Arpc1b (actin related protein 2/3 complex, subunit 1B)

Advanced Search (OLGA)

Gene: Arpc1b (actin related protein 2/3 complex, subunit 1B) Rattus norvegicus

Analyze

Symbol:

Arpc1b

Name:

actin related protein 2/3 complex, subunit 1B

RGD ID:

2155

Description:

Predicted to enable actin filament binding activity. Predicted to be a structural constituent of cytoskeleton. Involved in response to estradiol and response to estrogen. Part of tubulobulbar complex. Human ortholog(s) of this gene implicated in gastritis; immunodeficiency 71; and myelodysplastic syndrome. Orthologous to human ARPC1B (actin related protein 2/3 complex subunit 1B); PARTICIPATES IN insulin responsive facilitative sugar transporter mediated glucose transport pathway; platelet-derived growth factor signaling pathway; Rab family mediated signaling pathway; INTERACTS WITH 1,2,4-trimethylbenzene; 1-naphthyl isothiocyanate; 17alpha-ethynylestradiol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

actin-related protein 2/3 complex subunit 1B; Actin-related protein complex 1b; arp2/3 complex 41 kDa subunit; p41-ARC; p41Arc

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	14,595,939 - 14,609,501 (-)	NCBI		GRCr8
mRatBN7.2	12	9,482,176 - 9,495,772 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	9,480,831 - 9,495,747 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	10,286,931 - 10,300,462 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	10,910,133 - 10,923,665 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	9,933,561 - 9,947,093 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	11,252,300 - 11,265,849 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	11,252,296 - 11,265,865 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	13,321,403 - 13,334,951 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	9,796,269 - 9,803,639 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	12	9,826,196 - 9,833,567 (-)	NCBI
Celera	12	11,287,122 - 11,300,659 (-)	NCBI		Celera
Cytogenetic Map	12	p11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

basal cell carcinoma (ISO)

combined immunodeficiency (ISO)

Experimental Liver Cirrhosis (ISO)

gastritis (ISO)

genetic disease (ISO)

hemorrhagic disease (ISO)

immunodeficiency 71 (ISO)

myelodysplastic syndrome (ISO)

oral squamous cell carcinoma (ISO)

pleomorphic xanthoastrocytoma (ISO)

primary immunodeficiency disease (ISO)

schizophrenia (ISO)

stomach cancer (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2,4-trimethylbenzene (EXP)

1,2-dimethylhydrazine (ISO)

1-naphthyl isothiocyanate (EXP)

17alpha-ethynylestradiol (EXP)

17beta-estradiol (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-tribromophenol (ISO)

2-nitrofluorene (EXP)

3,4-methylenedioxymethamphetamine (ISO)

3-chloropropane-1,2-diol (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

3H-1,2-dithiole-3-thione (EXP)

4,4'-diaminodiphenylmethane (EXP,ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

9-cis-retinoic acid (EXP)

aconitine (EXP)

acrolein (ISO)

acrylamide (EXP)

all-trans-retinoic acid (ISO)

allethrin (EXP)

alpha-pinene (ISO)

amitrole (EXP)

ammonium chloride (EXP)

antirheumatic drug (ISO)

aripiprazole (EXP)

aristolochic acid A (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

bexarotene (EXP)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

caffeine (ISO)

calcitriol (ISO)

carbon nanotube (ISO)

carbonyl sulfide (EXP)

chlorpyrifos (EXP)

cisplatin (ISO)

cobalt dichloride (ISO)

copper atom (EXP)

copper(0) (EXP)

cyclosporin A (ISO)

cyhalothrin (EXP)

cypermethrin (EXP)

dexamethasone (ISO)

diarsenic trioxide (ISO)

dibutyl phthalate (EXP,ISO)

diethylstilbestrol (ISO)

diuron (EXP)

dorsomorphin (ISO)

elemental selenium (ISO)

epoxiconazole (ISO)

ethanol (ISO)

fenamidone (ISO)

fenvalerate (EXP)

flavonoids (EXP)

folic acid (ISO)

FR900359 (ISO)

genistein (ISO)

glafenine (EXP)

indometacin (ISO)

ivermectin (ISO)

methimazole (EXP)

methyl methanesulfonate (ISO)

methylmercury chloride (ISO)

N-methyl-4-phenylpyridinium (ISO)

