Gas1 (growth arrest specific 1) - Rat Genome Database

Name: Gas1
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Gas1 (growth arrest specific 1) Mus musculus

Analyze

Symbol:

Gas1

Name:

growth arrest specific 1

RGD ID:

1623311

MGI Page

MGI

Description:

Involved in several processes, including negative regulation of cell growth; odontogenesis; and regulation of smoothened signaling pathway. Acts upstream of or within several processes, including embryonic morphogenesis; nervous system development; and regulation of smoothened signaling pathway. Located in plasma membrane. Is expressed in several structures, including alimentary system; brain; genitourinary system; limb; and sensory organ. Orthologous to human GAS1 (growth arrest specific 1).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

AW554192; Gas; Gas-1; growth arrest-specific protein 1

RGD Orthologs

Human

Rat

Chinchilla

Bonobo

Dog

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GAS1 (growth arrest specific 1)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Rattus norvegicus (Norway rat):	Gas1 (growth arrest-specific 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Gas1 (growth arrest specific 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GAS1 (growth arrest specific 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GAS1 (growth arrest specific 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GAS1 (growth arrest specific 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GAS1 (growth arrest specific 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Gas1 (growth arrest specific 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	GAS1 (growth arrest specific 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Rattus norvegicus (Norway rat):	Gas1 (growth arrest-specific 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	gas1b (growth arrest-specific 1b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid\|ZFIN)
Danio rerio (zebrafish):	gas1a (growth arrest-specific 1a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid\|ZFIN)

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	13	60,322,219 - 60,325,179 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	13	60,322,219 - 60,325,179 (-)	Ensembl		GRCm39 Ensembl
GRCm38	13	60,174,405 - 60,177,535 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	13	60,174,405 - 60,177,365 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	13	60,275,766 - 60,278,896 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	13	60,184,028 - 60,186,988 (-)	NCBI		MGSCv36	mm8
Celera	13	61,235,218 - 61,238,431 (-)	NCBI		Celera
Cytogenetic Map	13	B2	NCBI
cM Map	13	31.92	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

holoprosencephaly (ISO)

holoprosencephaly 1 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (EXP)

1-nitropyrene (ISO)

17alpha-ethynylestradiol (EXP)

17beta-estradiol (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-methylcholine (ISO)

3,3',4,4',5-pentachlorobiphenyl (EXP)

3,3',5,5'-tetrabromobisphenol A (EXP)

4,4'-diaminodiphenylmethane (EXP)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (ISO)

acetaldehyde (EXP)

acrylamide (ISO)

aflatoxin B1 (EXP,ISO)

all-trans-retinoic acid (EXP,ISO)

Aroclor 1254 (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

beta-naphthoflavone (EXP)

bis(2-chloroethyl) sulfide (EXP)

bisphenol A (EXP,ISO)

bisphenol F (EXP)

butan-1-ol (ISO)

cadmium atom (ISO)

cadmium dichloride (EXP,ISO)

cadmium sulfate (ISO)

calcitriol (ISO)

cannabidiol (EXP,ISO)

carbon nanotube (EXP)

CGP 52608 (ISO)

ciguatoxin CTX1B (EXP)

cisplatin (EXP,ISO)

cobalt dichloride (ISO)

copper atom (EXP)

copper(0) (EXP)

crotonaldehyde (ISO)

cycloheximide (ISO)

desferrioxamine B (ISO)

diarsenic trioxide (ISO)

diclofenac (EXP)

diethylstilbestrol (EXP)

dimercaprol (EXP)

dioxygen (EXP)

divanadium pentaoxide (ISO)

dorsomorphin (ISO)

entinostat (ISO)

ethanol (ISO)

flusilazole (EXP)

folic acid (EXP)

formaldehyde (ISO)

gemcitabine (ISO)

gentamycin (ISO)

hemin (ISO)

hydroquinone (ISO)

iron atom (ISO)

iron(0) (ISO)

lamivudine (ISO)

lead(II) chloride (ISO)

melphalan (ISO)

mercury dibromide (ISO)

methylseleninic acid (ISO)

microcystin-LR (EXP)

Monobutylphthalate (EXP)

N-nitrosodiethylamine (EXP)

nickel dichloride (EXP)

O-methyleugenol (ISO)

p-chloromercuribenzoic acid (ISO)

paracetamol (EXP,ISO)

phenobarbital (EXP)

phenylmercury acetate (ISO)

pirinixic acid (EXP)

progesterone (ISO)

rotenone (ISO)

