Angptl8 (angiopoietin-like 8) - Rat Genome Database

Name: Angptl8
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Angptl8 (angiopoietin-like 8) Rattus norvegicus

Analyze

Symbol:

Angptl8

Name:

angiopoietin-like 8

RGD ID:

2320121

Description:

Predicted to be involved in cellular lipid metabolic process. Predicted to act upstream of or within several processes, including fat cell differentiation; regulation of protein metabolic process; and triglyceride homeostasis. Predicted to be active in extracellular region. Orthologous to human ANGPTL8 (angiopoietin like 8); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; acetamide; bisphenol A.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

angiopoietin-like protein 8; betatrophin; lipasin; LOC100361444; rCG31799-like

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ANGPTL8 (angiopoietin like 8)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Angptl8 (angiopoietin-like 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Angptl8 (angiopoietin like 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ANGPTL8 (angiopoietin like 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ANGPTL8 (angiopoietin like 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Angptl8 (angiopoietin like 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ANGPTL8 (angiopoietin like 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ANGPTL8 (angiopoietin like 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Angptl8 (angiopoietin like 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	ANGPTL8 (angiopoietin like 8)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Angptl8 (angiopoietin-like 8)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	angptl8	Alliance	DIOPT (OrthoFinder\|PANTHER)

Allele / Splice:

Angptl8^em1Kyo

Genetic Models:

F344-Angptl8^em1Kyo-/- F344-Angptl8^em1Kyo+/-

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	8	20,376,462 - 20,378,488 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	20,376,462 - 20,378,490 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	24,411,953 - 24,413,979 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	8	22,707,496 - 22,709,522 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	8	20,606,057 - 20,608,083 (+)	NCBI	Rnor_WKY
Rnor_6.0	8	22,855,495 - 22,858,565 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	22,856,539 - 22,858,565 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	22,910,979 - 22,913,005 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	20,948,070 - 20,950,087 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	8	21,767,738 - 21,769,764 (+)	NCBI		Celera
Cytogenetic Map	8	q13	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

alpha-mannosidosis (ISO)

Charcot-Marie-Tooth disease dominant intermediate B (ISO)

episodic ataxia type 2 (ISO)

genetic disease (ISO)

glutaric acidemia I (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3,3',4,4',5-pentachlorobiphenyl (ISO)

3,3',5-triiodo-L-thyronine (ISO)

acetamide (EXP)

aflatoxin B1 (ISO)

ammonium chloride (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

bromobenzene (EXP)

chloroquine (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

dioxygen (ISO)

endosulfan (EXP)

fulvestrant (ISO)

genistein (EXP)

gentamycin (EXP)

metformin (EXP)

N-nitrosodiethylamine (ISO)

N-Nitrosopyrrolidine (ISO)

nitrofen (EXP)

O-methyleugenol (ISO)

paracetamol (EXP,ISO)

pentanal (ISO)

phenformin (EXP)

quercetin (ISO)

quinolin-8-ol (ISO)

sodium arsenite (ISO)

tetrachloromethane (ISO)

thioacetamide (EXP)

trichloroethene (EXP)

tris(2-butoxyethyl) phosphate (ISO)

troglitazone (ISO)

urethane (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell maturation (ISO)

cellular lipid metabolic process (ISO)

fat cell differentiation (ISO)

glucose metabolic process (ISO)

positive regulation of protein processing (ISO)

regulation of lipid metabolic process (ISO)

regulation of lipoprotein metabolic process (ISO)

triglyceride homeostasis (ISO)

type B pancreatic cell proliferation (ISO)

Cellular Component

extracellular region (IBA,ISO)

Molecular Function

protein binding (ISO)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

decreased body weight (IMP)

decreased circulating triglyceride level (IMP)

decreased circulating VLDL triglyceride level (IMP)

decreased epididymal fat pad weight (IMP)

decreased fat cell size (IMP)

decreased susceptibility to diet-induced obesity (IMP)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	CRISPR/Cas9-mediated Angptl8 knockout suppresses plasma triglyceride concentrations and adiposity in rats.	Izumi R, etal., J Lipid Res. 2018 Sep;59(9):1575-1585. doi: 10.1194/jlr.M082099. Epub 2018 Jul 24.
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:22569073	PMID:22809513	PMID:23150577	PMID:24043787	PMID:24353178	PMID:25417115	PMID:25720603	PMID:31578075	PMID:31702044

