Foxc2 (forkhead box C2) - Rat Genome Database

Name: Foxc2
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Foxc2 (forkhead box C2) Mus musculus

Analyze

Symbol:

Foxc2

Name:

forkhead box C2

RGD ID:

1614461

MGI Page

MGI

Description:

Enables several functions, including DNA-binding transcription activator activity; DNA-binding transcription factor activity, RNA polymerase II-specific; and promoter-specific chromatin binding activity. Involved in several processes, including positive regulation of cell migration involved in sprouting angiogenesis; positive regulation of vascular wound healing; and regulation of transcription by RNA polymerase II. Acts upstream of or within several processes, including circulatory system development; embryonic morphogenesis; and kidney development. Predicted to be located in nuclear body. Is expressed in several structures, including cardiovascular system; central nervous system; embryo mesenchyme; limb long bone; and sensory organ. Human ortholog(s) of this gene implicated in several diseases, including lymphedema; lymphedema-distichiasis syndrome; obesity; ptosis; and type 2 diabetes mellitus. Orthologous to human FOXC2 (forkhead box C2).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

BF-3; brain factor 3; Fkh14; forkhead box protein C2; forkhead homolog 14; forkhead-related protein FKHL14; Hfhbf3; mesenchyme fork head protein 1; MFH-1; Mfh1; transcription factor FKH-14

RGD Orthologs

Human

Rat

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	FOXC2 (forkhead box C2)	HGNC	Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Foxc2 (forkhead box C2)	RGD	RGD
Pan paniscus (bonobo/pygmy chimpanzee):	FOXC2 (forkhead box C2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	FOXC2 (forkhead box C2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Foxc2 (forkhead box C2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	FOXC2 (forkhead box C2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	FOXC2 (forkhead box C2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Foxc2 (forkhead box C2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Foxc2 (forkhead box C2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	FOXC2 (forkhead box C2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	croc	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	fkh-8	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	foxc2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	121,842,910 - 121,845,634 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	121,842,910 - 121,845,634 (+)	Ensembl		GRCm39 Ensembl
GRCm38	8	121,116,171 - 121,118,895 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	121,116,171 - 121,118,895 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	123,640,071 - 123,642,795 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	124,002,560 - 124,004,872 (+)	NCBI		MGSCv36	mm8
Celera	8	125,334,251 - 125,336,975 (+)	NCBI		Celera
Cytogenetic Map	8	E1	NCBI
cM Map	8	70.33	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Cardiovascular Abnormalities (ISO)

congenital diaphragmatic hernia (ISO)

congestive heart failure (ISO)

Craniofacial Abnormalities (ISO)

eyelid disease (ISO)

genetic disease (ISO)

Hydrops Fetalis (ISO)

immunodeficiency 32B (ISO)

Insulin Resistance (ISO)

lymphedema (ISO)

lymphedema-distichiasis syndrome (ISO)

Lymphedema-Distichiasis Syndrome with Renal Disease and Diabetes Mellitus (ISO)

Musculoskeletal Abnormalities (ISO)

nephritis (ISO)

obesity (ISO)

persistent fetal circulation syndrome (ISO)

ptosis (ISO)

tetralogy of Fallot (ISO)

type 2 diabetes mellitus (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (EXP)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-hydroxypropanoic acid (ISO)

4,4'-sulfonyldiphenol (EXP)

5-aza-2'-deoxycytidine (EXP)

6-propyl-2-thiouracil (ISO)

abacavir (ISO)

acrylamide (ISO)

aflatoxin B1 (ISO)

aldrin (EXP)

all-trans-retinoic acid (ISO)

ammonium chloride (ISO)

arsenite(3-) (ISO)

belinostat (ISO)

benzo[a]pyrene (EXP,ISO)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (EXP,ISO)

bisphenol F (EXP)

C60 fullerene (ISO)

cannabidiol (ISO)

CHIR 99021 (ISO)

choline (EXP)

cocaine (ISO)

dabigatran (ISO)

DDE (ISO)

decabromodiphenyl ether (ISO)

dimethylselenide (ISO)

dioxygen (EXP)

dorsomorphin (ISO)

doxorubicin (ISO)

Doxylamine succinate (ISO)

endosulfan (ISO)

ethylene glycol (ISO)

folic acid (EXP)

genistein (EXP)

hydrazines (EXP)

hydroxyl (ISO)

isotretinoin (ISO)

L-methionine (EXP)

mercury dibromide (ISO)

methylmercury chloride (ISO)

N-nitrosodiethylamine (ISO)

nickel sulfate (EXP)

nilotinib (ISO)

nitrofen (ISO)

ozone (ISO)

panobinostat (ISO)

phenethyl caffeate (ISO)

phenylmercury acetate (ISO)

phenytoin (ISO)

pirinixic acid (EXP)

rac-lactic acid (ISO)

resveratrol (EXP)

