Advanced Search (OLGA)

Gene: Gpr183 (G protein-coupled receptor 183) Rattus norvegicus

Analyze

Symbol:

Gpr183

Name:

G protein-coupled receptor 183

RGD ID:

1598095

Description:

Predicted to enable G protein-coupled receptor activity and oxysterol binding activity. Predicted to be involved in several processes, including dendritic cell homeostasis; leukocyte chemotaxis; and leukocyte differentiation. Predicted to be located in nucleoplasm and plasma membrane. Orthologous to human GPR183 (G protein-coupled receptor 183); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; acetamide; alpha-Zearalanol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Ebi2; EBV-induced G-protein coupled receptor 2; Epstein-Barr virus induced gene 2 (lymphocyte-specific G protein-coupled receptor); epstein-Barr virus-induced G-protein coupled receptor 2; G-protein coupled receptor 183; LOC679975; similar to EBV-induced G-protein coupled receptor 2 (EBI2)

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GPR183 (G protein-coupled receptor 183)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Gpr183 (G protein-coupled receptor 183)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Gpr183 (G protein-coupled receptor 183)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GPR183 (G protein-coupled receptor 183)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GPR183 (G protein-coupled receptor 183)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Gpr183 (G protein-coupled receptor 183)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GPR183 (G protein-coupled receptor 183)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GPR183 (G protein-coupled receptor 183)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Gpr183 (G protein-coupled receptor 183)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Gpr183 (G protein-coupled receptor 183)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	GPR183 (G protein-coupled receptor 183)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	GPR183 (G protein-coupled receptor 183)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	gpr183a (G protein-coupled receptor 183a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	gpr183a (G protein-coupled receptor 183a)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	gpr183b (G protein-coupled receptor 183b)	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	gpr183b (G protein-coupled receptor 183b)	Alliance	DIOPT (InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	gpr183.2	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	gpr183.2	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Allele / Splice:

Gpr183^em2Mcwi ; Gpr183^em1Mcwi ; Gpr183^em3Mcwi

Genetic Models:

SS-Gpr183^em3Mcwi ; SS-Gpr183^em1Mcwi ; SS-Gpr183^em2Mcwi

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	105,445,129 - 105,457,192 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	15	105,437,561 - 105,466,977 (-)	Ensembl				GRCr8
mRatBN7.2	15	99,037,764 - 99,050,550 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	99,036,367 - 99,050,559 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	15	102,972,724 - 102,984,243 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	15	104,064,748 - 104,076,273 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	15	100,992,568 - 101,004,093 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	15	108,364,701 - 108,376,221 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	108,364,701 - 108,376,221 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	15	111,751,148 - 111,763,869 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	15	107,056,367 - 107,067,887 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	15	97,811,478 - 97,823,000 (-)	NCBI		Celera
Cytogenetic Map	15	q25	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

adult T-cell leukemia/lymphoma (ISO)

Anal Atresia, Hypospadias, and Penoscrotal Inversion (ISO)

holoprosencephaly (ISO)

holoprosencephaly 5 (ISO)

IgA glomerulonephritis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2-hydroxypropanoic acid (ISO)

4-hydroxynon-2-enal (ISO)

4-hydroxyphenyl retinamide (ISO)

acetamide (EXP)

albendazole (ISO)

alpha-Zearalanol (EXP)

antirheumatic drug (ISO)

arotinoid acid (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

buta-1,3-diene (ISO)

butyric acid (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

cannabidiol (ISO)

carbon nanotube (ISO)

CHIR 99021 (ISO)

chloroprene (ISO)

cisplatin (ISO)

cortisol (ISO)

crocidolite asbestos (ISO)

Cuprizon (EXP)

diarsenic trioxide (ISO)

dimethylarsinic acid (ISO)

diquat (ISO)

doxorubicin (ISO)

entinostat (ISO)

ethyl methanesulfonate (ISO)

ferric oxide (ISO)

fulvestrant (ISO)

furan (EXP)

GSK-J4 (ISO)

HC toxin (ISO)

irinotecan (ISO)

ivermectin (ISO)

L-ascorbic acid (ISO)

L-ascorbic acid 2-phosphate (ISO)

lead diacetate (EXP)

lipopolysaccharide (ISO)

methotrexate (ISO)

methyl methanesulfonate (ISO)

methylarsonic acid (ISO)

methylisothiazolinone (ISO)

mocetinostat (ISO)

