Cd81 (Cd81 molecule) - Rat Genome Database

Name: Cd81
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Cd81 (Cd81 molecule) Rattus norvegicus

Analyze

Symbol:

Cd81

Name:

Cd81 molecule

RGD ID:

2315

Description:

Predicted to enable cholesterol binding activity; signaling receptor binding activity; and virus receptor activity. Involved in regulation of cell population proliferation and regulation of growth. Located in apical plasma membrane. Human ortholog(s) of this gene implicated in common variable immunodeficiency 6. Orthologous to human CD81 (CD81 molecule); PARTICIPATES IN B cell receptor signaling pathway; hepatitis C pathway; malaria pathway; INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,6-di-tert-butyl-4-methylphenol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

26 kDa cell surface protein TAPA-1; CD 81 antigen; CD81 antigen; CD81 antigen (target of antiproliferative antibody 1); Tapa1; target of the antiproliferative antibody 1

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CD81 (CD81 molecule)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Cd81 (CD81 antigen)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Cd81 (CD81 molecule)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CD81 (CD81 molecule)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CD81 (CD81 molecule)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Cd81 (CD81 molecule)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CD81 (CD81 molecule)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CD81 (CD81 molecule)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Cd81 (CD81 molecule)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	ZSWIM7 (zinc finger SWIM-type containing 7)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	CD81 (CD81 molecule)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Cd81 (CD81 antigen)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cd81a (CD81 molecule a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cd81b (CD81 molecule b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	tsp-6	Alliance	DIOPT (InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER)
Drosophila melanogaster (fruit fly):	Tsp96F	Alliance	DIOPT (Hieranoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	tsp-9	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|SonicParanoid)
Caenorhabditis elegans (roundworm):	tsp-5	Alliance	DIOPT (InParanoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Tsp2A	Alliance	DIOPT (Ensembl Compara\|OMA\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	cd81	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Candidate Gene For:

Hcar4

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	1	198,235,861 - 198,251,660 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	198,241,484 - 198,251,660 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	206,614,397 - 206,630,285 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	1	213,700,545 - 213,716,337 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	1	206,374,702 - 206,390,494 (+)	NCBI	Rnor_WKY
Rnor_6.0	1	216,237,663 - 216,253,460 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	216,237,697 - 216,253,311 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	223,099,328 - 223,114,942 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	203,327,287 - 203,342,901 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	203,480,739 - 203,496,354 (+)	NCBI
Celera	1	195,804,757 - 195,820,558 (+)	NCBI		Celera
Cytogenetic Map	1	q41-q42	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

common variable immunodeficiency (ISO)

common variable immunodeficiency 6 (ISO)

delta beta-thalassemia (ISO)

developmental and epileptic encephalopathy (ISO)

early infantile epileptic encephalopathy (ISO)

genetic disease (ISO)

hepatitis C (ISO)

neuronal ceroid lipofuscinosis (ISO)

Segawa Syndrome, Autosomal Recessive (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-catechin (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (EXP)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,6-di-tert-butyl-4-methylphenol (EXP)

2,6-dinitrotoluene (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (EXP)

acrolein (ISO)

aflatoxin B1 (ISO)

Aflatoxin B2 alpha (ISO)

alpha-pinene (ISO)

ammonium chloride (EXP)

arsane (ISO)

arsenic atom (ISO)

beauvericin (ISO)

benzo[a]pyrene (EXP,ISO)

benzo[e]pyrene (ISO)

benzoates (ISO)

bis(2-ethylhexyl) phthalate (EXP)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (EXP,ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

cannabidiol (ISO)

chloropicrin (ISO)

cisplatin (EXP)

clobetasol (ISO)

cocaine (EXP,ISO)

cyclosporin A (ISO)