SB 431542 (ISO)

sulforaphane (ISO)

thalidomide (ISO)

trichostatin A (ISO)

valproic acid (EXP,ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

anatomical structure morphogenesis (IBA)

apoptotic process involved in outflow tract morphogenesis (IGI)

artery morphogenesis (IMP)

blood vessel development (IGI)

blood vessel diameter maintenance (IGI)

blood vessel remodeling (IGI)

branching involved in blood vessel morphogenesis (IGI)

camera-type eye development (IMP)

cardiac muscle cell proliferation (IGI)

cell differentiation (IBA)

cell population proliferation (IMP)

collagen fibril organization (IMP)

embryonic cranial skeleton morphogenesis (IMP)

embryonic heart tube development (IGI)

embryonic skeletal system morphogenesis (IMP)

embryonic viscerocranium morphogenesis (IMP)

glomerular endothelium development (IMP)

glomerular mesangial cell development (IMP)

heart development (IGI,IMP,ISO)

heart morphogenesis (IGI)

insulin receptor signaling pathway (ISO,ISS)

kidney development (IMP)

lymph vessel development (IGI)

lymphangiogenesis (ISO,ISS)

metanephros development (IMP)

negative regulation of apoptotic process involved in outflow tract morphogenesis (IGI)

negative regulation of cold-induced thermogenesis (ISO,ISS)

negative regulation of transcription by RNA polymerase II (IDA)

neural crest cell development (IGI)

Notch signaling pathway (IGI)

ossification (IMP)

paraxial mesoderm formation (IGI)

paraxial mesodermal cell fate commitment (IMP)

podocyte differentiation (IMP)

positive regulation of cell adhesion mediated by integrin (IDA)

positive regulation of cell migration involved in sprouting angiogenesis (IDA)

positive regulation of DNA-templated transcription (IDA,ISO,ISS)

positive regulation of endothelial cell migration (IDA)

positive regulation of integrin activation (IC)

positive regulation of transcription by RNA polymerase II (IDA,IMP,ISO)

positive regulation of vascular wound healing (IDA)

regulation of DNA-templated transcription (IEA)

regulation of organ growth (IGI)

regulation of transcription by RNA polymerase II (IBA)

response to hormone (ISO,ISS)

skeletal system development (IGI,IMP)

somitogenesis (IGI)

ureteric bud development (IMP)

vascular endothelial growth factor receptor signaling pathway (IGI)

ventricular cardiac muscle tissue morphogenesis (IGI)

Cellular Component

nuclear body (ISO)

nucleoplasm (ISO)

nucleus (ISO)

Molecular Function

chromatin DNA binding (ISO,ISS)

DNA binding (IDA,ISO)

DNA-binding transcription activator activity (IDA,ISO,ISS)

DNA-binding transcription activator activity, RNA polymerase II-specific (ISO)

DNA-binding transcription factor activity (IDA,IMP)

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA,IGI)

identical protein binding (ISO)

promoter-specific chromatin binding (IDA)

protein binding (ISO)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA,ISO)

RNA polymerase II transcription regulatory region sequence-specific DNA binding (ISO)

sequence-specific DNA binding (ISO,ISS)

sequence-specific double-stranded DNA binding (ISO)

transcription cis-regulatory region binding (IDA)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

abnormal alisphenoid bone morphology (IAGP)

abnormal aortic arch morphology (IAGP)

abnormal aortic valve morphology (IAGP)

abnormal basisphenoid bone morphology (IAGP)

abnormal blood vessel morphology (IAGP)

abnormal bone ossification (IAGP)

abnormal branching involved in ureteric bud morphogenesis (IAGP)

abnormal canal of Schlemm morphology (IAGP)

abnormal cartilage morphology (IAGP)

abnormal ciliary body morphology (IAGP)

abnormal cornea morphology (IAGP)

abnormal costovertebral joint morphology (IAGP)

abnormal craniofacial bone morphology (IAGP)

abnormal dermomyotome development (IAGP)

abnormal dorsal aorta morphology (IAGP)

abnormal dorsal root ganglion morphology (IAGP)

abnormal dorsal-ventral polarity of the somites (IAGP)

abnormal eye morphology (IAGP)

abnormal fourth pharyngeal arch artery morphology (IAGP)

abnormal glomerular mesangium morphology (IAGP)

abnormal gonial bone morphology (IAGP)

abnormal head development (IAGP)

abnormal heartbeat (IAGP)

abnormal iridocorneal angle (IAGP)

abnormal iris morphology (IAGP)