N-nitrosodiethylamine (ISO)

N-nitrosodimethylamine (EXP)

naphthalenes (EXP)

nickel atom (ISO)

ozone (ISO)

p-toluidine (EXP)

paracetamol (ISO)

phenobarbital (ISO)

pirinixic acid (EXP)

pyrethrins (EXP)

resveratrol (ISO)

SB 431542 (ISO)

selenium atom (ISO)

sodium arsenite (ISO)

sodium fluoride (ISO)

Soman (EXP)

sulfadimethoxine (EXP)

sulindac sulfide (ISO)

sunitinib (ISO)

testosterone (ISO)

testosterone enanthate (ISO)

tetrachloromethane (ISO)

thimerosal (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trichostatin A (ISO)

triphenyl phosphate (ISO)

tungsten (ISO)

valproic acid (ISO)

vancomycin (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

Arp2/3 complex-mediated actin nucleation (IBA,IEA,ISO)

response to estradiol (IEP)

response to estrogen (IEP)

Cellular Component

Arp2/3 protein complex (IBA,IEA,ISO)

cytoplasm (IEA)

nucleus (IEA)

tubulobulbar complex (IDA)

Molecular Function

actin binding (IEA)

actin filament binding (IBA,ISO)

protein binding (ISO)

protein-containing complex binding (IPI)

structural constituent of cytoskeleton (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

Fc gamma receptor mediated signaling pathway (IEA)

insulin responsive facilitative sugar transporter mediated glucose transport pathway (ISO)

platelet-derived growth factor signaling pathway (ISO)

Rab family mediated signaling pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Caveolin 1 (Cav-1) and actin-related protein 2/3 complex, subunit 1B (ARPC1B) expressions as prognostic indicators for oral squamous cell carcinoma (OSCC).	Auzair LB, etal., Eur Arch Otorhinolaryngol. 2015 Jul 3.
2.	Changes associated with lenalidomide treatment in the gene expression profiles of patients with del(5q).	Belickova M, etal., Clin Lymphoma Myeloma Leuk. 2012 Oct;12(5):375-83. doi: 10.1016/j.clml.2012.04.003. Epub 2012 May 18.
3.	Coronin 1B antagonizes cortactin and remodels Arp2/3-containing actin branches in lamellipodia.	Cai L, etal., Cell. 2008 Sep 5;134(5):828-42. doi: 10.1016/j.cell.2008.06.054.
4.	Arp2/3- and cofilin-coordinated actin dynamics is required for insulin-mediated GLUT4 translocation to the surface of muscle cells.	Chiu TT, etal., Mol Biol Cell. 2010 Oct 15;21(20):3529-39. doi: 10.1091/mbc.E10-04-0316. Epub 2010 Aug 25.
5.	Disruption of tubulobulbar complex by high intratesticular estrogens leading to failed spermiation.	D'Souza R, etal., Endocrinology. 2009 Apr;150(4):1861-9. doi: 10.1210/en.2008-1232. Epub 2008 Dec 18.
6.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
7.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
8.	Decreased expression of the seven ARP2/3 complex genes in human gastric cancers.	Kaneda A, etal., Cancer Lett. 2004 Aug 30;212(2):203-10.
9.	Estrogen and androgen regulate actin-remodeling and endocytosis-related genes during rat spermiation.	Kumar A, etal., Mol Cell Endocrinol. 2015 Mar 15;404:91-101. doi: 10.1016/j.mce.2014.12.029. Epub 2015 Jan 28.
10.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
11.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
12.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
13.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
14.	Mitochondrial dysfunction in schizophrenia: evidence for compromised brain metabolism and oxidative stress.	Prabakaran S, etal., Mol Psychiatry. 2004 Jul;9(7):684-97, 643.
15.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
16.	Comprehensive gene review and curation	RGD comprehensive gene curation
17.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
18.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
19.	The human Arp2/3 complex is composed of evolutionarily conserved subunits and is localized to cellular regions of dynamic actin filament assembly.	Welch MD, etal., J Cell Biol 1997 Jul 28;138(2):375-84.
20.	Altered mucosal DNA methylation in parallel with highly active Helicobacter pylori-related gastritis.	Yoshida T, etal., Gastric Cancer. 2013 Oct;16(4):488-97. doi: 10.1007/s10120-012-0230-x. Epub 2013 Jan 6.