DDE (EXP)

dexamethasone (ISO)

dextran sulfate (ISO)

dibenz[a,h]anthracene (EXP)

dibutyl phthalate (EXP)

diethylstilbestrol (ISO)

dioxygen (ISO)

doxorubicin (ISO)

enniatin (ISO)

epoxiconazole (EXP)

ethanol (ISO)

fenthion (ISO)

flavonoids (ISO)

flutamide (EXP)

folic acid (ISO)

fulvestrant (ISO)

fumonisin B1 (ISO)

gentamycin (EXP)

indometacin (ISO)

isotretinoin (ISO)

ivermectin (ISO)

lead(0) (ISO)

lead(2+) (ISO)

linuron (EXP)

methapyrilene (ISO)

methotrexate (ISO)

methoxyacetic acid (EXP)

monosodium L-glutamate (ISO)

nefazodone (EXP)

nimesulide (EXP)

ochratoxin A (ISO)

oxaliplatin (EXP)

ozone (ISO)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (EXP)

PhIP (EXP)

potassium dichromate (ISO)

pregnenolone 16alpha-carbonitrile (EXP)

prochloraz (EXP)

procymidone (EXP)

pyrene (EXP)

resveratrol (ISO)

rotenone (EXP,ISO)

sodium arsenite (ISO)

sunitinib (ISO)

temozolomide (ISO)

testosterone (ISO)

tetrachloromethane (EXP,ISO)

thimerosal (ISO)

thioacetamide (EXP)

topotecan (EXP)

triptonide (ISO)

valdecoxib (EXP)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

CD4-positive, alpha-beta T cell costimulation (ISO,ISS)

cellular response to low-density lipoprotein particle stimulus (ISO,ISS)

humoral immune response mediated by circulating immunoglobulin (ISO,ISS)

immunological synapse formation (ISO,ISS)

macrophage fusion (ISO,ISS)

myoblast fusion involved in skeletal muscle regeneration (ISO,ISS)

obsolete positive regulation of 1-phosphatidylinositol 4-kinase activity (ISO,ISS)

osteoclast fusion (ISO,ISS)

positive regulation of adaptive immune memory response (ISO)

positive regulation of B cell activation (ISO,ISS)

positive regulation of B cell proliferation (ISO)

positive regulation of B cell receptor signaling pathway (ISO,ISS)

positive regulation of CD4-positive, alpha-beta T cell proliferation (ISO,ISS)

positive regulation of cell population proliferation (ISO,ISS)

positive regulation of inflammatory response to antigenic stimulus (ISO,ISS)

positive regulation of MAPK cascade (ISO,ISS)

positive regulation of peptidyl-tyrosine phosphorylation (ISO,ISS)

positive regulation of protein catabolic process in the vacuole (ISO)

positive regulation of protein exit from endoplasmic reticulum (ISO,ISS)

positive regulation of receptor clustering (ISO,ISS)

positive regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell (ISO,ISS)

positive regulation of T cell receptor signaling pathway (ISO,ISS)

positive regulation of T-helper 2 cell cytokine production (ISO,ISS)

positive regulation of transcription by RNA polymerase II (ISO)

protein localization (ISO,ISS)

protein localization to lysosome (ISO)

protein localization to plasma membrane (ISO,ISS)

receptor internalization (ISO,ISS)

regulation of cell motility (ISO)

regulation of cell population proliferation (IDA)

regulation of growth (IEP)

regulation of macrophage migration (ISO,ISS)

regulation of protein stability (ISO)

viral entry into host cell (IEA)

Cellular Component

apical plasma membrane (IDA)

basal plasma membrane (ISO)

basolateral plasma membrane (ISO)

extracellular exosome (ISO)

immunological synapse (ISO,ISS)

membrane (IEA,ISO)

plasma membrane (ISO,ISS)

tetraspanin-enriched microdomain (ISO,ISS)

vesicle (ISO)

Molecular Function

cholesterol binding (ISO,ISS)

integrin binding (ISO,ISS)