abnormal iris pigment epithelium (IAGP)

abnormal lymph circulation (IAGP)

abnormal malleus morphology (IAGP)

abnormal Meckel's cartilage morphology (IAGP)

abnormal mesangial cell morphology (IAGP)

abnormal mesonephros morphology (IAGP)

abnormal middle ear ossicle morphology (IAGP)

abnormal multipotent stem cell morphology (IAGP)

abnormal muscle development (IAGP)

abnormal neural tube morphology (IAGP)

abnormal orbit morphology (IAGP)

abnormal otic vesicle development (IAGP)

abnormal palatine bone horizontal plate morphology (IAGP)

abnormal pharyngeal arch artery morphology (IAGP)

abnormal pharyngeal pouch morphology (IAGP)

abnormal podocyte morphology (IAGP)

abnormal presphenoid bone morphology (IAGP)

abnormal pterygoid process morphology (IAGP)

abnormal pulmonary valve morphology (IAGP)

abnormal renal glomerulus basement membrane morphology (IAGP)

abnormal renal glomerulus morphology (IAGP)

abnormal sclerotome morphology (IAGP)

abnormal somite development (IAGP)

abnormal somite shape (IAGP)

abnormal sphenoid bone morphology (IAGP)

abnormal subarachnoid space development (IAGP)

abnormal superior vena cava morphology (IAGP)

abnormal supraoccipital bone morphology (IAGP)

abnormal third pharyngeal arch artery morphology (IAGP)

abnormal thoracic duct morphology (IAGP)

abnormal trabecular meshwork morphology (IAGP)

abnormal vascular development (IAGP)

abnormal vertebrae development (IAGP)

abnormal vertebral arch morphology (IAGP)

abnormal vertebral body morphology (IAGP)

abnormal vertebral lamina morphology (IAGP)

abnormal vertebral pedicle morphology (IAGP)

abnormal vitelline vascular remodeling (IAGP)

absent cartilage (IAGP)

absent glomerular endothelium fenestra (IAGP)

absent incus (IAGP)

absent intervertebral disk (IAGP)

absent kidney (IAGP)

absent palatine bone (IAGP)

absent palatine bone horizontal plate (IAGP)

absent paraxial mesoderm (IAGP)

absent podocyte foot process (IAGP)

absent podocyte slit diaphragm (IAGP)

absent presphenoid bone (IAGP)

absent second pharyngeal arch (IAGP)

absent soft palate (IAGP)

absent somites (IAGP)

absent stapes (IAGP)

absent supraoccipital bone (IAGP)

aortic arch coarctation (IAGP)

atelectasis (IAGP)

blepharoptosis (IAGP)

cataract (IAGP)

cleft palate (IAGP)

cleft secondary palate (IAGP)

cornea ulcer (IAGP)

corneal abrasion (IAGP)

corneal vascularization (IAGP)

decreased angiogenesis (IAGP)

decreased body length (IAGP)

decreased embryo size (IAGP)

decreased glomerular capillary number (IAGP)

decreased renal glomerulus number (IAGP)

decreased rib number (IAGP)

decreased somite size (IAGP)

decreased tympanic ring size (IAGP)

dilated dorsal aorta (IAGP)

dilated glomerular capillary (IAGP)

dilated heart atrium (IAGP)

disorganized myocardium (IAGP)

double ureter (IAGP)

duplex kidney (IAGP)

ectopic ureteric bud (IAGP)

embryonic lethality during organogenesis, complete penetrance (IAGP)

embryonic lethality during organogenesis, incomplete penetrance (IAGP)

enlarged liver (IAGP)

enlarged lymph nodes (IAGP)

enlarged pericardium (IAGP)

enlarged third pharyngeal arch artery (IAGP)

extremity edema (IAGP)

eye opacity (IAGP)

eyelids open at birth (IAGP)

fusion of atlas and odontoid process (IAGP)

glomerulus hemorrhage (IAGP)

gonial bone hypoplasia (IAGP)

head mesenchyme hypoplasia (IAGP)

hydronephrosis (IAGP)

hydrops fetalis (IAGP)

hydroureter (IAGP)

incomplete rostral neuropore closure (IAGP)

increased brown adipose tissue amount (IAGP)

increased lymph node number (IAGP)

interrupted aortic arch (IAGP)

intracranial hemorrhage (IAGP)

iris stroma hypoplasia (IAGP)

kinked neural tube (IAGP)

lethality throughout fetal growth and development, incomplete penetrance (IAGP)

lymphangiectasis (IAGP)

lymphatic vessel hyperplasia (IAGP)

lymphedema (IAGP)

malleus hypoplasia (IAGP)

meningomyelocele (IAGP)