SB 431542 (ISO)

silicon dioxide (EXP,ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenate (ISO)

sodium fluoride (EXP)

sulforaphane (ISO)

tamoxifen (EXP,ISO)

tetrachloromethane (EXP)

tetraphene (EXP)

thapsigargin (EXP,ISO)

thioacetamide (ISO)

titanium dioxide (EXP)

trichloroethene (EXP)

triclosan (ISO)

trimellitic anhydride (EXP)

Triptolide (EXP)

troglitazone (EXP)

urethane (EXP)

valproic acid (EXP,ISO)

zidovudine (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

apoptotic process (IMP)

axon guidance (IMP)

camera-type eye development (IMP)

cell fate commitment (IGI,IMP)

cell population proliferation (IMP)

cellular response to vascular endothelial growth factor stimulus (ISO)

cerebellum morphogenesis (IMP)

developmental growth (IMP)

dorsal/ventral neural tube patterning (IGI,IMP)

dorsal/ventral pattern formation (IMP)

embryonic cranial skeleton morphogenesis (IGI,IMP)

embryonic digit morphogenesis (IGI,IMP)

embryonic morphogenesis (IGI,IMP)

embryonic skeletal system development (IGI,IMP)

eye morphogenesis (IMP)

middle ear morphogenesis (IMP)

negative regulation of apoptotic process (IDA,IMP)

negative regulation of cell cycle G1/S phase transition (NAS)

negative regulation of cell growth (IDA)

negative regulation of epithelial cell proliferation (IMP)

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand (IDA)

negative regulation of mitotic cell cycle (IBA,ISO)

negative regulation of protein processing (ISO)

negative regulation of smoothened signaling pathway (IDA)

odontogenesis (IMP)

outer ear morphogenesis (IMP)

positive regulation of cell population proliferation (IMP)

positive regulation of epithelial cell proliferation (IMP)

positive regulation of mesenchymal cell proliferation (IMP)

positive regulation of smoothened signaling pathway (IDA,IMP)

programmed cell death (IDA)

regulation of cell cycle (TAS)

regulation of ER to Golgi vesicle-mediated transport (ISO)

regulation of smoothened signaling pathway (IMP)

roof of mouth development (IMP)

smoothened signaling pathway (IMP)

Cellular Component

membrane (IDA)

plasma membrane (IBA,IDA,ISO,ISS)

Molecular Function

protein binding (IPI)

Molecular Pathway Annotations Click to see Annotation Detail View

Hedgehog signaling pathway (IEA,ISO)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

abnormal anterior eye segment morphology (IAGP)

abnormal autopod morphology (IAGP)

abnormal basicranium morphology (IAGP)

abnormal basisphenoid bone morphology (IAGP)

abnormal cerebellar foliation (IAGP)

abnormal cerebellar molecular layer (IAGP)

abnormal cerebellar Purkinje cell layer (IAGP)

abnormal cerebellum development (IAGP)

abnormal cerebellum external granule cell layer morphology (IAGP)

abnormal ciliary body morphology (IAGP)

abnormal cornea morphology (IAGP)

abnormal craniofacial bone morphology (IAGP)

abnormal craniofacial morphology (IAGP)

abnormal digit development (IAGP)

abnormal digit morphology (IAGP)

abnormal embryo turning (IAGP)

abnormal external auditory canal morphology (IAGP)

abnormal eye development (IAGP)

abnormal eye morphology (IAGP)

abnormal face development (IAGP)

abnormal floor plate morphology (IAGP)

abnormal gait (IAGP)

abnormal heart tube morphology (IAGP)

abnormal incisor morphology (IAGP)

abnormal innervation (IAGP)

abnormal intervertebral disk morphology (IAGP)

abnormal iris morphology (IAGP)

abnormal limb bone morphology (IAGP)

abnormal limb bud morphology (IAGP)

abnormal limb mesenchyme morphology (IAGP)

abnormal limb morphology (IAGP)

abnormal lower incisor morphology (IAGP)

abnormal malleus manubrium morphology (IAGP)

abnormal malleus morphology (IAGP)

abnormal malleus neck morphology (IAGP)

abnormal malleus processus brevis morphology (IAGP)

abnormal mandible morphology (IAGP)

abnormal Meckel's cartilage morphology (IAGP)

abnormal medial nasal prominence morphology (IAGP)

abnormal middle ear morphology (IAGP)

abnormal molar morphology (IAGP)

abnormal nasal capsule morphology (IAGP)

abnormal neurocranium morphology (IAGP)