MHC class II protein binding (ISO)

protein binding (IPI,ISO)

transferrin receptor binding (ISO)

virus receptor activity (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

B cell receptor signaling pathway (IEA)

hepatitis C pathway (IEA)

malaria pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Tetraspanin CD81 is required for the alpha v beta5-integrin-dependent particle-binding step of RPE phagocytosis.	Chang Y and Finnemann SC, J Cell Sci. 2007 Sep 1;120(Pt 17):3053-63. Epub 2007 Aug 7.
2.	The major CD9 and CD81 molecular partner. Identification and characterization of the complexes.	Charrin S, etal., J Biol Chem. 2001 Apr 27;276(17):14329-37. Epub 2001 Jan 18.
3.	Inhibition of natural killer cells through engagement of CD81 by the major hepatitis C virus envelope protein.	Crotta S, etal., J Exp Med 2002 Jan 7;195(1):35-41.
4.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.	Retinal pigment epithelium of the rat express CD81, the target of the anti-proliferative antibody (TAPA).	Geisert EE Jr, etal., Invest Ophthalmol Vis Sci 2002 Jan;43(1):274-80.
6.	Astrocyte growth, reactivity, and the target of the antiproliferative antibody, TAPA.	Geisert EE Jr, etal., J Neurosci 1996 Sep 1;16(17):5478-87.
7.	A novel cell adhesion molecule, G-CAM, found on cultured rat glia.	Geisert EE Jr, etal., Neurosci Lett 1991 Dec 9;133(2):262-6.
8.	The upregulation of a glial cell surface antigen at the astrocytic scar in the rat.	Irwin MH and Geisert EE Jr, Neurosci Lett 1993 May 14;154(1-2):57-60.
9.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
10.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
11.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
12.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
13.	GOA pipeline	RGD automated data pipeline
14.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
15.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
16.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
17.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data

Additional References at PubMed

PMID:8409388	PMID:8766544	PMID:9360996	PMID:10400713	PMID:11046035	PMID:11673522	PMID:12565133	PMID:12796480	PMID:14676841	PMID:15908444	PMID:16449649	PMID:16557522
PMID:17327823	PMID:17481908	PMID:18662991	PMID:19028452	PMID:19056867	PMID:19199708	PMID:19946888	PMID:20237408	PMID:20375010	PMID:20407874	PMID:20458337	PMID:21235781
PMID:21276792	PMID:21423176	PMID:21930792	PMID:22307619	PMID:23376485	PMID:23395392	PMID:23499492	PMID:23533145	PMID:23575678	PMID:23858057	PMID:24038174	PMID:25002582
PMID:25635054	PMID:27881302	PMID:27993971	PMID:28167787	PMID:28871089	PMID:30871575	PMID:32830152	PMID:36961378

Genomics

Comparative Map Data

Cd81
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	1	198,235,861 - 198,251,660 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	198,241,484 - 198,251,660 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	206,614,397 - 206,630,285 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	1	213,700,545 - 213,716,337 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	1	206,374,702 - 206,390,494 (+)	NCBI	Rnor_WKY
Rnor_6.0	1	216,237,663 - 216,253,460 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	216,237,697 - 216,253,311 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	223,099,328 - 223,114,942 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	203,327,287 - 203,342,901 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	203,480,739 - 203,496,354 (+)	NCBI
Celera	1	195,804,757 - 195,820,558 (+)	NCBI		Celera
Cytogenetic Map	1	q41-q42	NCBI

CD81
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	2,376,180 - 2,397,397 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	11	2,376,177 - 2,397,802 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	11	2,397,410 - 2,418,627 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	2,355,123 - 2,375,225 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	11	2,355,315 - 2,375,202	NCBI
Celera	11	2,433,431 - 2,453,456 (+)	NCBI		Celera
Cytogenetic Map	11	p15.5	NCBI
HuRef	11	2,188,870 - 2,209,001 (+)	NCBI		HuRef
CHM1_1	11	2,397,498 - 2,417,522 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	11	2,465,548 - 2,486,747 (+)	NCBI		T2T-CHM13v2.0

Cd81
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	142,606,487 - 142,621,667 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	142,606,476 - 142,621,671 (+)	Ensembl		GRCm39 Ensembl
GRCm38	7	143,052,750 - 143,067,930 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	143,052,739 - 143,067,934 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	150,238,655 - 150,253,835 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	142,862,185 - 142,877,314 (+)	NCBI		MGSCv36	mm8
Celera	7	142,808,354 - 142,823,535 (+)	NCBI		Celera
Cytogenetic Map	7	F5	NCBI
cM Map	7	88.1	NCBI