no abnormal phenotype detected (IAGP)

ocular distichiasis (IAGP)

pericardial edema (IAGP)

perimembraneous ventricular septal defect (IAGP)

perinatal lethality, complete penetrance (IAGP)

perinatal lethality, incomplete penetrance (IAGP)

periorbital edema (IAGP)

persistent truncus arteriosis (IAGP)

renal hypoplasia (IAGP)

rib fusion (IAGP)

short vertebral body (IAGP)

short vertebral column (IAGP)

small basioccipital bone (IAGP)

small exoccipital bone (IAGP)

small first pharyngeal arch (IAGP)

small heart (IAGP)

small interparietal bone (IAGP)

small kidney (IAGP)

small mandible (IAGP)

small Meckel's cartilage (IAGP)

small pterygoid bone (IAGP)

small temporal bone squamous part (IAGP)

small vertebral body (IAGP)

spina bifida (IAGP)

spina bifida occulta (IAGP)

spinal hemorrhage (IAGP)

thick aortic valve cusps (IAGP)

thick pulmonary valve cusps (IAGP)

thin myocardium (IAGP)

trabecula carnea hypoplasia (IAGP)

ventricle myocardium hypoplasia (IAGP)

ventricular septal defect (IAGP)

vertebral fusion (IAGP)

References

References - curated

#	Reference Title	Reference Citation
1.	The FOXC2 C-512T polymorphism is associated with obesity and dyslipidemia.	Carlsson E, etal., Obes Res. 2004 Nov;12(11):1738-43.
2.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
3.	Mouse MP Annotation Import Pipeline	RGD automated import pipeline
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:7683413	PMID:7689224	PMID:8325367	PMID:8375339	PMID:8661058	PMID:8666231	PMID:8674414	PMID:8889548	PMID:9106663	PMID:9169153	PMID:9409679	PMID:9545561
PMID:9676429	PMID:10349636	PMID:10364424	PMID:10479458	PMID:10572046	PMID:10660670	PMID:10704385	PMID:10767326	PMID:10886375	PMID:10950932	PMID:11042159	PMID:11076861
PMID:11217851	PMID:11551504	PMID:11562355	PMID:11923482	PMID:11943768	PMID:12015277	PMID:12223415	PMID:12413905	PMID:12466851	PMID:12477932	PMID:12533514	PMID:12719382
PMID:12812790	PMID:12925591	PMID:14512019	PMID:14648841	PMID:14681479	PMID:15107405	PMID:15196959	PMID:15277530	PMID:15322537	PMID:15342473	PMID:15465483	PMID:15618518
PMID:15664398	PMID:16141072	PMID:16141073	PMID:16412416	PMID:16459152	PMID:16498405	PMID:16602821	PMID:16678147	PMID:16839542	PMID:17321697	PMID:17506979	PMID:17537911
PMID:18187037	PMID:18233958	PMID:18287559	PMID:18367164	PMID:18424556	PMID:18545664	PMID:18579532	PMID:18582859	PMID:18621714	PMID:19369394	PMID:19398761	PMID:19475495
PMID:19540201	PMID:19591821	PMID:19686679	PMID:19825936	PMID:19879845	PMID:19935708	PMID:20059953	PMID:20059958	PMID:20060810	PMID:20960542	PMID:21143873	PMID:21267068
PMID:21270254	PMID:21515254	PMID:21614587	PMID:21640215	PMID:21731775	PMID:21873635	PMID:21909098	PMID:21931791	PMID:22012621	PMID:22306086	PMID:22365545	PMID:22511595
PMID:22522965	PMID:22723296	PMID:22736606	PMID:22921202	PMID:22988430	PMID:23023706	PMID:23369715	PMID:23502673	PMID:23645207	PMID:23741013	PMID:23862012	PMID:23904126
PMID:24055172	PMID:24146773	PMID:24310815	PMID:24361262	PMID:24370450	PMID:24590274	PMID:24705356	PMID:24785830	PMID:24927569	PMID:24952961	PMID:25044936	PMID:25202984
PMID:25576926	PMID:25808752	PMID:26027726	PMID:26079578	PMID:26113535	PMID:26214525	PMID:26299482	PMID:26389677	PMID:26542011	PMID:26542959	PMID:26839363	PMID:26953188
PMID:27193493	PMID:27214551	PMID:27313318	PMID:27606604	PMID:27771509	PMID:27783871	PMID:27819350	PMID:27991863	PMID:28179430	PMID:28223138	PMID:28250050	PMID:28253399
PMID:28506991	PMID:28675425	PMID:28705793	PMID:28754980	PMID:28794157	PMID:29035278	PMID:29322554	PMID:29449451	PMID:29555813	PMID:29649409	PMID:29688375	PMID:30021842
PMID:30104731	PMID:30332639	PMID:30352686	PMID:30355615	PMID:30376688	PMID:30482854	PMID:30633332	PMID:30796970	PMID:31062503	PMID:31319059	PMID:31461654	PMID:31582413
PMID:31659103	PMID:31710307	PMID:32015493	PMID:32170602	PMID:32182215	PMID:32259372	PMID:32510325	PMID:32546759	PMID:33060128	PMID:33127760	PMID:33414188	PMID:33667029
PMID:33681192	PMID:33934370	PMID:34256037	PMID:34263740	PMID:34331943	PMID:34403370	PMID:34446717	PMID:34731528	PMID:35108538	PMID:35177595	PMID:35236825	PMID:35512705
PMID:36274060	PMID:36736300