Muraglitazar (EXP)

nickel atom (ISO)

ozone (ISO)

panobinostat (ISO)

paracetamol (ISO)

pioglitazone (ISO)

rac-lactic acid (ISO)

rosuvastatin calcium (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

sunitinib (ISO)

tacedinaline (ISO)

Tesaglitazar (EXP)

thioacetamide (EXP)

titanium dioxide (EXP)

trichloroethene (EXP)

trichostatin A (ISO)

triclosan (ISO)

trimellitic anhydride (ISO)

troglitazone (EXP)

tunicamycin (ISO)

valproic acid (ISO)

vorinostat (ISO)

XAV939 (ISO)

zinc atom (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adaptive immune response (IEA,ISO,ISS)

B cell activation involved in immune response (IBA)

biological_process (ND)

cell chemotaxis (ISO)

dendritic cell chemotaxis (ISO,ISS)

dendritic cell homeostasis (ISO,ISS)

G protein-coupled receptor signaling pathway (IEA,ISO,ISS)

humoral immune response (ISO)

immune system process (IEA)

leukocyte chemotaxis (ISO,ISS)

mature B cell differentiation involved in immune response (ISO)

osteoclast differentiation (ISO,ISS)

positive regulation of B cell proliferation (ISO,ISS)

positive regulation of ERK1 and ERK2 cascade (ISO,ISS)

regulation of astrocyte chemotaxis (ISO,ISS)

signal transduction (IEA)

T cell chemotaxis (ISO,ISS)

T follicular helper cell differentiation (ISO,ISS)

Cellular Component

membrane (IEA)

nucleoplasm (ISO)

plasma membrane (IEA,ISO,ISS)

Molecular Function

G protein-coupled receptor activity (IBA,IEA,ISO,ISS)

oxysterol binding (IEA,ISO,ISS)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
3.	Comprehensive gene review and curation	RGD comprehensive gene curation

Additional References at PubMed

PMID:18628402	PMID:19597478	PMID:21673108	PMID:21796211	PMID:21796212	PMID:22875855	PMID:22930711	PMID:23502855	PMID:23682316	PMID:24678947	PMID:25297897	PMID:25348153
PMID:26438360	PMID:27147029

Genomics

Comparative Map Data

Gpr183
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	105,445,129 - 105,457,192 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	15	105,437,561 - 105,466,977 (-)	Ensembl				GRCr8
mRatBN7.2	15	99,037,764 - 99,050,550 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	99,036,367 - 99,050,559 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	15	102,972,724 - 102,984,243 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	15	104,064,748 - 104,076,273 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	15	100,992,568 - 101,004,093 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	15	108,364,701 - 108,376,221 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	108,364,701 - 108,376,221 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	15	111,751,148 - 111,763,869 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	15	107,056,367 - 107,067,887 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	15	97,811,478 - 97,823,000 (-)	NCBI		Celera
Cytogenetic Map	15	q25	NCBI

GPR183
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	13	99,294,539 - 99,307,399 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	13	99,294,539 - 99,307,399 (-)	Ensembl			hg38	GRCh38
GRCh37	13	99,946,793 - 99,959,653 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	13	98,744,790 - 98,757,695 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	13	98,744,790 - 98,757,695	NCBI
Celera	13	80,790,353 - 80,803,314 (-)	NCBI		Celera
Cytogenetic Map	13	q32.3	NCBI
HuRef	13	80,541,169 - 80,554,130 (-)	NCBI		HuRef
CHM1_1	13	99,916,965 - 99,929,926 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	13	98,504,775 - 98,517,640 (-)	NCBI		T2T-CHM13v2.0

Gpr183
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	14	122,189,743 - 122,202,605 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	14	122,189,963 - 122,202,607 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	14	121,952,331 - 121,965,193 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	14	121,952,551 - 121,965,195 (-)	Ensembl			mm10	GRCm38
MGSCv37	14	122,351,553 - 122,364,415 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	14	121,087,511 - 121,100,373 (-)	NCBI		MGSCv36	mm8
Celera	14	120,513,847 - 120,526,678 (-)	NCBI		Celera
Cytogenetic Map	14	E5	NCBI
cM Map	14	65.86	NCBI

Gpr183
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955404	11,264,954 - 11,277,531 (+)	Ensembl
ChiLan1.0	NW_004955404	11,264,954 - 11,277,531 (+)	NCBI	ChiLan1.0	ChiLan1.0