Cd81
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955422	14,155,682 - 14,175,181 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955422	14,155,682 - 14,175,181 (+)	NCBI	ChiLan1.0	ChiLan1.0

CD81
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	11	3,998,095 - 4,018,491 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	11	2,400,503 - 2,421,132 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	11	2,442,322 - 2,449,308 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	11	2,437,991 - 2,449,308 (+)	Ensembl	panpan1.1		panPan2

CD81
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	18	46,466,484 - 46,474,236 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	18	46,466,499 - 46,473,868 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	18	45,067,559 - 45,083,899 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	18	47,137,460 - 47,153,838 (+)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	18	46,585,393 - 46,601,749 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	18	46,165,925 - 46,182,254 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	18	46,912,742 - 46,929,121 (+)	NCBI		UU_Cfam_GSD_1.0

Cd81
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	2,718,486 - 2,727,090 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936794	664,115 - 669,800 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936794	664,089 - 670,294 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CD81
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	1,625,736 - 1,641,663 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	1,625,728 - 1,641,662 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

CD81
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	1	2,190,896 - 2,211,838 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	1	2,190,845 - 2,211,389 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	99,392,792 - 99,413,678 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cd81
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624767	15,192,452 - 15,210,922 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624767	15,192,446 - 15,210,923 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Cd81
109 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	303
Count of miRNA genes:	174
Interacting mature miRNAs:	202
Transcripts:	ENSRNOT00000027760
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	49393289	199050459	Rat
1578780	Cm52	Cardiac mass QTL 52	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	1	81591954	219808434	Rat
70209	Niddm23	Non-insulin dependent diabetes mellitus QTL 23	2.82		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	94494440	198324465	Rat
731168	Bp154	Blood pressure QTL 154	3.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	94642722	214537671	Rat
1354591	Cm36	Cardiac mass QTL 36	4.1		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	102813953	201278233	Rat
1354615	Cm32	Cardiac mass QTL 32	5.2		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	1	102813953	201278233	Rat
1354606	Bp246	Blood pressure QTL 246	3.6		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	102813953	218753816	Rat
7794788	Mcs32	Mammary carcinoma susceptibility QTL 32	2.61		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	1	115540693	238914717	Rat
7421630	Bp362	Blood pressure QTL 362		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	118608292	241799120	Rat
631205	Bp196	Blood pressure QTL 196	4	0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	118944897	199050459	Rat
631549	Bp89	Blood pressure QTL 89	5.7		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	123350581	201284552	Rat
1598853	Memor3	Memory QTL 3	4.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	1	143506580	212458660	Rat
737828	Hcas3	Hepatocarcinoma susceptibility QTL 3	4.9		liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	1	144267353	222987745	Rat
2302378	Insul11	Insulin level QTL 11	3.25		blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	1	144267353	251128347	Rat
7771612	Cm80	Cardiac mass QTL 80	8.4		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	1	149448574	221264292	Rat
724531	Uae5	Urinary albumin excretion QTL 5	4		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	1	150700142	252085212	Rat
1578759	Uae30	Urinary albumin excretion QTL 30	3.3	0.003	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	150700247	252085048	Rat
1578778	Pur4	Proteinuria QTL 4	3.3	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	1	150700247	252085048	Rat
1354602	Bw35	Body weight QTL 35	12.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	201278233	Rat
1354620	Kidm19	Kidney mass QTL 19	4		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	151162512	201278233	Rat
1354634	Kidm12	Kidney mass QTL 12	3.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	1	151162512	201278233	Rat