Genomics

Comparative Map Data

Foxc2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	121,842,910 - 121,845,634 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	121,842,910 - 121,845,634 (+)	Ensembl		GRCm39 Ensembl
GRCm38	8	121,116,171 - 121,118,895 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	121,116,171 - 121,118,895 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	123,640,071 - 123,642,795 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	124,002,560 - 124,004,872 (+)	NCBI		MGSCv36	mm8
Celera	8	125,334,251 - 125,336,975 (+)	NCBI		Celera
Cytogenetic Map	8	E1	NCBI
cM Map	8	70.33	NCBI

FOXC2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	86,566,829 - 86,569,728 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	16	86,566,829 - 86,569,728 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	16	86,600,435 - 86,603,334 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	85,158,443 - 85,159,948 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	16	85,158,442 - 85,159,948	NCBI
Celera	16	70,901,820 - 70,903,503 (+)	NCBI		Celera
Cytogenetic Map	16	q24.1	NCBI
HuRef	16	72,340,749 - 72,342,345 (+)	NCBI		HuRef
CHM1_1	16	88,012,585 - 88,014,267 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	16	92,635,146 - 92,638,044 (+)	NCBI		T2T-CHM13v2.0

Foxc2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	19	49,186,034 - 49,188,736 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	49,185,662 - 49,188,737 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	55,977,317 - 55,980,018 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	19	56,661,030 - 56,663,732 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	19	58,875,485 - 58,878,187 (+)	NCBI	Rnor_WKY
Rnor_6.0	19	53,044,379 - 53,047,081 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	53,044,379 - 53,047,081 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	63,788,037 - 63,790,739 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.1	1	228,513,040 - 228,513,088 (-)	NCBI
Celera	19	48,432,333 - 48,435,035 (+)	NCBI		Celera
Cytogenetic Map	19	q12	NCBI

FOXC2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	16	102,240,227 - 102,243,107 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	16	67,237,476 - 67,239,545 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	16	86,569,509 - 86,571,878 (+)	NCBI	panpan1.1	PanPan1.1	panPan2

FOXC2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	66,234,336 - 66,296,007 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	66,294,176 - 66,295,693 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	66,246,461 - 66,254,587 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	66,455,805 - 66,464,138 (-)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	5	66,479,102 - 66,487,010 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	66,314,300 - 66,322,205 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	66,727,335 - 66,735,464 (-)	NCBI		UU_Cfam_GSD_1.0

Foxc2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	26,482,456 - 26,485,324 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936641	2,236,873 - 2,238,375 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936641	2,236,224 - 2,238,501 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

FOXC2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	2,552,862 - 2,554,367 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	2,552,141 - 2,555,041 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	2,756,138 - 2,761,356 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