GPR183
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	14	100,818,658 - 100,837,495 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	13	99,485,636 - 99,498,792 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	13	80,461,908 - 80,475,046 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	13	99,600,695 - 99,613,671 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	13	99,601,220 - 99,602,305 (-)	Ensembl			panPan2	panpan1.1

GPR183
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	22	49,332,665 - 49,347,721 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	22	49,333,188 - 49,347,593 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	22	49,113,865 - 49,128,934 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	22	49,773,993 - 49,789,040 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	22	49,774,006 - 49,789,026 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	22	49,425,293 - 49,440,355 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	22	49,459,634 - 49,474,711 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	22	49,495,775 - 49,510,831 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Gpr183
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	184,753,026 - 184,765,923 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936472	11,186,267 - 11,198,832 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936472	11,196,567 - 11,198,890 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GPR183
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	11	68,231,224 - 68,245,751 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	11	68,231,851 - 68,248,627 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	11	75,527,987 - 75,529,869 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GPR183
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	3	77,952,689 - 77,966,317 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	3	77,953,212 - 77,954,297 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666046	34,448,232 - 34,461,198 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	185
Count of miRNA genes:	134
Interacting mature miRNAs:	146
Transcripts:	ENSRNOT00000034560
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1549844	Bss7	Bone structure and strength QTL 7	6.4		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	15	82194914	108192169	Rat
2300326	Plaw1	Placental weight QTL 1	15	0.005	placenta mass (VT:0004257)	placenta wet weight (CMO:0002088)	15	74735564	106469153	Rat
2298549	Neuinf12	Neuroinflammation QTL 12	3.5		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	15	61710951	106710951	Rat
1358354	Srcrt5	Stress Responsive Cort QTL 5	3.38		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	15	82503470	108192169	Rat
1641889	Colcr6	Colorectal carcinoma resistance QTL 6	2.9	0.0126	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	15	83700787	108192169	Rat
70155	Gcs1	Gastric cancer susceptibility QTL1	3.8		stomach morphology trait (VT:0000470)	stomach tumor susceptibility score (CMO:0002043)	15	82714037	106778197	Rat
2313080	Bss65	Bone structure and strength QTL 65	3.9	0.0001	long bone metaphysis morphology trait (VT:0000133)	tibia midshaft total cross-sectional area (CMO:0001715)	15	67399137	108192169	Rat
2317055	Aia10	Adjuvant induced arthritis QTL 10	3.41		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	15	82194914	108192169	Rat
631655	Bp126	Blood pressure QTL 126	4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	15	64571127	108192169	Rat
7411646	Foco21	Food consumption QTL 21	23.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	15	84278281	108192169	Rat

Markers in Region

D15Rat27

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	15	99,043,148 - 99,043,291 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	108,368,891 - 108,369,033	NCBI	Rnor6.0
Rnor_5.0	15	111,756,447 - 111,756,589	UniSTS	Rnor5.0
RGSC_v3.4	15	107,060,557 - 107,060,699	UniSTS	RGSC3.4
RGSC_v3.4	15	107,060,381 - 107,060,711	RGD	RGSC3.4
Celera	15	97,815,670 - 97,815,812	UniSTS
RGSC_v3.1	15	107,076,337 - 107,076,479	RGD
RH 3.4 Map	15	706.5	RGD
RH 3.4 Map	15	706.5	UniSTS
RH 2.0 Map	15	609.8	RGD
SHRSP x BN Map	15	66.4899	RGD
FHH x ACI Map	15	74.04	RGD
Cytogenetic Map	15	q25	UniSTS

Genetic Models

This gene Gpr183 is modified in the following models/strains:

SS-Gpr183^em3Mcwi SS-Gpr183^em1Mcwi SS-Gpr183^em2Mcwi

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	164	91	90	59	92	59	6	355	191	11	143	81	91	31	16	16

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001109386	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039093645	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC129791	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473951	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000015	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000034560 ⟹ ENSRNOP00000035137

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	15	105,444,348 - 105,449,284 (-)	Ensembl
mRatBN7.2 Ensembl	15	99,037,613 - 99,050,559 (-)	Ensembl
Rnor_6.0 Ensembl	15	108,364,701 - 108,376,221 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000098097 ⟹ ENSRNOP00000097517

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	15	105,437,561 - 105,466,977 (-)	Ensembl
mRatBN7.2 Ensembl	15	99,036,367 - 99,050,559 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000122520 ⟹ ENSRNOP00000106344

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	15	105,443,856 - 105,457,571 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000153084 ⟹ ENSRNOP00000110942