1354636	Lmblg1	Limb length QTL 1	6.4		tibia length (VT:0004357)	tibia length (CMO:0000450)	1	151162512	201278233	Rat
1354610	Bw34	Body weight QTL 34	4.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
1354646	Kidm18	Kidney mass QTL 18	5.7		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	151162512	256448636	Rat
1354661	Bw33	Body weight QTL 33	5.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
1358886	Bp260	Blood pressure QTL 260	3.67		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	151162766	225824951	Rat
1549837	Hcar15	Hepatocarcinoma resistance QTL 15		0.05	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	153136852	260522016	Rat
2303622	Vencon6	Ventilatory control QTL 6		0.001	respiration trait (VT:0001943)	respiration rate (CMO:0000289)	1	154561505	199561505	Rat
4889428	Stresp24	Stress response QTL 24		0.05	heart pumping trait (VT:2000009)	absolute change in electrocardiographic low frequency R-R spectral component to high frequency R-R spectral component ratio (CMO:0002162)	1	155866514	200866514	Rat
1354618	Kidm15	Kidney mass QTL 15	5		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	1	156677124	201278233	Rat
2312420	Pur17	Proteinuria QTL 17	7.1	0.0001	urine protein amount (VT:0005160)	urine total protein excretion rate (CMO:0000756)	1	156677124	218753816	Rat
1354580	Scort1	Serum corticosterone level QTL 1	3.4		blood corticosterone amount (VT:0005345)	blood corticosterone level (CMO:0001172)	1	156677124	256448636	Rat
61347	Bp197	Blood pressure QTL 197	4.2		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	1	158633083	203633083	Rat
2292222	Bp307	Blood pressure QTL 307	3.06	0.0014	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	164310393	213533942	Rat
2292220	Bp306	Blood pressure QTL 306	3.47	0.00087	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	164310393	243914901	Rat
619613	Bp77	Blood pressure QTL 77		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	164747424	209747424	Rat
619613	Bp77	Blood pressure QTL 77		0.01	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	164747424	209747424	Rat
1354653	Despr9	Despair related QTL 9		0.00019	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	167909849	212909849	Rat
61341	Bp26	Blood pressure QTL 26			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	169537671	214537671	Rat
724562	Rends1	Renal damage susceptibility QTL 1		0.05	kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	1	169537671	214537671	Rat
1358294	Bw37	Body weight QTL 37	5	0.000011	body mass (VT:0001259)	body weight (CMO:0000012)	1	171310381	216310381	Rat
2293689	Bss47	Bone structure and strength QTL 47	7.25	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	1	171629477	216629477	Rat
2293693	Bss22	Bone structure and strength QTL 22	33.52	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	1	171629477	216629477	Rat
2300161	Bmd43	Bone mineral density QTL 43	8.4	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	171629477	216629477	Rat
2300174	Bmd42	Bone mineral density QTL 42	8.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	bone mineral density (CMO:0001226)	1	171629477	216629477	Rat
2300187	Bmd41	Bone mineral density QTL 41	8.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	171629477	216629477	Rat
2293654	Bss30	Bone structure and strength QTL 30	32.65	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	1	171629477	216629477	Rat
2293673	Bss27	Bone structure and strength QTL 27	18.63	0.0001	femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	1	171629477	216629477	Rat
2293677	Bss41	Bone structure and strength QTL 41	9.38	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra cross-sectional area (CMO:0001689)	1	171629477	216629477	Rat
1549830	Bss1	Bone structure and strength QTL 1	4.8		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	1	172609619	217609619	Rat
631214	Bw61	Body weight QTL61	3.4	0.0001	intramuscular adipose amount (VT:0010044)	intramuscular fat area (CMO:0001162)	1	173108781	218108781	Rat
70163	Bw20	Body weight QTL 20	5.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	174133260	219133260	Rat
738032	Hcas5	Hepatocarcinoma susceptibility QTL 5	3.12		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	176426412	257976495	Rat
1600380	Niddm70	Non-insulin dependent diabetes mellitus QTL 70	3.1	0.0008	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	176550523	221550523	Rat
10059600	Bp378	Blood pressure QTL 378	3.08	0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	176869060	221869060	Rat
1354624	Cm35	Cardiac mass QTL35	5.7		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	177227632	256448636	Rat
1354652	Kidm20	Kidney mass QTL 20	4.3		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	177227632	256448636	Rat
1558658	Bw59	Body weight QTL 59	3.5	0.0003	body mass (VT:0001259)	body weight (CMO:0000012)	1	178784622	223784622	Rat