FOXC2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	5	71,951,980 - 71,955,021 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	5	71,952,632 - 71,954,134 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666047	3,750,917 - 3,753,843 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Foxc2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624746	2,632,619 - 2,634,085 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624746	2,632,547 - 2,634,867 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Foxc2
136 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	223
Count of miRNA genes:	199
Interacting mature miRNAs:	209
Transcripts:	ENSMUST00000054691
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCm39)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1357708	Orq1_m	ovulation rate QTL 1 (mouse)			Not determined		8	71740461	124622354	Mouse
4142023	W3q5_m	weight 3 weeks QTL 5 (mouse)			Not determined			71740461	124622354	Mouse
27095912	Pglq14_m	pelvic girdle length QTL 14, 16 week (mouse)					8	74126628	126826739	Mouse
27226796	Scvln16_m	sacral vertebrae length 2, 16 week (mouse)					8	89726628	130027694	Mouse
1357494	Obsty2_m	obesity 2 (mouse)			Not determined		8	96245241	129745061	Mouse
12880431	Fgf23lq2_m	FGF23 serum level QTL 2 (mouse)					8	97626632	130127694	Mouse
11252141	Fdr2_m	fat response to dietary restriction 2 (mouse)					8	98390634	130127694	Mouse
1301481	Lith11_m	lithogenic gene 11 (mouse)			Not determined		8	98563635	130127694	Mouse
1302105	Im1_m	Immunoregulatory 1 (mouse)			Not determined		8	99828531	130127694	Mouse
1301080	Sluc9_m	susceptibility to lung cancer 9 (mouse)			Not determined		8	99828531	130127694	Mouse
4141435	Fbtq3_m	femoral bone trait QTL 3 (mouse)			Not determined		8	100965309	130127694	Mouse
1301316	Dntcs1_m	dental caries susceptibility 1 (mouse)			Not determined		8	103443553	127781786	Mouse
11532691	Sluc38_m	susceptibility to lung cancer 38 (mouse)					8	105033977	130127694	Mouse
11532692	Sluc38a_m	susceptibility to lung cancer 38a (mouse)					8	105033977	130127694	Mouse
14746994	Manh65_m	mandible shape 65 (mouse)					8	106489629	130127694	Mouse
10412273	Fcd1_m	functional capillary density 1 (mouse)			Not determined		8	110415083	130127694	Mouse
10412274	Leci1_m	leukocyte endothelial cell interactions 1 (mouse)			Not determined		8	110415083	130127694	Mouse
12904938	Edlmmq7_m	extensor digitorum longus muscle mass QTL 7 (mouse)					8	111481497	130127694	Mouse
12904960	Gmmq6_m	gastrocnemius muscle mass QTL 6 (mouse)					8	111481497	130127694	Mouse
4141546	Mrdq3_m	modifier of retinal degeneration QTL 3 (mouse)			Not determined			114439420	126055880	Mouse
26884375	Skwq2_m	skull length QTL 2, 5 week (mouse)					8	120726739	130027694	Mouse

Markers in Region

X92499

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	8	121,118,476 - 121,118,660	UniSTS	GRCm38
MGSCv37	8	123,642,376 - 123,642,560	UniSTS	GRCm37
Celera	8	125,336,556 - 125,336,740	UniSTS
Cytogenetic Map	8	E1	UniSTS
cM Map	8	65.5	UniSTS
Whitehead/MRC_RH	8	1416.9	UniSTS

Foxc2

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	8	121,118,264 - 121,118,465	UniSTS	GRCm38
MGSCv37	8	123,642,164 - 123,642,365	UniSTS	GRCm37
Celera	8	125,336,344 - 125,336,545	UniSTS
Cytogenetic Map	8	E1	UniSTS
cM Map	8	65.5	UniSTS

Foxc2

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
Cytogenetic Map	8	E1	UniSTS

Expression

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_013519	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC127554	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AI852431	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK076319	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK146887	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC139208	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466525	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	S63607	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X74040	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X92499	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	Y08222	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSMUST00000054691 ⟹ ENSMUSP00000055290

RefSeq Status:

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	8	121,842,910 - 121,845,634 (+)	Ensembl
GRCm38.p6 Ensembl	8	121,116,171 - 121,118,895 (+)	Ensembl

RefSeq Acc Id:

NM_013519 ⟹ NP_038547

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	8	121,842,910 - 121,845,634 (+)	NCBI
GRCm38	8	121,116,171 - 121,118,895 (+)	ENTREZGENE
MGSCv37	8	123,640,071 - 123,642,795 (+)	RGD
Celera	8	125,334,251 - 125,336,975 (+)	RGD
cM Map	8		ENTREZGENE

Sequence:

show sequence

GAAACTTTTCCCAATCCCTAAAAGGGACTTTGCTTCTTTTTCCGGGCTCGGCCGCGCAGCCTCT
CCGGACCCTAGCTCGCTGACGCTGCGGGCTGCAGTTCTCCTGGCGGGGCCCCGAGAGCCGCTGT
CTCCTTTTCTAGCACTCGGAAGGGCTGGTGTCGCTCCACGGTCGCGCGTGGCGTCTGTGCCGCC
AGCTCAGGGCTGCCACCCGCCAAGCCGAGAGTGCGCGGCCAGCGGGGCCGCCTGCCGTGCACCC
TTCAGGATGCCGATCCGCCCGGTCGGCTGAACCCGAGCGCCGGCGTCTTCCGCGCGTGGACCGC
GAGGCTGCCCCGAGTCGGGGCTGCCTGCATCGCTCCGTCCCTTCCTGCTCTCCTGCTCCGGGCC
TCGCTCGCCGCGGGCCGCAGTCGGTGCGCGCAGGCGGCGACCGGGCGTCTGGGACGCAGCATGC
AGGCGCGTTACTCGGTATCGGACCCCAACGCCCTGGGAGTGGTACCCTATTTGAGTGAGCAAAA
CTACTACCGGGCGGCCGGCAGCTACGGCGGCATGGCCAGCCCCATGGGCGTCTACTCCGGCCAC
CCGGAGCAGTACGGCGCCGGCATGGGCCGCTCCTACGCGCCCTACCACCACCAGCCCGCGGCGC
CCAAGGACCTGGTGAAGCCGCCCTACAGCTATATAGCGCTCATCACCATGGCGATCCAGAACGC
GCCAGAGAAGAAGATCACTCTGAACGGCATCTACCAGTTCATCATGGACCGTTTCCCCTTCTAC
CGCGAGAACAAGCAGGGCTGGCAGAACAGCATCCGCCACAACCTGTCACTCAATGAGTGCTTCG
TGAAAGTGCCGCGCGACGACAAGAAGCCGGGCAAGGGCAGCTACTGGACGCTCGACCCGGACTC
CTACAACATGTTCGAGAATGGCAGCTTCCTGCGGCGGCGGCGGCGCTTCAAGAAGAAGGATGTG
CCCAAGGACAAGGAGGAGCGGGCCCACCTCAAGGAGCCGCCCTCGACCACGGCCAAGGGCGCTC
CGACAGGGACCCCGGTAGCTGACGGGCCCAAGGAGGCCGAGAAGAAAGTCGTGGTTAAGAGCGA
GGCGGCGTCCCCCGCGCTGCCGGTCATCACCAAGGTGGAGACGCTGAGCCCCGAGGGAGCGCTG
CAGGCCAGTCCGCGCAGCGCATCCTCCACGCCCGCAGGTTCCCCAGACGGCTCGCTGCCGGAGC
ACCACGCCGCGGCGCCTAACGGGCTGCCCGGCTTCAGCGTGGAGACCATCATGACGCTGCGCAC
GTCGCCTCCGGGCGGCGATCTGAGCCCAGCGGCCGCGCGCGCCGGCCTGGTGGTGCCACCGCTG
GCACTGCCATACGCCGCAGCGCCACCCGCCGCTTACACGCAGCCGTGCGCGCAGGGCCTGGAGG
CTGCGGGCTCCGCGGGCTACCAGTGCAGTATGCGGGCTATGAGTCTGTACACCGGGGCCGAGCG
GCCCGCGCACGTGTGCGTTCCGCCCGCGCTGGACGAGGCTCTGTCGGACCACCCGAGCGGCCCC
GGCTCCCCGCTCGGCGCCCTCAACCTCGCAGCGGGTCAGGAGGGCGCGTTGGGGGCCTCGGGTC
ACCACCACCAGCATCACGGCCACCTCCACCCGCAGGCGCCACCGCCCGCCCCGCAGCCCCCTCC
CGCGCCGCAGCCCGCCACCCAGGCCACCTCCTGGTATCTGAACCACGGCGGGGACCTGAGCCAC
CTCCCCGGCCACACGTTTGCAACCCAACAGCAAACTTTCCCCAACGTCCGGGAGATGTTCAACT
CGCACCGGCTAGGACTGGACAACTCGTCCCTCGGGGAGTCCCAGGTGAGCAATGCGAGCTGTCA
GCTGCCCTATCGAGCTACGCCGTCCCTCTACCGCCACGCAGCCCCCTACTCTTACGACTGCACC
AAATACTGAGGCTGTCCAGTCCGCTCCAGCCCCAGGACCGCACCGGCTTCGCCTCCTCCATGGG
AACCTTCTTCGACGGAGCCGCAGAAAGCGACGGAAAGCGCCCCTCTCTCAGAACCAGGAGCAGA
GAGCTCCGTGCAACTCGCAGGTAACTTATCCGCAGCTCAGTTTGAGATCTCAGCGAGTCCCTCT
AAGGGGGATGCAGCCCAGCAAAACGAAATACAGATTTTTTTTTTAATTCCTTCCCCTACCCAGA
TGCTGCGCCTGCTCCCCTTGGGGCTTCATAGATTAGCTTATGGACCAAACCCCATAGGGACCCC
TAATGACTTCTGTGGAGATTCTCCACGGGCGCAAGAGGTCTCTCCGGATAAGGTGCCTTCTGTA
AACGAGTGCGGATTTGTAACCAGGCTATTTTGTTCTTGCCCAGAGCCTTTAATATAATATTTAA
AGTTGTGTCCACTGGATAAGGTTTCGTCTTGCCCAACTGTTACTGCCAAATTGAATTCAAGAAA
CGTGTGTGGGTCTTTTCTCCCCACGTCACCATGATAAAATAGGTCCCTCCCCAAACTGTAGGTC
TTTTACAAAACAAGAAAATAATTTATTTTTTTGTTGTTGTTGGATAACGAAATTAAGTATCGGA
TACTTTTAATTTAGGAAGTGCATGGCTTTGTACAGTAGATGCCATCTGGGGTATTCCAAAAACA
CACCAAAAGACTTTAAAATTTCAATCTCACCTGTGTTTGTCTTATGTGATCTCAGTGTTGTATT
TACCTTAAAATAAACCCGTGTTGTTTTTCTGCCCAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_038547	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB27463	(Get FASTA)	NCBI Sequence Viewer
	AAI39209	(Get FASTA)	NCBI Sequence Viewer
	BAC36298	(Get FASTA)	NCBI Sequence Viewer
	CAA52192	(Get FASTA)	NCBI Sequence Viewer
	CAA63244	(Get FASTA)	NCBI Sequence Viewer
	CAA69399	(Get FASTA)	NCBI Sequence Viewer
	EDL11653	(Get FASTA)	NCBI Sequence Viewer
	Q61850	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_038547 ⟸ NM_013519

