Advanced Search (OLGA)

Gene: Tmem253 (transmembrane protein 253) Rattus norvegicus

Analyze

Symbol:

Tmem253

Name:

transmembrane protein 253

RGD ID:

1597322

Description:

Predicted to be located in membrane. Orthologous to human TMEM253 (transmembrane protein 253); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; acrylamide; bisphenol A.

Type:

protein-coding

RefSeq Status:

MODEL

Previously known as:

hypothetical protein LOC690368; LOC690368

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	TMEM253 (transmembrane protein 253)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):	Tmem253 (transmembrane protein 253)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Tmem253 (transmembrane protein 253)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	TMEM253 (transmembrane protein 253)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	TMEM253 (transmembrane protein 253)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Tmem253 (transmembrane protein 253)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	TMEM253 (transmembrane protein 253)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	TMEM253 (transmembrane protein 253)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Tmem253 (transmembrane protein 253)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	MRPS14 (mitochondrial ribosomal protein S14)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Tmem253 (transmembrane protein 253)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	TMEM253 (transmembrane protein 253)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	si:dkey-30c15.13	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	si:dkey-30c15.13	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	27,180,029 - 27,182,607 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	15	27,179,740 - 27,183,056 (+)	Ensembl				GRCr8
mRatBN7.2	15	24,706,517 - 24,709,107 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	24,706,529 - 24,708,625 (+)	Ensembl				mRatBN7.2
Rnor_6.0	15	28,413,414 - 28,416,039 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	28,413,461 - 28,415,554 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	15	32,221,865 - 32,226,503 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	15	27,445,186 - 27,447,282 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	15	25,011,020 - 25,013,645 (+)	NCBI		Celera
Cytogenetic Map	15	p14	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Brain-Lung-Thyroid Syndrome (ISO)

purine nucleoside phosphorylase deficiency (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

2,3,7,8-tetrachlorodibenzodioxine (EXP)

acrylamide (EXP)

aflatoxin B1 (ISO)

aristolochic acid A (ISO)

benzo[b]fluoranthene (ISO)

bisphenol A (EXP,ISO)

cisplatin (ISO)

diquat (ISO)

epoxiconazole (ISO)

gentamycin (EXP)

hexamethylene diisocyanate (ISO)

iron dichloride (ISO)

lipopolysaccharide (ISO)

okadaic acid (ISO)

paracetamol (EXP)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

sodium arsenite (ISO)

urethane (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Cellular Component

membrane (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Genomics

Comparative Map Data

Tmem253
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	27,180,029 - 27,182,607 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	15	27,179,740 - 27,183,056 (+)	Ensembl				GRCr8
mRatBN7.2	15	24,706,517 - 24,709,107 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	24,706,529 - 24,708,625 (+)	Ensembl				mRatBN7.2
Rnor_6.0	15	28,413,414 - 28,416,039 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	28,413,461 - 28,415,554 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	15	32,221,865 - 32,226,503 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	15	27,445,186 - 27,447,282 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	15	25,011,020 - 25,013,645 (+)	NCBI		Celera
Cytogenetic Map	15	p14	NCBI

TMEM253
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	14	21,098,836 - 21,103,724 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	14	21,098,811 - 21,103,724 (+)	Ensembl			hg38	GRCh38
GRCh37	14	21,566,995 - 21,571,883 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	14	20,639,343 - 20,641,723 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	14	1,427,654 - 1,432,447 (+)	NCBI		Celera
Cytogenetic Map	14	q11.2	NCBI
HuRef	14	1,687,284 - 1,692,081 (+)	NCBI		HuRef
CHM1_1	14	21,568,829 - 21,573,619 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	14	15,296,249 - 15,301,137 (+)	NCBI		T2T-CHM13v2.0

Tmem253
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	14	52,252,309 - 52,257,244 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	14	52,253,115 - 52,257,251 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	14	52,014,852 - 52,019,787 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	14	52,015,658 - 52,019,794 (+)	Ensembl			mm10	GRCm38
MGSCv37	14	52,636,540 - 52,639,462 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	14	50,938,816 - 50,941,740 (+)	NCBI		MGSCv36	mm8
Celera	14	48,996,770 - 48,999,666 (+)	NCBI		Celera
Cytogenetic Map	14	C2	NCBI
cM Map	14	26.77	NCBI