Genomics

Comparative Map Data

Angptl8
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	8	20,376,462 - 20,378,488 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	20,376,462 - 20,378,490 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	24,411,953 - 24,413,979 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	8	22,707,496 - 22,709,522 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	8	20,606,057 - 20,608,083 (+)	NCBI	Rnor_WKY
Rnor_6.0	8	22,855,495 - 22,858,565 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	22,856,539 - 22,858,565 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	22,910,979 - 22,913,005 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	20,948,070 - 20,950,087 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	8	21,767,738 - 21,769,764 (+)	NCBI		Celera
Cytogenetic Map	8	q13	NCBI

ANGPTL8
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	11,239,619 - 11,241,943 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	19	11,237,450 - 11,241,943 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	11,350,295 - 11,352,619 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	11,209,817 - 11,213,619 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	19	11,245,140 - 11,247,464 (+)	NCBI		Celera
Cytogenetic Map	19	p13.2	NCBI
HuRef	19	10,926,369 - 10,928,693 (+)	NCBI		HuRef
CHM1_1	19	11,351,357 - 11,353,681 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	11,366,594 - 11,368,918 (+)	NCBI		T2T-CHM13v2.0

Angptl8
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	21,746,806 - 21,748,643 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	21,746,806 - 21,748,643 (+)	Ensembl		GRCm39 Ensembl
GRCm38	9	21,835,510 - 21,837,347 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	21,835,510 - 21,837,347 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	9	21,639,954 - 21,641,791 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	9	21,585,740 - 21,587,757 (+)	NCBI		MGSCv36	mm8
Celera	9	19,105,101 - 19,106,938 (+)	NCBI		Celera
Cytogenetic Map	9	A3	NCBI

Angptl8
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955495	2,205,485 - 2,207,376 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955495	2,205,424 - 2,207,611 (+)	NCBI	ChiLan1.0	ChiLan1.0

ANGPTL8
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	19	11,498,069 - 11,500,400 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	11,498,069 - 11,500,400 (+)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	19	10,787,457 - 10,790,090 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

ANGPTL8
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	50,040,383 - 50,043,312 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	50,040,383 - 50,042,031 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	49,913,888 - 49,915,655 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	50,561,284 - 50,563,051 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	50,561,284 - 50,562,932 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	49,771,477 - 49,773,244 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	50,198,362 - 50,200,129 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	50,441,068 - 50,442,835 (-)	NCBI		UU_Cfam_GSD_1.0

Angptl8
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	208,982,926 - 208,984,600 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936659	1,370,113 - 1,371,769 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936659	1,370,115 - 1,371,767 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ANGPTL8
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	69,952,581 - 69,954,220 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	69,951,556 - 69,954,223 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