abnormal nose morphology (IAGP)

abnormal otic capsule morphology (IAGP)

abnormal palatal mesenchymal cell proliferation (IAGP)

abnormal phalanx morphology (IAGP)

abnormal posterior eye segment morphology (IAGP)

abnormal premaxilla morphology (IAGP)

abnormal Purkinje cell dendrite morphology (IAGP)

abnormal Purkinje cell morphology (IAGP)

abnormal retina ganglion layer morphology (IAGP)

abnormal retina neuronal layer morphology (IAGP)

abnormal retina pigment epithelium morphology (IAGP)

abnormal rostral-caudal body axis extension (IAGP)

abnormal secondary palate development (IAGP)

abnormal stapes morphology (IAGP)

abnormal styloid process morphology (IAGP)

abnormal synchondrosis (IAGP)

abnormal tegmen tympani morphology (IAGP)

abnormal temporal bone morphology (IAGP)

abnormal temporal bone squamous part morphology (IAGP)

abnormal tympanic ring morphology (IAGP)

abnormal vertebrae morphology (IAGP)

abnormal vertebral body morphology (IAGP)

abnormal vitreous body morphology (IAGP)

abnormal vomeronasal organ morphology (IAGP)

absent gonial bone (IAGP)

absent hypoglossal canal (IAGP)

absent incus (IAGP)

absent malleus (IAGP)

absent mandible (IAGP)

absent mandibular symphysis (IAGP)

absent maxilla (IAGP)

absent tympanic ring (IAGP)

absent upper incisors (IAGP)

absent vomeronasal organ (IAGP)

alisphenoid bone hypoplasia (IAGP)

bifid tongue (IAGP)

brachydactyly (IAGP)

brachyphalangia (IAGP)

cardiac edema (IAGP)

cervical vertebral fusion (IAGP)

cleft palate (IAGP)

cleft secondary palate (IAGP)

coloboma (IAGP)

decreased embryo size (IAGP)

decreased eye pigmentation (IAGP)

decreased fetal size (IAGP)

decreased neuronal precursor cell number (IAGP)

embryonic growth arrest (IAGP)

embryonic lethality during organogenesis, complete penetrance (IAGP)

embryonic lethality, complete penetrance (IAGP)

enlarged pericardium (IAGP)

failure of palatal shelf elevation (IAGP)

gonial bone hypoplasia (IAGP)

holoprosencephaly (IAGP)

impaired balance (IAGP)

increased neuronal precursor cell number (IAGP)

microphthalmia (IAGP)

midface hypoplasia (IAGP)

narrow eye opening (IAGP)

oligodactyly (IAGP)

palatal shelves fail to meet at midline (IAGP)

perinatal lethality, complete penetrance (IAGP)

polydactyly (IAGP)

postnatal lethality, incomplete penetrance (IAGP)

premature coronal suture closure (IAGP)

premaxilla hypoplasia (IAGP)

short limbs (IAGP)

short mandible (IAGP)

short maxilla (IAGP)

short Meckel's cartilage (IAGP)

short metacarpal bones (IAGP)

short metatarsal bones (IAGP)

single external naris (IAGP)

small alisphenoid bone (IAGP)

small cerebellum (IAGP)

small cranium (IAGP)

small lens (IAGP)

small parietal bone (IAGP)

styloid process hypoplasia (IAGP)

syndactyly (IAGP)

synostosis (IAGP)

thin apical ectodermal ridge (IAGP)

thin cerebellar granule layer (IAGP)