634321	Hc1	Hypercalciuria QTL 1	2.91		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	1	178810256	240830002	Rat
1578763	Kidm29	Kidney mass QTL 29	3.3	0.0001	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	1	179567751	260522016	Rat
1302787	Stl25	Serum triglyceride level QTL 25	2.7	0.0073	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	1	180359209	210702199	Rat
6903303	Scl34	Serum cholesterol QTL 34	2.5	0.0033	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	180359209	218108781	Rat
737977	Bp160	Blood pressure QTL 160		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	181133855	226133855	Rat
724559	Pancm1	Pancreatic morphology QTL 1	7.1		islet of Langerhans morphology trait (VT:0005215)	pancreatic islet damage composite score (CMO:0001156)	1	181759564	214537555	Rat
2293083	Iddm25	Insulin dependent diabetes mellitus QTL 25	4.18		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	181829673	224569684	Rat
634312	Bp143	Blood pressure QTL 143	3	0.0002	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	182623426	219932796	Rat
8655655	Arrd2	Age-related retinal degeneration QTL 2	7.79		retinal layer morphology trait (VT:0003727)	percentage of study population developing retinopathy during a period of time (CMO:0002453)	1	183970203	243914901	Rat
8655855	Arrd3	Age-related retinal degeneration QTL 3	3.07		lens clarity trait (VT:0001304)	cataract incidence/prevalence measurement (CMO:0001585)	1	183970203	243914901	Rat
631838	Niddm36	Non-insulin dependent diabetes mellitus QTL 36		0.01	insulin secretion trait (VT:0003564)	calculated pancreatic islet insulin release measurement (CMO:0001217)	1	184550676	229550676	Rat
1300145	Rf7	Renal function QTL 7	2.96		urine creatinine amount (VT:0010540)	urine creatinine level (CMO:0000125)	1	185145134	221264292	Rat
1359018	Hrtrt20	Heart rate QTL 20	3.08		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	185356336	202902618	Rat
2312564	Glom18	Glomerulus QTL 18	2.4	0.003	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	1	185356336	231689108	Rat
1582206	Kidm33	Kidney mass QTL 33	6.9		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	188377360	224054420	Rat
6480780	Insul18	Insulin level QTL 18	4.11		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	189607473	200611765	Rat
1358898	Bp255	Blood pressure QTL 255	3.6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	191019702	246062233	Rat
10059590	Kidm44	Kidney mass QTL 44	3.42	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	191033875	236033875	Rat
631260	Tcas2	Tongue tumor susceptibility QTL 2	4.93		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	1	192485903	199050587	Rat
1358191	Ept10	Estrogen-induced pituitary tumorigenesis QTL 10	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	192825253	243914732	Rat
8552891	Epfw5	Epididymal fat weight QTL 5	4.4		epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	1	193113876	238113876	Rat
634338	Hcar4	Hepatocarcinoma resistance QTL 4	4.6		liver integrity trait (VT:0010547)	liver tumorous lesion number to liver area ratio (CMO:0001210)	1	193422268	214537671	Rat
1600388	Niddm67	Non-insulin dependent diabetes mellitus QTL 67	5.84	0.000004	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	195804352	257091168	Rat
1600395	Niddm69	Non-insulin dependent diabetes mellitus QTL 69	4.14	0.0002	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	195804352	257091168	Rat
1600396	Niddm68	Non-insulin dependent diabetes mellitus QTL 68	4.97	0.0003	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	195804352	257091168	Rat
631658	Cm7	Cardiac mass QTL 7	5.32	0.0001	aorta mass (VT:0002845)	aorta weight (CMO:0000076)	1	196248093	241248093	Rat
1358292	Cm37	Cardiac mass QTL 37	6.2	0.00000081	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	1	196248093	241248093	Rat
6480783	Insul19	Insulin level QTL 19	4.33		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	197489281	200611765	Rat
1600374	Mcs17	Mammary carcinoma susceptibility QTL 17	3		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	1	197670404	242670404	Rat
1641926	Teswt2	Testicular weight QTL 2	2.82		testis mass (VT:1000644)	both testes wet weight (CMO:0000175)	1	197697768	238755659	Rat
2302375	Bw83	Body weight QTL 83	4.87	0.0002	body mass (VT:0001259)	body weight (CMO:0000012)	1	197697768	242697768	Rat
61376	Bp42	Blood pressure QTL 42	23.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	197814409	242814409	Rat
1298084	Thym4	Thymus enlargement QTL 4	10.68		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	1	197814409	242814409	Rat
1357335	Bw39	Body weight QTL 39	3.3		body mass (VT:0001259)	body weight (CMO:0000012)	1	197814409	242814409	Rat
1331790	Bp201	Blood pressure QTL 201	3.127		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	198211513	225126682	Rat