Additional References at PubMed

PMID:11741539	PMID:15489334	PMID:20458337	PMID:21423176	PMID:23376485	PMID:27113856	PMID:28242260	PMID:28972183	PMID:35352799

Genomics

Comparative Map Data

Arpc1b
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	14,595,939 - 14,609,501 (-)	NCBI		GRCr8
mRatBN7.2	12	9,482,176 - 9,495,772 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	9,480,831 - 9,495,747 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	10,286,931 - 10,300,462 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	10,910,133 - 10,923,665 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	9,933,561 - 9,947,093 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	11,252,300 - 11,265,849 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	11,252,296 - 11,265,865 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	13,321,403 - 13,334,951 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	9,796,269 - 9,803,639 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	12	9,826,196 - 9,833,567 (-)	NCBI
Celera	12	11,287,122 - 11,300,659 (-)	NCBI		Celera
Cytogenetic Map	12	p11	NCBI

ARPC1B
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	99,374,259 - 99,394,816 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	99,374,249 - 99,394,816 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	7	98,972,353 - 98,992,439 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	98,810,265 - 98,830,360 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	7	98,616,979 - 98,637,053	NCBI
Celera	7	93,706,528 - 93,726,623 (+)	NCBI		Celera
Cytogenetic Map	7	q22.1	NCBI
HuRef	7	93,608,035 - 93,628,135 (+)	NCBI		HuRef
CHM1_1	7	98,902,377 - 98,922,501 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	7	100,610,955 - 100,633,717 (+)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	98,332,071 - 98,352,197 (+)	NCBI

Arpc1b
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	145,051,066 - 145,064,996 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	145,051,025 - 145,067,515 (+)	Ensembl		GRCm39 Ensembl
GRCm38	5	145,114,256 - 145,128,186 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	145,114,215 - 145,130,705 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	145,875,125 - 145,889,055 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	145,367,857 - 145,381,713 (+)	NCBI		MGSCv36	mm8
Celera	5	142,106,218 - 142,120,149 (+)	NCBI		Celera
Cytogenetic Map	5	G2	NCBI
cM Map	5	85.03	NCBI

Arpc1b
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955460	15,055,480 - 15,069,093 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955460	15,055,753 - 15,069,093 (+)	NCBI	ChiLan1.0	ChiLan1.0

ARPC1B
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	117,231,895 - 117,252,410 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	165,496,564 - 165,517,159 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	91,348,120 - 91,368,299 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	104,861,582 - 104,870,382 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	104,861,582 - 104,870,369 (+)	Ensembl	panpan1.1		panPan2

ARPC1B
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	10,192,299 - 10,198,383 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	10,178,462 - 10,198,309 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	11,819,059 - 11,832,117 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	10,192,483 - 10,205,575 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	10,134,810 - 10,205,481 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	10,062,441 - 10,075,520 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	10,040,965 - 10,054,042 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	10,274,762 - 10,287,831 (-)	NCBI		UU_Cfam_GSD_1.0