References

References - curated

#	Reference Title	Reference Citation
1.	Interactions between Hedgehog proteins and their binding partners come into view.	Beachy PA, etal., Genes Dev. 2010 Sep 15;24(18):2001-12.
2.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
3.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
4.	Mouse MP Annotation Import Pipeline	RGD automated import pipeline
5.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:1347472	PMID:1427878	PMID:1505026	PMID:2569712	PMID:3409319	PMID:8127893	PMID:8226788	PMID:8307588	PMID:8666395	PMID:8889548	PMID:9188486	PMID:9189272
PMID:9671732	PMID:9932288	PMID:10349636	PMID:10922068	PMID:10996315	PMID:10996316	PMID:11042159	PMID:11076861	PMID:11217851	PMID:11231094	PMID:11356029	PMID:11456441
PMID:11456442	PMID:11572986	PMID:11906213	PMID:11955608	PMID:12399319	PMID:12466851	PMID:12477932	PMID:14681479	PMID:15070677	PMID:15151988	PMID:15459106	PMID:15489334
PMID:15760903	PMID:16141072	PMID:16141073	PMID:16168717	PMID:16551639	PMID:16602821	PMID:17504940	PMID:17504941	PMID:17525797	PMID:18038450	PMID:18539269	PMID:18554416
PMID:18981472	PMID:19211681	PMID:19449303	PMID:19478089	PMID:21150899	PMID:21440680	PMID:21664576	PMID:21664577	PMID:21802063	PMID:21820049	PMID:21858068	PMID:21873635
PMID:22898775	PMID:23429478	PMID:23813868	PMID:24529556	PMID:24813615	PMID:24952961	PMID:25063195	PMID:25453830	PMID:25458012	PMID:25535338	PMID:25804736	PMID:26161998
PMID:26186931	PMID:26439398	PMID:26740594	PMID:26930384	PMID:27391369	PMID:27657450	PMID:27811357	PMID:28052872	PMID:28315934	PMID:28442042	PMID:28771384	PMID:28799057
PMID:28874785	PMID:29030970	PMID:29031500	PMID:29110208	PMID:29139542	PMID:29395133	PMID:30635555	PMID:31373354	PMID:31719045	PMID:32021964	PMID:32332736	PMID:33028094
PMID:33060130	PMID:34140513	PMID:34309509	PMID:34698766	PMID:34767969	PMID:34796774	PMID:35942939	PMID:36265686	PMID:36459481	PMID:36971701

Genomics

Comparative Map Data

Gas1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	13	60,322,219 - 60,325,179 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	13	60,322,219 - 60,325,179 (-)	Ensembl		GRCm39 Ensembl
GRCm38	13	60,174,405 - 60,177,535 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	13	60,174,405 - 60,177,365 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	13	60,275,766 - 60,278,896 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	13	60,184,028 - 60,186,988 (-)	NCBI		MGSCv36	mm8
Celera	13	61,235,218 - 61,238,431 (-)	NCBI		Celera
Cytogenetic Map	13	B2	NCBI
cM Map	13	31.92	NCBI

GAS1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	86,944,362 - 86,947,506 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	9	86,944,362 - 86,947,506 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	9	89,559,277 - 89,562,421 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	88,749,098 - 88,751,924 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	9	86,788,831 - 86,791,658	NCBI
Celera	9	60,128,056 - 60,130,876 (-)	NCBI		Celera
Cytogenetic Map	9	q21.33	NCBI
HuRef	9	59,383,451 - 59,386,172 (-)	NCBI		HuRef
CHM1_1	9	89,705,737 - 89,708,564 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	9	99,095,595 - 99,098,739 (-)	NCBI		T2T-CHM13v2.0

Gas1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	17	4,482,014 - 4,485,155 (+)	NCBI	mRatBN7.2	mRatBN7.2
UTH_Rnor_SHR_Utx	17	4,501,253 - 4,504,238 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	17	6,042,584 - 6,045,570 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	17	4,497,694 - 4,500,679 (+)	NCBI	Rnor_WKY
Rnor_6.0	17	4,846,116 - 4,849,350 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	4,846,789 - 4,847,940 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	17	7,072,776 - 7,075,999 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	17	4,606,730 - 4,609,964 (+)	NCBI		Celera
Cytogenetic Map	17	p14	NCBI

Gas1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955432	727,784 - 729,096 (+)	NCBI	ChiLan1.0	ChiLan1.0

GAS1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	9	52,471,996 - 52,473,168 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	9	58,079,700 - 58,082,849 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	9	86,137,630 - 86,140,170 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	9	86,139,009 - 86,140,045 (-)	Ensembl	panpan1.1		panPan2

GAS1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	72,927,346 - 72,930,119 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	72,927,670 - 72,928,827 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	73,689,084 - 73,690,386 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	73,232,667 - 73,233,972 (+)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	1	73,042,847 - 73,044,149 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	72,809,335 - 72,810,621 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	73,514,553 - 73,515,855 (+)	NCBI		UU_Cfam_GSD_1.0