- UniProtKB:

Q8C694 (UniProtKB/Swiss-Prot), Q61850 (UniProtKB/Swiss-Prot), B9EI61 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MQARYSVSDPNALGVVPYLSEQNYYRAAGSYGGMASPMGVYSGHPEQYGAGMGRSYAPYHHQPA
APKDLVKPPYSYIALITMAIQNAPEKKITLNGIYQFIMDRFPFYRENKQGWQNSIRHNLSLNEC
FVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDVPKDKEERAHLKEPPSTTAKG
APTGTPVADGPKEAEKKVVVKSEAASPALPVITKVETLSPEGALQASPRSASSTPAGSPDGSLP
EHHAAAPNGLPGFSVETIMTLRTSPPGGDLSPAAARAGLVVPPLALPYAAAPPAAYTQPCAQGL
EAAGSAGYQCSMRAMSLYTGAERPAHVCVPPALDEALSDHPSGPGSPLGALNLAAGQEGALGAS
GHHHQHHGHLHPQAPPPAPQPPPAPQPATQATSWYLNHGGDLSHLPGHTFATQQQTFPNVREMF
NSHRLGLDNSSLGESQVSNASCQLPYRATPSLYRHAAPYSYDCTKY

hide sequence

RefSeq Acc Id:

ENSMUSP00000055290 ⟸ ENSMUST00000054691

Protein Domains

Fork-head

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q61850-F1-model_v2	AlphaFold	Q61850	1-494	view protein structure

Promoters

RGD ID:

8668479

Promoter ID:

EPDNEW_M12270

Type:

initiation region

Name:

Foxc2_1

Description:

Mus musculus forkhead box C2 , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	8	121,116,171 - 121,116,231	EPDNEW

RGD ID:

6843168

Promoter ID:

MM_KWN:55960

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

3T3L1_Day0, 3T3L1_Day2, Kidney, Lung, MEF_B4, MEF_B6, Spleen

Transcripts:

NM_013519, UC009NRR.1

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv36	8	123,639,366 - 123,641,517 (+)	MPROMDB

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	MGI:1347481	AgrOrtholog
Ensembl Genes	ENSMUSG00000046714	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Protein	ENSMUSP00000055290	ENTREZGENE
	ENSMUSP00000055290.7	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000054691	ENTREZGENE
	ENSMUST00000054691.8	UniProtKB/Swiss-Prot
Gene3D-CATH	1.10.10.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	Fork_head_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	FOXC1/C2-like_FH	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TF_fork_head_CS_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TF_fork_head_CS_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	WH-like_DNA-bd_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	WH_DNA-bd_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	mmu:14234	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGD	MGI:1347481	ENTREZGENE
NCBI Gene	14234	ENTREZGENE
PANTHER	FORKHEAD BOX PROTEIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	FORKHEAD BOX PROTEIN C2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Forkhead	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Foxc2	PhenoGen
PRINTS	FORKHEAD	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	FORK_HEAD_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	FORK_HEAD_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	FORK_HEAD_3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	SM00339	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF46785	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	B9EI61	ENTREZGENE, UniProtKB/TrEMBL
	FOXC2_MOUSE	UniProtKB/Swiss-Prot, ENTREZGENE
	Q8C694	ENTREZGENE
UniProt Secondary	P97948	UniProtKB/Swiss-Prot
	Q63869	UniProtKB/Swiss-Prot
	Q8C694	UniProtKB/Swiss-Prot

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Mammalian Phenotype

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Mammalian Phenotype