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	15	105,443,099 - 105,460,540 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000155187 ⟹ ENSRNOP00000104804

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	15	105,444,278 - 105,460,540 (-)	Ensembl

RefSeq Acc Id:

NM_001109386 ⟹ NP_001102856

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	105,445,606 - 105,457,126 (-)	NCBI
mRatBN7.2	15	99,038,959 - 99,050,479 (-)	NCBI
Rnor_6.0	15	108,364,701 - 108,376,221 (-)	NCBI
Rnor_5.0	15	111,751,148 - 111,763,869 (-)	NCBI
RGSC_v3.4	15	107,056,367 - 107,067,887 (-)	RGD
Celera	15	97,811,478 - 97,823,000 (-)	RGD

Sequence:

show sequence

CAGTCTGGGCAAACACAGACGGCCACCTTGGAGGCTCTAGCCACCCTCTGATACTAACTCTGAC
CACTGCGGATACAGAAATGGCTAACAATTTTACTACACCACTGGCAGCTTCTCACGGCAATAAC
TGTGATCTCTATGCACACCACAGCACGGCCAGGATATTAATGCCTCTGCATTATAGCCTGGTCT
TCATCATTGGTCTGGTGGGAAACTTGTTGGCCTTAGTTGTCATTGTTCAAAATAGAAAAAAAAT
CAACTCAACCACTCTCTATTCAATGAACTTGGTGATTTCCGACATCCTGTTTACCACAGCTTTA
CCTACGCGGATAGTCTACTATGCCCTGGGTTTTGACTGGAGGATTGGTGATGCCCTGTGCCGGA
TAACTGCTCTGTTGTTCTACATCAACACGTATGCAGGTGTGAACTTCATGACTTGTTTGAGCAT
AGACCGATTCTTTGCCGTGGTGCACCCTCTGCGCTACAACAAGATTAAAAGAATTGAATATGCA
AAGGGCATTTGTGTATTTGTCTGGATTTTGGTGTTTGCTCAAACACTGCCACTGCTCCTCAAAC
CCATGTCTAAGCAGGAGGCAGACAAGACTACTTGCATGGAATATCCAAATTTTGAAGGGACAGC
ATCTCTCCCGTGGATTCTGCTCGGAGCCTGCCTGCTAGGCTACGTGCTGCCTCTTGCCATCATT
CTCCTGTGCTACTCTCAGATCTGCTGCAAACTCTTCAGGACTGCCAAGCAGAACCCACTGACCG
AGAAATCTGGTGTGAACAAAAAGGCTCTCAACACGATCATCCTCATCATCGGCGTGTTCGTCTT
GTGCTTCACGCCCTACCACGTGGCCATTATGCAGCACATGGTGAAGACTCTCTACGCCCCCGGA
GCCCTCGGCTGTGGGGTGAGACACTCCTTCCAGATCTCTCTGCACTTCACAGTGTGCCTGATGA
ACTTCAACTGCTGCATGGACCCTTTCATATACTTCTTTGCATGTAAAGGGTACAAGAGAAAGGT
CATGAAGATGCTCAAACGTCAAGTGAGCGTGTCAATCTCCAGTGCAGTGAGGTCAGCCCCTGAG
GAGAACTCACGGGAAATGACGGAGTCACAGATGATGATCCACTCCAAGGCCTCCAATGGGAGGT
AAAGGTGCTTGGGCCCTCACAGCACAGCAAGCTGCAGGGCAGGCGGGCTCTGCCTACCAACTGT
TCTGCTCCCAACCAGGATGCCTTCCAGTTGTCCTCTCTGGGCAGGACTACCCACTGCCACCTCA
CCAGCCAGCGCACTGACATCCAGACCAGACCAAGGAAACAGCAAAAGCAAGTTCTACTTCATAA
ATGAAACAGAATATACAAAGGAAGGCTATCGTAATACGTCTCCATGTAAAAAGAAATGCTGTGT
GAAATTACCATTTCTTGCCAATAGCGTGGCAAAAGAAAGAAGACTGATTGCACTGTATATATTG
CCAGTGTAAAAATGTTAATACTCTAATATATGTAACATATTTCCTAATTTACACCTTTCACTTT

hide sequence

RefSeq Acc Id:

XM_039093645 ⟹ XP_038949573

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	105,445,129 - 105,457,192 (-)	NCBI
mRatBN7.2	15	99,037,764 - 99,050,550 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001102856	(Get FASTA)	NCBI Sequence Viewer
	XP_038949573	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	D4A7K7	(Get FASTA)	NCBI Sequence Viewer
	EDM02572	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000035137.3
	ENSRNOP00000097517.1
	ENSRNOP00000104804
	ENSRNOP00000110942