GAS1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	10	28,509,261 - 28,510,301 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	10	28,509,168 - 28,511,554 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	10	32,610,336 - 32,613,309 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GAS1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	12	97,590,381 - 97,593,209 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	12	97,591,762 - 97,592,805 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	85,913,252 - 85,916,646 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gas1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624809	10,415,592 - 10,416,596 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624809	10,414,935 - 10,417,838 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Gas1
118 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	362
Count of miRNA genes:	285
Interacting mature miRNAs:	306
Transcripts:	ENSMUST00000065086
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCm39)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
26884393	Humsd7_m	humerus midshaft diameter 7, 16 week (mouse)					13	3950000	76048119	Mouse
4142147	Mvwf4_m	modifier of von Willebrand factor 4 (mouse)			Not determined			20477612	112898424	Mouse
4142009	Pregq3_m	pregnancy QTL 3 (mouse)			Not determined		13	20615512	72385189	Mouse
10401111	Pgia40_m	proteoglycan induced arthritis 40 (mouse)			Not determined		13	27918469	61918560	Mouse
1300710	Pcd4ts2_m	p-glycoprotein positive CD4 T cell subset 2 (mouse)			Not determined		13	28210442	62210544	Mouse
1357802	Vtbt15_m	vertebral trabecular bone trait 15 (mouse)			Not determined		13	28217379	62217515	Mouse
10045621	Heal21_m	wound healing/regeneration 21 (mouse)			Not determined		13	28217379	62217515	Mouse
10755533	Chol18_m	cholesterol 18 (mouse)					13	30969467	64969467	Mouse
10755517	Chol15_m	cholesterol 15 (mouse)					13	30969467	64969467	Mouse
12738439	Twq4_m	testis weight QTL 4 (mouse)					13	31129110	65129110	Mouse
14696729	Kidlq2_m	kidney weight, left QTL 2 (mouse)					13	31344736	65344736	Mouse
1301299	Sluc23_m	susceptibility to lung cancer 23 (mouse)			Not determined		13	34921943	68922081	Mouse
10412235	Scgq5_m	spontaneous crescentic glomerulonephritis QTL 5 (mouse)			Not determined		13	36060908	96239162	Mouse
1357587	Pfat3_m	predicted fat percentage 3 (mouse)			Not determined		13	36101530	70101640	Mouse
1301734	Acsns2_m	Angiostrongylus costaricensis nematode susceptibility 2 (mouse)			Not determined		13	36101530	70101640	Mouse
1300561	Heal7_m	wound healing/regeneration 7 (mouse)			Not determined		13	36144820	70144904	Mouse
1300862	Cfbw5_m	cystic fibrosis body weight 5 (mouse)			Not determined		13	38720358	72720517	Mouse
1300985	Bmd13_m	bone mineral density 13 (mouse)			Not determined		13	39629249	73629397	Mouse
1302157	Bwem2_m	body weight day 30 males 2 (mouse)			Not determined		13	39629249	73629397	Mouse
1301801	Cpfd5_m	cerebellum pattern fissures (mouse)			Not determined		13	39629249	73629397	Mouse
15039353	Nmrs35_m	NAFLD-associated magnetic resonance shift 35 (mouse)					13	40588253	74588253	Mouse
1300668	Pas10_m	pulmonary adenoma susceptibility 10 (mouse)			Not determined		13	41489042	75489158	Mouse
4142331	Bxs6_m	BXSB/MpJ autoimmune nephritis 6 (mouse)			Not determined			45210442	83744746	Mouse
10412109	Bxs7_m	BXSB/MpJ autoimmune nephritis 7 (mouse)			Not determined		13	45210442	83744746	Mouse
26884396	Humsd4_m	humerus midshaft diameter 4, 10 week (mouse)					13	47853476	73148119	Mouse
4142372	Moo2_m	modifier of Odc2 (mouse)			Not determined		X	50318411	84318559	Mouse
1301666	Eae13_m	susceptibility to experimental allergic encephalomyelitis 13 (mouse)			Not determined		13	50318411	84318559	Mouse
1300573	Elsgp2_m	elevated serum gp70 2 (mouse)			Not determined		13	50616828	84617027	Mouse
14746975	Manh74_m	mandible shape 74 (mouse)					13	52477269	86477269	Mouse
1302073	Pgct1_m	primordial germ cell tumor locus 1 (mouse)			Not determined		13	53820783	87820897	Mouse
1357563	Bmch6_m	bone mechanical trait 6 (mouse)			Not determined		13	55384980	89385140	Mouse
4142314	Tailaq3_m	tail length adjusted QTL 3 (mouse)			Not determined			55720354	112431103	Mouse
4140959	W10q17_m	weight 10 weeks QTL 17 (mouse)			Not determined			55720354	112431103	Mouse
4141992	W6q16_m	weight 6 weeks QTL 16 (mouse)			Not determined			55720354	112431103	Mouse
4142241	Tailq3_m	tail length QTL 3 (mouse)			Not determined			55720354	112431103	Mouse
1558850	Sgp3_m	serum gp70 production 3 (mouse)			Not determined		13	56470456	76971314	Mouse
10402414	Sgp5_m	serum gp70 production 5 (mouse)			Not determined		13	56470456	105422186	Mouse
1357553	Cia28_m	collagen induced arthritis 28 (mouse)			Not determined		13	56629249	96239162	Mouse
10412163	Wra1_m	wheel running activity 1 (mouse)			Not determined		13	59132600	93132738	Mouse