Arpc1b
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	138,283,052 - 138,294,275 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936750	1,650,979 - 1,662,206 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936750	1,651,026 - 1,662,208 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ARPC1B
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	6,220,939 - 6,342,637 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	6,329,737 - 6,342,641 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	6,520,442 - 6,527,677 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ARPC1B
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	28	13,764,637 - 13,780,317 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666070	2,517,817 - 2,538,868 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Arpc1b
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624740	32,805,610 - 32,821,918 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624740	32,805,647 - 32,821,986 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Arpc1b
133 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	49
Count of miRNA genes:	35
Interacting mature miRNAs:	42
Transcripts:	ENSRNOT00000001315
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2312418	Kidm41	Kidney mass QTL 41	3.7	0.0001	kidney mass (VT:0002707)	single kidney wet weight to body weight ratio (CMO:0000622)	12	1	19611090	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
1331739	Hrtrt14	Heart rate QTL 14	3.56232		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	12	9318216	12829686	Rat
9590147	Scort7	Serum corticosterone level QTL 7	13.61	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	12	1	42110980	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564498	46669029	Rat
61331	Eau2	Experimental allergic uveoretinitis QTL 2		0.0005	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	12	8525423	28064601	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	6107579	46669029	Rat
1581516	Cm56	Cardiac mass QTL 56	4.2	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	12	1	29333307	Rat
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
9590086	Insglur6	Insulin/glucose ratio QTL 6	18.97	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	12	1	42110980	Rat
6893681	Bw109	Body weight QTL 109	2.3	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	12	1	23297788	Rat
1302792	Scl21	Serum cholesterol level QTL 21	3.8	0.0011	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	12	7196730	46669029	Rat
1598855	Bp294	Blood pressure QTL 294	3.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	1	34851688	Rat
1600391	Edcs2	Endometrial carcinoma susceptibility QTL2	3.5	0.01	uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	12	6833190	17870186	Rat
724526	Uae3	Urinary albumin excretion QTL 3	4.9	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	12	3906969	10373166	Rat
10755457	Coatc14	Coat color QTL 14		0.01759	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	12	1	22591684	Rat
634351	Apr5	Acute phase response QTL 5	6.7		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	12	1	44503507	Rat
634350	Apr4	Acute phase response QTL 4	6		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	1172005	46172005	Rat
8694179	Bw150	Body weight QTL 150	2.9	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	12	1	42110980	Rat
7411545	Bw128	Body weight QTL 128	5.2	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	12	1	42110980	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	5564495	46669029	Rat
7387292	Kidm42	Kidney mass QTL 42	3.03	0.0004	kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	12	1	36247923	Rat
1300157	Rf21	Renal function QTL 21	4.4		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	12	9318216	32103380	Rat
737979	Pia22	Pristane induced arthritis QTL 22	53.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	1	44465750	Rat
7411586	Foco5	Food consumption QTL 5	5.4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
2303575	Insul14	Insulin level QTL 14	4		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	12	1	42450532	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
2302042	Pia38	Pristane induced arthritis QTL 38	3.5	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	1	44503507	Rat
7411595	Foco9	Food consumption QTL 9	4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
2293086	Iddm30	Insulin dependent diabetes mellitus QTL 30	3.82		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	8449490	28302290	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
7411660	Foco28	Food consumption QTL 28	10.9	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat

Markers in Region

AW208418

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	9,482,384 - 9,482,495 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	11,252,507 - 11,252,617	NCBI	Rnor6.0
Rnor_5.0	12	13,321,610 - 13,321,720	UniSTS	Rnor5.0
RGSC_v3.4	12	9,796,476 - 9,796,586	UniSTS	RGSC3.4
Celera	12	11,287,329 - 11,287,439	UniSTS
Cytogenetic Map	12	p11	UniSTS

RH127787

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	9,482,333 - 9,482,659 (+)	MAPPER	mRatBN7.2
mRatBN7.2	15	31,903,244 - 31,903,431 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	38,029,775 - 38,029,961	NCBI	Rnor6.0
Rnor_6.0	12	11,252,456 - 11,252,781	NCBI	Rnor6.0
Rnor_5.0	15	41,870,760 - 41,870,946	UniSTS	Rnor5.0
Rnor_5.0	12	13,321,559 - 13,321,884	UniSTS	Rnor5.0
RGSC_v3.4	12	9,796,425 - 9,796,750	UniSTS	RGSC3.4
RGSC_v3.4	15	36,799,280 - 36,799,466	UniSTS	RGSC3.4
Celera	15	31,613,626 - 31,613,812	UniSTS
Celera	12	11,287,278 - 11,287,603	UniSTS
RH 3.4 Map	15	259.29	UniSTS
Cytogenetic Map	12	p11	UniSTS
Cytogenetic Map	15	p12	UniSTS

RH129626

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	15	31,903,371 - 31,903,560 (+)	MAPPER	mRatBN7.2
mRatBN7.2	12	9,482,210 - 9,482,393 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	11,252,333 - 11,252,515	NCBI	Rnor6.0
Rnor_6.0	15	38,029,902 - 38,030,090	NCBI	Rnor6.0
Rnor_5.0	15	41,870,887 - 41,871,075	UniSTS	Rnor5.0
Rnor_5.0	12	13,321,436 - 13,321,618	UniSTS	Rnor5.0
RGSC_v3.4	12	9,796,302 - 9,796,484	UniSTS	RGSC3.4
RGSC_v3.4	15	36,799,407 - 36,799,595	UniSTS	RGSC3.4
Celera	15	31,613,753 - 31,613,941	UniSTS
Celera	12	11,287,155 - 11,287,337	UniSTS
Cytogenetic Map	15	p12	UniSTS
Cytogenetic Map	12	p11	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_019289	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039089713	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC136010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF083269	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC062027	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228791	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228917	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228971	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ231755	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ232285	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000001315 ⟹ ENSRNOP00000001315