Markers in Region

RH127728

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	198,251,331 - 198,251,548 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	216,253,132 - 216,253,348	NCBI	Rnor6.0
Rnor_5.0	1	223,114,763 - 223,114,979	UniSTS	Rnor5.0
RGSC_v3.4	1	203,342,722 - 203,342,938	UniSTS	RGSC3.4
Celera	1	195,820,230 - 195,820,446	UniSTS
Cytogenetic Map	1	q41	UniSTS

RH94618

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	198,251,329 - 198,251,507 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	216,253,130 - 216,253,307	NCBI	Rnor6.0
Rnor_5.0	1	223,114,761 - 223,114,938	UniSTS	Rnor5.0
RGSC_v3.4	1	203,342,720 - 203,342,897	UniSTS	RGSC3.4
Celera	1	195,820,228 - 195,820,405	UniSTS
Cytogenetic Map	1	q41	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High											2
Medium	3	43	57	41	19	41	8	11	74	35	39	11	8
Low
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_013087	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC095135	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC060583	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473953	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CR476007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FM032840	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FM090203	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FN799324	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214006	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218562	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229194	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ231991	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ232886	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000044	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U19894	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000027760 ⟹ ENSRNOP00000027760

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	198,241,484 - 198,251,660 (+)	Ensembl
Rnor_6.0 Ensembl	1	216,237,697 - 216,253,311 (+)	Ensembl

RefSeq Acc Id:

NM_013087 ⟹ NP_037219

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	1	198,235,861 - 198,251,660 (+)	NCBI
Rnor_6.0	1	216,237,663 - 216,253,460 (+)	NCBI
Rnor_5.0	1	223,099,328 - 223,114,942 (+)	NCBI
RGSC_v3.4	1	203,327,287 - 203,342,901 (+)	RGD
Celera	1	195,804,757 - 195,820,558 (+)	NCBI

Sequence:

show sequence

CGGTCTATAAAGAGTGAAGAGCTCGGCGCGCGCCCGGTCTGAGCGAGCGCGCCCTTGCTTCAAA
GCGGTAGCGACTCTAGCGCCTCCGGCTAGGCCTCCAACCCTTCTCTACCCTACGTCTCAATAGC
CGCACCGCAGTTCTCCGGCCCTCAAGCGACCCAGGCTATCTTCCAGTCCCGGACTCCGGTACTG
CGTCCCCAGACCGCCCGCTCCAGGACCAACCCAAGCTCCGCAGGCCGCGCGCCGCCATGGGGGT
GGAAGGCTGCACCAAATGCATCAAATACCTGCTCTTCGTCTTCAATTTCGTCTTCTGGCTGGCT
GGAGGTGTGATCCTAGGTGTAGCTCTGTGGTTGCGCCATGATCCACAAACCACCAGCCTTCTCT
ACCTGGAACTGGGAGACAAACCAGCACCTAGCACCTTCTATGTGGGCATCTACATTCTCATTGC
TGTGGGAGCTGTGATGATGTTTGTAGGCTTCCTGGGGTGCTATGGGGCCATCCAGGAGTCCCAG
TGCCTGCTGGGGACGTTCTTCACTTGCCTTGTGATCCTGTTTGCCTGTGAGGTAGCTGCGGGCA
TCTGGGGCTTTGTAAACAAAGACCAGATCGCCAAGGATGTGAAGCAGTTCTACGACCAGGCCCT
TCAGCAGGCTGTGATGGATGATGATGCCAACAATGCCAAGGCAGTGGTGAAGACCTTCCATGAG
ACGCTCAACTGTTGTGGCTCCAATACGCTGACCACACTGACCACCACCGTGCTGAGGAACAGCC
TGTGTCCCTCAAGCAGCAACTCATTCACTCAGCTTCTGAAGGAAGACTGCCATCAGAAAATCGA
TGAGCTCTTTTCTGGGAAGCTGTACCTCATTGGAATTGCAGCCATTGTGGTAGCTGTCATTATG
ATCTTCGAGATGATTCTGAGCATGGTGCTGTGCTGTGGCATCCGGAACAGCTCCGTGTACTAAG
GCCCTTCGCTTCGCACCAGAGGGTCCCTGGAATGACCAGAGGCCACCTTGGGGGCCATGGCCTG
TGTATATACTATTTCTGTATTACTCTGCTACACTTAGCCTTTTTACTTTTGAGTCTTTTTTGTT
CTGAACTTTTCCTGTCACCTTTTGGAGCCGACACCACACATAGGTGGCGTATGTGGGGACGTAG
AGGTGGAGCTGGCCCTAGCTGGCAGGGCCCTGTACTTCTGGGACCCCTGGAGAGTTCTGCCTGC
TGAGCCAAACCTCCTCCATAGCTACTTGTCCAGAGGCCACATAGCCAAGCTAGAAGGCCATGTC
CACCCACTCTGCCCACTGTGGGTCACATCGCTCCCATCTTTTTAATCCTTGTCCCTTTCCTGCC
TCCATTTCAAGAGCTGGGTTTGTAAGCACTCTTATGCCTTCAATGCACTTATTCTTTCTAACGT
GTCACCTTCAACTGTAATTAAATCTTGAAACAGTCATTTAATAAAGGAGGAAAAAATCAGGCAT
GCTAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_037219	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAC53103	(Get FASTA)	NCBI Sequence Viewer
	AAH60583	(Get FASTA)	NCBI Sequence Viewer
	EDM12179	(Get FASTA)	NCBI Sequence Viewer
	Q62745	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_037219 ⟸ NM_013087