ANGPTL8
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	10,169,733 - 10,172,433 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	10,170,052 - 10,173,005 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666074	9,713,854 - 9,716,184 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Angptl8
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624828	3,092,739 - 3,099,120 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624828	3,092,673 - 3,094,919 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Angptl8
4 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	121
Count of miRNA genes:	91
Interacting mature miRNAs:	103
Transcripts:	ENSRNOT00000015381
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
9590084	Insglur5	Insulin/glucose ratio QTL 5	18.54	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	8	1	24597739	Rat
2317882	Alcrsp24	Alcohol response QTL 24	3.2	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	8	1	25902202	Rat
12880023	Bw184	Body weight QTL 184		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	8	2097640	47097640	Rat
12880025	Cm102	Cardiac mass QTL 102		0.044	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	8	2097640	47097640	Rat
12880028	Cm103	Cardiac mass QTL 103		0.02	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	8	2097640	47097640	Rat
12880044	Am9	Aortic mass QTL 9		0.007	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	8	2097640	47097640	Rat
2317032	Ginf2	Gastrointestinal inflammation QTL 2	3.21	0.005	liver integrity trait (VT:0010547)	liver granuloma severity score (CMO:0002157)	8	4705810	49705810	Rat
2317036	Livw3	Liver weight QTL 3	2.43	0.01	liver mass (VT:0003402)	liver weight to body weight ratio (CMO:0000633)	8	4705810	49705810	Rat
2317048	Ginf1	Gastrointestinal inflammation QTL 1	3.52	0.005	cecum mucosa thickness (VT:0010234)	enterocolitis severity score (CMO:0002138)	8	4705810	49705810	Rat
2301416	Bp315	Blood pressure QTL 315		0.008	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	7670578	52670578	Rat
1354595	Despr4	Despair related QTL 4	2.16	0.0036	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	8	7688955	52688955	Rat
1354627	Despr14	Despair related QTL 14		0.0056	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	8	7688955	52688955	Rat
1581557	Eae16	Experimental allergic encephalomyelitis QTL 16	3.8		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	8	8462195	110921472	Rat
2317030	Wbc5	White blood cell count QTL 5	3.21	0.005	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	8	8736635	53736635	Rat
2317051	Aia18	Adjuvant induced arthritis QTL 18	2.42		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	8	8736635	53736635	Rat
1598824	Memor4	Memory QTL 4	2.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	8	9712220	53356647	Rat
1357398	Slep3	Serum leptin concentration QTL 3	3.43		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	8	9712463	41866876	Rat
2302367	Slep5	Serum leptin concentration QTL 5	3.43		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	8	9712463	41866876	Rat
631650	Stl6	Serum triglyceride level QTL 6	4	0.0019	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	10378157	112202585	Rat
1558646	Swd5	Spike wave discharge measurement QTL 5	3.45	0.00036	brain electrophysiology trait (VT:0010557)	brain spike-and-wave discharge frequency (CMO:0001742)	8	14906751	59906751	Rat
61373	Mcs4	Mammary carcinoma susceptibility QTL 4	1.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	8	16290444	61290444	Rat
631271	Lecl1	Lens clarity QTL 1		0.001	lens clarity trait (VT:0001304)	age of onset/diagnosis of cataract (CMO:0001584)	8	18984168	84531599	Rat
731182	Uae24	Urinary albumin excretion QTL 24	6.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	19331152	93965294	Rat

Markers in Region

BI274505

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	20,378,226 - 20,378,386 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	22,858,304 - 22,858,463	NCBI	Rnor6.0
Rnor_5.0	8	22,912,744 - 22,912,903	UniSTS	Rnor5.0
RGSC_v3.4	8	20,949,826 - 20,949,985	UniSTS	RGSC3.4
Celera	8	21,769,503 - 21,769,662	UniSTS
RH 3.4 Map	1	962.71	UniSTS
Cytogenetic Map	8	q13	UniSTS

BI282731

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	20,376,710 - 20,377,030 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	22,856,788 - 22,857,107	NCBI	Rnor6.0
Rnor_5.0	8	22,911,228 - 22,911,547	UniSTS	Rnor5.0
RGSC_v3.4	8	20,948,310 - 20,948,629	UniSTS	RGSC3.4
Celera	8	21,767,987 - 21,768,306	UniSTS
Cytogenetic Map	8	q13	UniSTS

Genetic Models

This gene Angptl8 is modified in the following models/strains

F344-Angptl8^em1Kyo-/-

F344-Angptl8^em1Kyo+/-

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium			52	41	3	41					9	4
Low	3	13	5		16		8	8	6	31	23	7	8
Below cutoff		6						3	17	4	8

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001271710	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_593760	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC119556	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC160867	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473993	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000190	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000015381 ⟹ ENSRNOP00000015381

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	20,376,462 - 20,378,488 (+)	Ensembl
Rnor_6.0 Ensembl	8	22,856,539 - 22,858,565 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000094372 ⟹ ENSRNOP00000085135

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	20,376,462 - 20,378,490 (+)	Ensembl

RefSeq Acc Id:

NM_001271710 ⟹ NP_001258639

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	8	20,376,462 - 20,378,488 (+)	NCBI
Rnor_6.0	8	22,856,539 - 22,858,565 (+)	NCBI
Rnor_5.0	8	22,910,979 - 22,913,005 (+)	NCBI
Celera	8	21,767,738 - 21,769,764 (+)	NCBI