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	9,482,291 - 9,495,747 (-)	Ensembl
Rnor_6.0 Ensembl	12	11,252,296 - 11,265,865 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000114214 ⟹ ENSRNOP00000091680

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	9,480,831 - 9,495,712 (-)	Ensembl

RefSeq Acc Id:

NM_019289 ⟹ NP_062162

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	14,595,939 - 14,609,488 (-)	NCBI
mRatBN7.2	12	9,482,178 - 9,495,739 (-)	NCBI
Rnor_6.0	12	11,252,300 - 11,265,849 (-)	NCBI
Rnor_5.0	12	13,321,403 - 13,334,951 (-)	NCBI
RGSC_v3.4	12	9,796,269 - 9,803,639 (-)	RGD
Celera	12	11,287,122 - 11,300,659 (-)	RGD

Sequence:

show sequence

CGCTGCGCGGGTCTCAGAGCCGGTTCGGCGCGTCGACTGTCCAGAGTCCGCGGCCGAGGAGACC
CGAGGTCCAGGAGACAAGTGACTATGGCTTACCACAGCTTCCTGGTGGAACCCATCAGCTGCCA
TGCCTGGAACAAGGACCGTACTCAGATCGCCATCTGCCCCAACAACCACGAGGTGCACATCTAC
GAGAAGAGCGGTGCCAAGTGGAACAAGGTGCACGAGCTCAAGGAGCACAACGGGCAGGTGACAG
GCATCGACTGGGCCCCCGAGAGTAACCGCATTGTGACCTGCGGCACAGACCGCAATGCCTATGT
GTGGACGCTGAAGGGCCGCACGTGGAAGCCCACGCTGGTCATCCTTCGGATTAATCGAGCTGCC
CGCTGCGTGCGCTGGGCCCCCAATGAGAACAAGTTCGCCGTGGGCAGTGGCTCCCGTGTCATTT
CCATCTGTTATTTTGAGCAGGAGAATGACTGGTGGGTGTGCAAACACATCAAAAAGCCCATCCG
CTCCACTGTCCTTAGCCTGGACTGGCACCCCAACAACGTGCTCCTGGCTGCAGGCTCCTGTGAC
TTCAAGTGCAGGATCTTCTCTGCCTATATCAAGGAGGTGGAGGAACGGCCAGCCCCTACACCGT
GGGGCTCCAAGATGCCCTTTGGGGAGCTGATGTTTGAATCGAGCAGCAGCTGTGGCTGGGTGCA
TGGTGTCTGCTTCTCGGCCGGTGGGAGCCGAGTTGCTTGGGTCAGCCATGACAGCACTGTGTGC
CTGGTAGATGCTGAGAAGAAGATGGCCGTGGCAACCCTGGCCTCTGAGACATTACCGCTCCTGG
CCATCACCTTCATCACAGAAAATAGTCTCGTGGCAGCGGGCCACGACTGCTTCCCGGTGCTGTT
TACCTATGACAACGCTGCGGGGACATTGAGCTTTGGTGGCCGGCTGGATGTGCCCAAGCAGAAC
TCCCAGCGTGGCCTGACAGCCCGAGAGCGCTTCCAGAACCTCGACAAGAAGGCCAGCTCTGAAG
GGGGTGCAGCCACAGGGGCTGGCCTGGATTCACTGCACAAGAACAGCGTCAGTCAAATCTCGGT
GCTCAGCGGGGGCAAGGCCAAGTGCTCGCAGTTCTGCACCACAGGCATGGACGGTGGCATGAGC
ATCTGGGATGTGAAGAGCTTGGAGTCAGCCTTGAAGGACCTGAAGATCAGATGAGCTGTGAGGA
GTGCTGTCCTCATCCCACATGCTGGGGAGGAGGGAAAGGGGTTGGGGAGGCTAAGGGCTGCTTT
GCTGAATGCTTCTAGGGTGTAGTACAGGTCTGCAAAGGGGATGCTCTCTCTCCAAAGAGGGGAA
GAGGAAGGTGGGGAACTTTCCTGCCTATTTAATGAAAATGTGCCTTTTAAAGAGATGCTTTCAT
TCATTGCAAACCAAAAACAAGACAAAAAACCCAAAGCACAATGCTGGTCATAAACTGCTTCAAA
ATGTGGGCTAATAAACATACCAAATGTGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039089713 ⟹ XP_038945641