- UniProtKB:

Q6P9V1 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MGVEGCTKCIKYLLFVFNFVFWLAGGVILGVALWLRHDPQTTSLLYLELGDKPAPSTFYVGIYI
LIAVGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVKQFYD
QALQQAVMDDDANNAKAVVKTFHETLNCCGSNTLTTLTTTVLRNSLCPSSSNSFTQLLKEDCHQ
KIDELFSGKLYLIGIAAIVVAVIMIFEMILSMVLCCGIRNSSVY

hide sequence

RefSeq Acc Id:

ENSRNOP00000027760 ⟸ ENSRNOT00000027760

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q62745-F1-model_v2	AlphaFold	Q62745	1-236	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13690569

Promoter ID:

EPDNEW_R1094

Type:

multiple initiation site

Name:

Cd81_1

Description:

Cd81 molecule

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	216,237,698 - 216,237,758	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2315	AgrOrtholog
BioCyc Gene	G2FUF-56880	BioCyc
Ensembl Genes	ENSRNOG00000020451	Ensembl, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000027760.5	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000027760.8	UniProtKB/TrEMBL
Gene3D-CATH	1.10.1450.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:6918296	IMAGE-MGC_LOAD
InterPro	Tetraspanin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Tetraspanin/Peripherin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Tetraspanin_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Tetraspanin_EC2_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:25621	UniProtKB/TrEMBL
MGC_CLONE	MGC:72925	IMAGE-MGC_LOAD
NCBI Gene	25621	ENTREZGENE
PANTHER	CD81 ANTIGEN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR19282	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Tetraspanin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Cd81	PhenoGen
PIRSF	Tetraspanin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PRINTS	TMFOUR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	TM4_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF48652	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TIGR	TC216937
UniProt	CD81_RAT	UniProtKB/Swiss-Prot
	F7EXZ2_RAT	UniProtKB/TrEMBL
	Q62745	ENTREZGENE
	Q6P9V1	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-09-29	Cd81	Cd81 molecule	Cd81	CD 81 antigen	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-11-06	Cd81	CD 81 antigen		CD81 antigen (target of antiproliferative antibody 1)	Name updated	625702	APPROVED
2002-06-10	Cd81	CD81 antigen (target of antiproliferative antibody 1)			Symbol and Name status set to approved	70586	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)