Sequence:

show sequence

ATACCCCCGAGACTGTCCACCATGGTTGTGCCTATTCTCTGCCTCCTATGGGCCATAGCAACAG
CAGTGCGACCTGCCCCAGTGGCCCCTCTCGGTGGTCCAGAGCCGGCCCAATATGAAGAGTTGAC
CCTGCTCTTTCACGGGGCCCTACAGCTAGGTCAGGCCCTCAATGGTGTGTACAAAGCCACGGAA
GCTCGCCTGACAGAAGCTGGGCGCAACCTGGGCCTTTTTGACCAAGCACTGGAATTTCTGGGAA
GAGAGGTCAATCAGGGCCGGGATGCAACACGGGAGCTTCGCACCAGCTTGTCGGAGATTCAGGC
AGAAGAGGACACTTTACACCTTCGAGCAGAAGCCACAGCCCGATCGCTGAGGGAAGTGGCCCGG
GCCCAGCATGCTCTGCGGAACAGTGTACGGAGACTACAAGTGCAGCTGAGAGGTGCCTGGCTAG
GCCAAGCCCACCAAGAATTTGAGAATTTAAAGGATCGAGCCGATAAGCAGAACCACCTCTTGTG
GGCTCTCACTGGCCACGTGCAGCGACAGCAGCGTGAGATGGCAGAGCAGCAACAGTGGCTGCGG
CAGATCCAGCAGAGACTCCACATGGCAGCCCTCCCAGCCTGAGACTACCTGGATGCCACTGAGG
ACCAGTTGTGCTGCAGGGAACACTGAATGCGCTCCACCGGGCCTATCTATGAGCAGGGCCGACA
GAGCTGGCTGCCCATCAGCTAGACTTGGCCGGTGCACCCCGCTTCCTGGCAGAGCAGAGACAGA
AGCAAGCAGGCGGGATGGAAGGCAGAAGACAGCCCCGTGGAGAAGGCTGGAGAAGGACATGAGC
TCCCTTATGCCCCACACCCCACAATAAAAAAGAGGCAATCTATAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001258639	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL78268	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_001258639 ⟸ NM_001271710
- Peptide Label:	precursor
- UniProtKB:	D3ZMI0 (UniProtKB/TrEMBL)
- Sequence:	show sequence MVVPILCLLWAIATAVRPAPVAPLGGPEPAQYEELTLLFHGALQLGQALNGVYKATEARLTEAG RNLGLFDQALEFLGREVNQGRDATRELRTSLSEIQAEEDTLHLRAEATARSLREVARAQHALRN SVRRLQVQLRGAWLGQAHQEFENLKDRADKQNHLLWALTGHVQRQQREMAEQQQWLRQIQQRLH MAALPA hide sequence

RefSeq Acc Id:

ENSRNOP00000015381 ⟸ ENSRNOT00000015381

RefSeq Acc Id:

ENSRNOP00000085135 ⟸ ENSRNOT00000094372

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZMI0-F1-model_v2	AlphaFold	D3ZMI0	1-198	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13695790

Promoter ID:

EPDNEW_R6314

Type:

single initiation site

Name:

Angptl8_1

Description:

angiopoietin-like 8

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	8	22,856,539 - 22,856,599	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2320121	AgrOrtholog
BioCyc Gene	G2FUF-31407	BioCyc
Ensembl Genes	ENSRNOG00000011490	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000015381	ENTREZGENE
	ENSRNOP00000015381.6	UniProtKB/TrEMBL
	ENSRNOP00000085135.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000015381	ENTREZGENE
	ENSRNOT00000015381.8	UniProtKB/TrEMBL
	ENSRNOT00000094372.1	UniProtKB/TrEMBL
InterPro	TD26	UniProtKB/TrEMBL
KEGG Report	rno:100361444	UniProtKB/TrEMBL
NCBI Gene	100361444	ENTREZGENE
PANTHER	ANGIOPOIETIN-LIKE PROTEIN 8	UniProtKB/TrEMBL
	PTHR21463	UniProtKB/TrEMBL
PhenoGen	Angptl8	PhenoGen
UniProt	A0A8I6A1K9_RAT	UniProtKB/TrEMBL
	D3ZMI0	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-11-05	Angptl8	angiopoietin-like 8	LOC100361444	rCG31799-like	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2010-05-05	LOC100361444	rCG31799-like			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar

Mammalian Phenotype