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	14,595,939 - 14,609,501 (-)	NCBI
mRatBN7.2	12	9,482,176 - 9,495,772 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_062162	(Get FASTA)	NCBI Sequence Viewer
	XP_038945641	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAC32605	(Get FASTA)	NCBI Sequence Viewer
	AAH62027	(Get FASTA)	NCBI Sequence Viewer
	EDL89617	(Get FASTA)	NCBI Sequence Viewer
	EDL89618	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000001315.5
	ENSRNOP00000091680.1
GenBank Protein	O88656	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_062162 ⟸ NM_019289

- UniProtKB:

O88656 (UniProtKB/Swiss-Prot), A6K1G1 (UniProtKB/TrEMBL), A0A8L2Q086 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAYHSFLVEPISCHAWNKDRTQIAICPNNHEVHIYEKSGAKWNKVHELKEHNGQVTGIDWAPES
NRIVTCGTDRNAYVWTLKGRTWKPTLVILRINRAARCVRWAPNENKFAVGSGSRVISICYFEQE
NDWWVCKHIKKPIRSTVLSLDWHPNNVLLAAGSCDFKCRIFSAYIKEVEERPAPTPWGSKMPFG
ELMFESSSSCGWVHGVCFSAGGSRVAWVSHDSTVCLVDAEKKMAVATLASETLPLLAITFITEN
SLVAAGHDCFPVLFTYDNAAGTLSFGGRLDVPKQNSQRGLTARERFQNLDKKASSEGGAATGAG
LDSLHKNSVSQISVLSGGKAKCSQFCTTGMDGGMSIWDVKSLESALKDLKIR

hide sequence

Ensembl Acc Id:

ENSRNOP00000001315 ⟸ ENSRNOT00000001315

RefSeq Acc Id:	XP_038945641 ⟸ XM_039089713
- Peptide Label:	isoform X1
- UniProtKB:	O88656 (UniProtKB/Swiss-Prot), A6K1G1 (UniProtKB/TrEMBL), A0A8L2Q086 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000091680 ⟸ ENSRNOT00000114214

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-O88656-F1-model_v2	AlphaFold	O88656	1-372	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698419

Promoter ID:

EPDNEW_R8943

Type:

initiation region

Name:

Arpc1b_1

Description:

actin related protein 2/3 complex, subunit 1B

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	12	11,265,834 - 11,265,894	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2155	AgrOrtholog
BioCyc Gene	G2FUF-20055	BioCyc
Ensembl Genes	ENSRNOG00000000991	Ensembl, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000001315.7	UniProtKB/TrEMBL
	ENSRNOT00000114214.1	UniProtKB/Swiss-Prot
Gene3D-CATH	2.130.10.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:5622004	IMAGE-MGC_LOAD
InterPro	ARPC1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	WD40/YVTN_repeat-like_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	WD40_repeat	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	WD40_repeat_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:54227	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:72489	IMAGE-MGC_LOAD
NCBI Gene	54227	ENTREZGENE
PANTHER	PTHR10709	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR10709:SF10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	WD40	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Arpc1b	PhenoGen
PIRSF	ARP2/3_su1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	WD_REPEATS_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	WD_REPEATS_REGION	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000000991	RatGTEx
SMART	WD40	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF50978	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TIGR	TC217626
UniProt	A0A8L2Q086	ENTREZGENE, UniProtKB/TrEMBL
	A6K1G1	ENTREZGENE, UniProtKB/TrEMBL
	ARC1B_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2003-04-09	Arpc1b	actin related protein 2/3 complex, subunit 1B		Actin-related protein complex 1b	Name updated	629478	APPROVED
2002-06-10	Arpc1b	Actin-related protein complex 1b			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_function	human homolog is a subunit of the Arp2/3 protein complex	631743
gene_process	human homolog is involved in control of actin polymerization	631743

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)