RefSeq Acc Id:

NP_001102856 ⟸ NM_001109386

- UniProtKB:

D4A7K7 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MANNFTTPLAASHGNNCDLYAHHSTARILMPLHYSLVFIIGLVGNLLALVVIVQNRKKINSTTL
YSMNLVISDILFTTALPTRIVYYALGFDWRIGDALCRITALLFYINTYAGVNFMTCLSIDRFFA
VVHPLRYNKIKRIEYAKGICVFVWILVFAQTLPLLLKPMSKQEADKTTCMEYPNFEGTASLPWI
LLGACLLGYVLPLAIILLCYSQICCKLFRTAKQNPLTEKSGVNKKALNTIILIIGVFVLCFTPY
HVAIMQHMVKTLYAPGALGCGVRHSFQISLHFTVCLMNFNCCMDPFIYFFACKGYKRKVMKMLK
RQVSVSISSAVRSAPEENSREMTESQMMIHSKASNGR

hide sequence

Ensembl Acc Id:

ENSRNOP00000035137 ⟸ ENSRNOT00000034560

RefSeq Acc Id:	XP_038949573 ⟸ XM_039093645
- Peptide Label:	isoform X1
- UniProtKB:	D4A7K7 (UniProtKB/Swiss-Prot)

Ensembl Acc Id:

ENSRNOP00000097517 ⟸ ENSRNOT00000098097

Ensembl Acc Id:

ENSRNOP00000110942 ⟸ ENSRNOT00000153084

Ensembl Acc Id:

ENSRNOP00000106344 ⟸ ENSRNOT00000122520

Ensembl Acc Id:

ENSRNOP00000104804 ⟸ ENSRNOT00000155187

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4A7K7-F1-model_v2	AlphaFold	D4A7K7	1-357	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13699881

Promoter ID:

EPDNEW_R10405

Type:

multiple initiation site

Name:

Gpr183_1

Description:

G protein-coupled receptor 183

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	15	108,376,220 - 108,376,280	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1598095	AgrOrtholog
BioCyc Gene	G2FUF-12364	BioCyc
Ensembl Genes	ENSRNOG00000025094	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000034560.4	UniProtKB/Swiss-Prot
	ENSRNOT00000098097.1	UniProtKB/Swiss-Prot
	ENSRNOT00000153084	ENTREZGENE
	ENSRNOT00000155187	ENTREZGENE
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/Swiss-Prot
InterPro	GP183-like	UniProtKB/Swiss-Prot
	GPCR_Rhodpsn	UniProtKB/Swiss-Prot
	GPCR_Rhodpsn_7TM	UniProtKB/Swiss-Prot
KEGG Report	rno:679975	UniProtKB/Swiss-Prot
NCBI Gene	679975	ENTREZGENE
PANTHER	G-PROTEIN COUPLED RECEPTOR	UniProtKB/Swiss-Prot
	G-PROTEIN COUPLED RECEPTOR 183	UniProtKB/Swiss-Prot
Pfam	7tm_1	UniProtKB/Swiss-Prot
PhenoGen	Gpr183	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/Swiss-Prot
	P2YPURNOCPTR	UniProtKB/Swiss-Prot
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/Swiss-Prot
	G_PROTEIN_RECEP_F1_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000025094	RatGTEx
SMART	7TM_GPCR_Srsx	UniProtKB/Swiss-Prot
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/Swiss-Prot
UniProt	D4A7K7	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-08-27	Gpr183	G protein-coupled receptor 183	Ebi2	Epstein-Barr virus induced gene 2 (lymphocyte-specific G protein-coupled receptor)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-05	Ebi2	Epstein-Barr virus induced gene 2 (lymphocyte-specific G protein-coupled receptor)	LOC679975	similar to EBV-induced G-protein coupled receptor 2 (EBI2)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-01-09	LOC679975	similar to EBV-induced G-protein coupled receptor 2 (EBI2)	LOC686966	similar to EBV-induced G-protein coupled receptor 2 (EBI2)	Data merged from RGD:1591255	1643240	APPROVED
2006-11-20	LOC679975	similar to EBV-induced G-protein coupled receptor 2 (EBI2)			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-20	LOC686966	similar to EBV-induced G-protein coupled receptor 2 (EBI2)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD