGTCCAGACTGCTAAAACTCACAGATTGGAAT
ACAGCAAGAGTATTTGATTTCTGTAGTTCACTGGTATTTGAAATCACATTTACAACTATATATG
GAAAAATTCTTGCTGCTAACAAAAAACAAATTATCAGTGAGCTGAGGGATGATTTTTTAAAATT
TGATGACCATTTCCCATACTTAGTATCTGACATACCTATTCAGCTTCTAAGAAATGCAGAATTT
ATGCAGAAGAAAATTATAAAATGTCTCACACCAGAAAAAGTAGCTCAGATGCAAAGACGGTCAG
AAATTGTTCAGGAGAGGCAGGAGATGCTGAAAAAATACTACGGGCATGAAGAGTTTGAAATAGG
AGCACATCATCTTGGCTTGCTCTGGGCCTCTCTAGCAAACACCATTCCAGCTATGTTCTGGGCA
ATGTATTATCTTCTTCAGCATCCAGAAGCTATGGAAGTCCTGCGTGACGAAATTGACAGCTTCC
TGCAGTCAACAGGTCAAAAGAAAGGACCTGGAATTTCTGTCCACTTCACCAGAGAACAATTGGA
CAGCTTGGTCTGCCTGGAAAGCGCTATTCTTGAGGTTCTGAGGTTGTGCTCCTACTCCAGCATC
ATCCGTGAAGTGCAAGAGGATATGGATTTCAGCTCAGAGAGTAGGAGCTACCGTCTGCGGAAAG
GAGACTTTGTAGCTGTCTTTCCTCCAATGATACACAATGACCCAGAAGTCTTCGATGCTCCAAA
GGACTTTAGGTTTGATCGCTTCGTAGAAGATGGTAAGAAGAAAACAACGTTTTTCAAAGGAGGA
AAAAAGCTGAAGAGTTACATTATACCATTTGGACTTGGAACAAGCAAATGTCCAGGCAGATACT
TTGCAATTAATGAAATGAAGCTACTAGTGATTATACTTTTAACTTATTTTGATTTAGAAGTCAT
TGACACTAAGCCTATAGGACTAAACCACAGTCGCATGTTTCTGGGCATTCAGCATCCAGACTCT
GACATCTCATTTAGGTACAAGGCAAAATCTTGGAGATCCTGAAAGGGTGGCAGAGAAGCTTAGC
GGAATAAGGCTGCACATGCTGAGCTCTGTGATTTGCTGTACTCCCCAAATGCAGCCACTATTCT
TGTTTGTTAGAAAATGGCAAATTTTTATTTGATTGCGATCCATCCAGTTTGTTTTGGGTCACAA
AACCTGTCATAAAATAAAGCGCTGTCATGGTGTAAAAAAATGTCATGGCAATCATTTCAGGATA
AGGTAAAATAACGTTTTCAAGTTTGTACTTACTATGATTTTTATCATTTGTAGTGAATGTGCTT
TTCCAGTAATAAATTTGCGCCAGGGTGATTTTTTTTAAATTACTGAAATCCTCTAATATGGTTT
TATGTGCTGCCAGAAAAGTGTGCCATCAATGGACAGTATAACAATTTCCAGTTTTCCAGAGAAG
GGAGAAATTAAACCCCATGAGTTACGCTGTATAAAATTGTTCTCTTCAACTATAATATCAATAA
TGTCTATATCACCAGGTTACCTTTGCATTAAATGAGTTTTGCAAAAGATTAAATGTCCCAACTT
CCTTTCAATATTTAATCATCCATAAATGCTCTTTATAACTTTGTATTCTACAGCTCAATAGAAC
ACAATTAATTGTTATGTAAGATTGCTCATGTTCAAGTTAGATATTGTTAAATTTTAATGTATAT
GAAAACACAAAGCCTATTCCATAGTCAGCAGTTACTCTAAACATTAGTATTAGGTTTATTGTGG
AGGTAAATGTTGAAGTTACAATAGCACTGATGGTAGAATTGGTCTGTAGTATAAACTGTGTTAG
CTGATGCTGCAATGAACCCTTTACCAAACATTTCCATTTCTATAAACAGAGAAATTAGGTAGCA
TTATTTATCCACAACCTTTTGGACTTGAAGTTAAGTTTATTATTTTAAACTATTAAATTAAACT
ATACAAAATAATTCTATGTGATACCATATAGCCTGTATTGATTAGTAAAAGATTTCTACTATCA
AA

hide sequence

RefSeq Acc Id:

XM_039101794 ⟹ XP_038957722

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	2	100,503,928 - 100,669,713 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_062011	(Get FASTA)	NCBI Sequence Viewer
	XP_038957722	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA92616	(Get FASTA)	NCBI Sequence Viewer
	EDM01054	(Get FASTA)	NCBI Sequence Viewer
	Q63688	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_062011 ⟸ NM_019138

- UniProtKB:

Q63688 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MEGATTPDAASPGPLSLLGLLFAVTLLLPVLFLLTRRTRRPCEPPLIKGWIPYLGMALKFWKDP
LAFLQTLQRQCGDTFTVLLGGKYITFVLNPFQYQYVMKNPKQLSFEKFSRRLSAKAFSVKKLLT
NDDLSNDIHRGYLLLQGKSLDGLLETMIQEVKEIFESRLLKLTDWNTARVFDFCSSLVFEITFT
TIYGKILAANKKQIISELRDDFLKFDDHFPYLVSDIPIQLLRNAEFMQKKIIKCLTPEKVAQMQ
RRSEIVQERQEMLKKYYGHEEFEIGAHHLGLLWASLANTIPAMFWAMYYLLQHPEAMEVLRDEI
DSFLQSTGQKKGPGISVHFTREQLDSLVCLESAILEVLRLCSYSSIIREVQEDMDFSSESRSYR
LRKGDFVAVFPPMIHNDPEVFDAPKDFRFDRFVEDGKKKTTFFKGGKKLKSYIIPFGLGTSKCP
GRYFAINEMKLLVIILLTYFDLEVIDTKPIGLNHSRMFLGIQHPDSDISFRYKAKSWRS

hide sequence

RefSeq Acc Id:

ENSRNOP00000073111 ⟸ ENSRNOT00000082084

RefSeq Acc Id:

ENSRNOP00000013116 ⟸ ENSRNOT00000013116

RefSeq Acc Id:	XP_038957722 ⟸ XM_039101794
- Peptide Label:	isoform X1

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q63688-F1-model_v2	AlphaFold	Q63688	1-414	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13691251

Promoter ID:

EPDNEW_R1776

Type:

initiation region

Name:

Cyp7b1_1

Description:

cytochrome P450 family 7 subfamily B member 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	2	102,871,237 - 102,871,297	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2483	AgrOrtholog
BioCyc Gene	G2FUF-53640	BioCyc
Ensembl Genes	ENSRNOG00000009730	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000013116	ENTREZGENE
	ENSRNOP00000013116.4	UniProtKB/TrEMBL
	ENSRNOP00000073111.2	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000013116	ENTREZGENE
	ENSRNOT00000013116.7	UniProtKB/TrEMBL
	ENSRNOT00000082084.2	UniProtKB/TrEMBL
Gene3D-CATH	1.10.630.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	Cyt_P450	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Cyt_P450_CYP7A1-type	UniProtKB/TrEMBL
	Cyt_P450_E_grp-IV	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Cyt_P450_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:25429	UniProtKB/Swiss-Prot
NCBI Gene	25429	ENTREZGENE
PANTHER	CYTOCHROME P450 7B1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	CYTOCHROME P450 FAMILY 7	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	p450	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Cyp7b1	PhenoGen
PIRSF	Cytochrome_CYPVIIA1	UniProtKB/TrEMBL
PRINTS	EP450IV	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF48264	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TIGR	TC220574
UniProt	A0A0G2K4N5_RAT	UniProtKB/TrEMBL
	CP7B1_RAT	UniProtKB/Swiss-Prot
	G3V787_RAT	UniProtKB/TrEMBL
	Q63688	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Name	Description	Reference	Status
2004-09-10	Cyp7b1	cytochrome P450, family 7, subfamily b, polypeptide 1	cytochrome P450, subfamily 7B, polypeptide 1	Name updated	1299863	APPROVED
2002-11-06	Cyp7b1	cytochrome P450, subfamily 7B, polypeptide 1	Cytochrom P450	Name updated	625702	APPROVED
2002-06-10	Cyp7b1	Cytochrom P450		Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_domains	possesses a steroidogenic domain	1298867
gene_expression	expressed at low levels in testis, ovary and adrenal gland	1298867
gene_expression	taurocholic acid and taurodeoxycholic acid decrease expression in primary hepatocytes	1298868
gene_expression	expression is enriched in brain, liver and kidney	1298867
gene_expression	expression is sexually dimorphic in liver but not in brain	1298867
gene_process	may metabolize steroids in brain	1298867
gene_regulation	squalestatin added to primary hepatocytes decreases enzymatic activity	1298868
gene_regulation	cholesterol, phorbol myristate acetate (PMA) or cyclic AMP (cAMP) added to primary hepatocytes increase enzymatic activity	1298868

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)