Markers in Region

AW554192

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	13	60,174,928 - 60,175,057	UniSTS	GRCm38
MGSCv37	13	60,276,289 - 60,276,418	UniSTS	GRCm37
Celera	13	61,235,741 - 61,235,871	UniSTS
Cytogenetic Map	13	B3-C2	UniSTS
Whitehead/MRC_RH	13	632.6	UniSTS

Gas1

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	13	60,175,029 - 60,176,042	UniSTS	GRCm38
MGSCv37	13	60,276,390 - 60,277,403	UniSTS	GRCm37
Celera	13	61,235,843 - 61,236,856	UniSTS
Cytogenetic Map	13	B3-C2	UniSTS
cM Map	13	37.0	UniSTS

Gas1

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	13	60,174,525 - 60,174,688	UniSTS	GRCm38
MGSCv37	13	60,275,886 - 60,276,049	UniSTS	GRCm37
Celera	13	61,235,338 - 61,235,501	UniSTS
Cytogenetic Map	13	B3-C2	UniSTS
cM Map	13	37.0	UniSTS

Expression

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_008086	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC124392	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AI595188	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK081311	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC055747	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC058628	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BU708456	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X65128	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	Z22668	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSMUST00000065086 ⟹ ENSMUSP00000064555

RefSeq Status:

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	13	60,322,219 - 60,325,179 (-)	Ensembl
GRCm38.p6 Ensembl	13	60,174,405 - 60,177,365 (-)	Ensembl

RefSeq Acc Id:

ENSMUST00000223933 ⟹ ENSMUSP00000153311

RefSeq Status:

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	13	60,323,601 - 60,324,755 (-)	Ensembl
GRCm38.p6 Ensembl	13	60,175,787 - 60,176,941 (-)	Ensembl

RefSeq Acc Id:

NM_008086 ⟹ NP_032112

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	13	60,322,219 - 60,325,179 (-)	NCBI
GRCm38	13	60,174,405 - 60,177,535 (-)	ENTREZGENE
MGSCv37	13	60,275,766 - 60,278,896 (-)	RGD
Celera	13	61,235,218 - 61,238,431 (-)	RGD
cM Map	13		ENTREZGENE

Sequence:

show sequence

AGCGGGCAAGCCTGGAGCGCGCGGGGCCAGGGCTCGGCGAGCCGGAGGAGCGTTGCTAATGTTT
TTGTTTGTTTGCTTTTCTATGCATGCATAATGAGGGGGCGCCGCGGCACCACACGGGGGCTCCC
GGCCCACTTTTGTATTTAAAGCCTCGCGGCGAGCTAGTCCGCAGCCGGGCTCCGCGGATCCGCT
CCCCAAGCTCCGGGTCTCGGAGCAGAGAAACGCTCCGAGTTTCGGGGTCCTCCCTGCGCCTGGC
GCCCAGAACTTCCCGGAGCGCGGCCCAGACCGGGGTAGAGGGGGAGGGGACCAAGCGTCCTGGC
CGCGGGAAGGCGGGATGCCAGAGCTGCGAAGTGCTACGCGCCGCTGAGCCGGGAACCGAGGAGC
CGCCGGCCGCACGACTGTCTGCAGGCGCCTAGCACCATGCACCCCCGGCGCCGCGCGCTCCTGC
AGCTTCGCCGCGTCCCCCCGGAACGGCACTGAGCGCCTCCAACCGTCTACCGGACCCGGACCTG
CGTCGCCGCGCTTCTCAGGGAGCCCCGGCCGCGGTGCCGGAGCGAACACCCGCCTTTACCAGCC
GCGGGGCCGCCGGCATGGATGGATGAGGACGCCCATGCCAGAAGTGCGCGGAACTCGGACAAAC
TTTTCCAGCGGCCCCGCGGCCGCCACCCGAGCCTCGTCTCCGCTCCGCACCGCGTCCGGCGGCC
GCTGCTGCCCGCGATGCTAGCCGCGCTGCTGGGCGGCGCCGGGGCCCGCACGGGGACCTTGCCG
GGCGCCTTGCTGTGCCTGATGGCGCTGCTGCAGCTGCTGTGCTCGGCACCGCGGGGCTCGGGGC
TAGCGCACGGCCGCCGCCTCATCTGCTGGCAGGCGCTGCTGCAGTGTCAGGGCGAGCCCGACTG
CAGCTACGCCTACAGCCAGTACGCCGAGGCTTGTGCGCCGGTGCTAGCGCAGCGCGGCGGGGCT
GATGCTCCGGGGCCCGCCGGCGCCTTCCCCGCCTCGGCCGCGTCCTCGCCGCGCTGGCGCTGCC
CGAGCCACTGCATCTCGGCGCTTATCCAGCTCAACCACACGCGCCGCGGGCCCGCGCTGGAGGA
CTGCGACTGCGCGCAGGACGAACACTGCAGGTCCACCAAGCGCGCCATCGAGCCCTGTCTGCCG
CGCACCAGCAGCGTGGGCCCGGGCGCGGGAGCGGGCTCGGTCATGGGCTGCACTGAGGCCCGGC
GGCGCTGCGACCGGGACAGCCGCTGCAACCTGGCGCTCAGCCGCTACCTGGCCTACTGCGGCAA
GCTTTTCAACGGGCTGCGCTGCACAGACGAGTGCCGCGCGGTCATCGAGGACATGCTGGCCGTG
CCCAAGGCGGCGCTGCTCAACGACTGCGTGTGCGATGGGCTGGAGCGGCCCATCTGCGAATCGG
TCAAAGAGAACATGGCCCGCCTGTGCTTCGGCCCAGATGCGAGCAACGGTCCGGGCAGCAGCGG
CTCGGACGGGGGCCTGGACGACTACTACGACGAAGAATATGACGACGAGCAGCGCGCTGGGGCC
GCGGGCGGCGAGCAACCCCTGGACGACGACGACGGCCTTGCGCGCCCGGGCGGCGGCGCTGCTG
CGGCGGGCGGCCGCGGAGACTTGCCCCACGGTCCCGGGCGCAGGAGCAGCAGCAGCGGCAGTGG
AGGCCACTGGGCGAATCGAAGCGCCTGGACCCCGTTTGCCTGTTTGCTGCTGCTGTTGCTCCTG
CTGCTCGGGTCACACTTGTAGCTCCTGCGCCCCTGCTGCAGGCTGCTCCAGGCCGGTATGCACG
ACCCAGCTGGTTCCCGAGCAGGGCACCTGTGGCTCGGAGACCGGAGATGGTCGGGAACACTGAC
CCACACTCTTCCTGGGTGGACAGGGCCCAGCTCGTACCGCAGCCAACATGTTCGGCCCTCTTCT
GTGCGGTTTTCCAGGCTGCAGAGATAACCGGCTGATCTATACTGCCAGCTCTAATCTGCAGAAT
TCGGGACACCCTGCAAAAGCAAAGGAGGCCTAGACTCAGAGTGCTGAACGGTGGGGGTCTTTCA
AGTTCCAATGGACTTGGAGAAGGGATGTTGAGGGAATTAGGTTTGCAAAGGGGCCGGGTTTTTA
TTTGTCTGTTTGTTTTGTTTTTAAACTGTTTTCCGGTGAGGGAACACATAGTACTGGTAACGAC
TTAAATTGCTTGTGACCACTGAGAAACACAGCAATCGTAAGTAAATAGAAAAGTTCCCCTTACC
GATTCATTCCTGTGCTCTTGGTGTATCTATCCATCGGTAATGCTCAGTGTGGAGCTGGCGATTG
CCTTTGGGGGGGGGAGGGGCTTCCCCGAAATTACAACTGCATTATATTCCTAACCCTTCACCTT
TAATTTTCCTGCCACCATTCTGATCCCTCTGCACCACGTGTCTTAGAATTAAGGATCCAAAAGA
AGAAAAAAAGTTACCATGGTGTTGAACAATGCATGTTTTTTATCCTAAAGCTCGGTACTGCCAT
CTAGGAAAACCTCTATGATGTTTGTTCTGTTGTCCTTTTTTTTTTTTCCCTCCACCAAGAAATT
CTAAATTTGAATATGCAGAGATTGAATATTACCTCTGCCCCTATCAGGGTCTTCCACCCTGGTA
CGTCGTATATAAACTGTATTAAAACTGGGGTTTCTTACCAGTTGCTGTACTTTGTATATAGAAT
TTTTTATAAATTGTATGCTTCAGAAAATAATTTATTTTTAAAAAAAGAAATTAAAAGTTTTAAA
TCTGCATCATTGTTGTATCTCCCCTATCCAAGAAATGTATAGAATACATTGGTCATGAGGAATC
CACTCCTGCAGCCCATCCAAGAAATGTATAGAATACATTGCTCACCAGGAACCCGCTCCCGCAG
CCCATTTTGAAATGTGCCCTGTGTAGAAGAATGTACAGTGTATTTTACAGATTTGAAGTAACGT
TCTTATTTTCAAGAGAATTTATGGACATTGTAGAAATGTATAAATGCATTTCCAAACTGCCTTA
AACATTGTATTTTTATAGACATCATTTTTTTAAATCCCGTGTTTAAAAAAAAAAAACTATGACT
TTGTGTATTTTTGGTTGTTTTATTAAAAATGCACACACCAGTAAAGAGTTTAAACAGTGAAAAA
AAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_032112	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH55747	(Get FASTA)	NCBI Sequence Viewer
	AAH58628	(Get FASTA)	NCBI Sequence Viewer
	CAA46256	(Get FASTA)	NCBI Sequence Viewer
	Q01721	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_032112 ⟸ NM_008086

- UniProtKB:

Q01721 (UniProtKB/Swiss-Prot), A0A286YD87 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MDEDAHARSARNSDKLFQRPRGRHPSLVSAPHRVRRPLLPAMLAALLGGAGARTGTLPGALLCL
MALLQLLCSAPRGSGLAHGRRLICWQALLQCQGEPDCSYAYSQYAEACAPVLAQRGGADAPGPA
GAFPASAASSPRWRCPSHCISALIQLNHTRRGPALEDCDCAQDEHCRSTKRAIEPCLPRTSSVG
PGAGAGSVMGCTEARRRCDRDSRCNLALSRYLAYCGKLFNGLRCTDECRAVIEDMLAVPKAALL
NDCVCDGLERPICESVKENMARLCFGPDASNGPGSSGSDGGLDDYYDEEYDDEQRAGAAGGEQP
LDDDDGLARPGGGAAAAGGRGDLPHGPGRRSSSSGSGGHWANRSAWTPFACLLLLLLLLLGSHL

hide sequence

RefSeq Acc Id:

ENSMUSP00000153311 ⟸ ENSMUST00000223933

RefSeq Acc Id:

ENSMUSP00000064555 ⟸ ENSMUST00000065086

Protein Domains

GDNF/GAS1

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q01721-F1-model_v2	AlphaFold	Q01721	1-343	view protein structure

Promoters

RGD ID:

8680570

Promoter ID:

EPDNEW_M18316

Type:

multiple initiation site

Name:

Gas1_1

Description:

Mus musculus growth arrest specific 1 , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	13	60,177,365 - 60,177,425	EPDNEW

RGD ID:

6823916

Promoter ID:

MM_KWN:14360

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day6, Brain, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen

Transcripts:

ENSMUST00000109819, NM_008086, NM_008086_GAS1

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv36	13	60,275,861 - 60,279,887 (-)	MPROMDB

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	MGI:95655	AgrOrtholog
Ensembl Genes	ENSMUSG00000052957	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Protein	ENSMUSP00000064555	ENTREZGENE
	ENSMUSP00000064555.6	UniProtKB/Swiss-Prot
	ENSMUSP00000153311.2	UniProtKB/TrEMBL
Ensembl Transcript	ENSMUST00000065086	ENTREZGENE
	ENSMUST00000065086.6	UniProtKB/Swiss-Prot
	ENSMUST00000223933.2	UniProtKB/TrEMBL
InterPro	GAS1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GDNF/GAS1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	mmu:14451	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGD	MGI:95655	ENTREZGENE
NCBI Gene	14451	ENTREZGENE
PANTHER	GROWTH ARREST-SPECIFIC PROTEIN 1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR16840	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	GDNF	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Gas1	PhenoGen
SMART	GDNF	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A286YD87	ENTREZGENE, UniProtKB/TrEMBL
	GAS1_MOUSE	UniProtKB/Swiss-Prot, ENTREZGENE
	Q7TNT6_MOUSE	UniProtKB/TrEMBL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Mammalian Phenotype

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Mammalian Phenotype