Tmem253
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955550	1,862,719 - 1,866,822 (+)	Ensembl
ChiLan1.0	NW_004955550	1,862,781 - 1,867,230 (+)	NCBI	ChiLan1.0	ChiLan1.0

TMEM253
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	15	22,550,226 - 22,554,472 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	14	21,766,747 - 21,770,959 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	14	1,913,655 - 1,917,874 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

TMEM253
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	15	18,187,622 - 18,194,700 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	15	18,187,616 - 18,193,427 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	15	18,671,660 - 18,685,505 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	15	18,447,013 - 18,460,567 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	15	18,450,237 - 18,452,076 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	15	18,128,293 - 18,142,133 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	15	18,184,255 - 18,198,096 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	15	18,312,210 - 18,326,061 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Tmem253
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	32,393,443 - 32,398,684 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936880	304,740 - 306,616 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936880	302,889 - 307,007 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TMEM253
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	78,030,446 - 78,032,537 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	7	77,991,665 - 78,033,146 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

TMEM253
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	29	21,573,831 - 21,577,932 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	29	21,574,780 - 21,576,691 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666059	24,858,547 - 24,860,919 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tmem253
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624825	7,095,542 - 7,097,636 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624825	7,093,627 - 7,098,746 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Variants

Variants in Tmem253
1 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	64
Count of miRNA genes:	53
Interacting mature miRNAs:	54
Transcripts:	ENSRNOT00000060521
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331729	Rf42	Renal function QTL 42	3.071		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	15	17362897	73690657	Rat
1641887	Alcrsp14	Alcohol response QTL 14			response to alcohol trait (VT:0010489)	brain neurotensin receptor 1 density (CMO:0002068)	15	1	42356671	Rat
10755503	Bp391	Blood pressure QTL 391	2.37		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	15	20248600	37896129	Rat
1578646	Bmd18	Bone mineral density QTL 18	5.2		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	15	22806240	98288169	Rat
9589149	Insul29	Insulin level QTL 29	9.06	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	15	1	34723002	Rat
1578647	Bmd17	Bone mineral density QTL 17	4		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	15	22806240	98288169	Rat
10401805	Kidm51	Kidney mass QTL 51			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	15	306329	45306329	Rat
2317750	Glom26	Glomerulus QTL 26	4.3		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	15	12496141	65205939	Rat
2298549	Neuinf12	Neuroinflammation QTL 12	3.5		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	15	1	55302115	Rat
8552920	Pigfal8	Plasma insulin-like growth factor 1 level QTL 8	3		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	15	1	34723002	Rat
2293688	Bss29	Bone structure and strength QTL 29	5.31	0.0001	femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	15	11111142	56111142	Rat
5685002	Bss103	Bone structure and strength QTL 103	2.8		tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	15	14481165	28469888	Rat
8694361	Abfw6	Abdominal fat weight QTL 6	10.2	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	15	1	34723002	Rat
631273	Lecl2	Lens clarity QTL 2		0.001	lens clarity trait (VT:0001304)	age of onset/diagnosis of cataract (CMO:0001584)	15	10596089	55596089	Rat
2300167	Bmd63	Bone mineral density QTL 63	5.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	15	11111142	56111142	Rat
731170	Pur3	Proteinuria QTL 3	2.3	0.0005	urine protein amount (VT:0005160)	urine protein excretion rate (CMO:0000759)	15	1	41686771	Rat
738017	Hcas7	Hepatocarcinoma susceptibility QTL 7	2.91		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464)	15	2266368	46921453	Rat
10054130	Srcrt8	Stress Responsive Cort QTL 8	2.18	0.0085	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	15	22117933	67117933	Rat
2300173	Bmd62	Bone mineral density QTL 62	12.8	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	15	11111142	56111142	Rat
2324620	Coatc3	Coat color QTL 3			coat/hair pigmentation trait (VT:0010463)	pigmented coat/hair area to total coat/hair area ratio (CMO:0001810)	15	19856566	46187442	Rat
61424	Scl1	Serum cholesterol level QTL 1	7.7	0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	15	16725528	80672115	Rat
1582251	Gluco24	Glucose level QTL 24	3.2	0.0008	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	15	5530756	50530756	Rat
1354657	Despr13	Despair related QTL 13		0.0022	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	15	1	29912054	Rat
631550	Bw7	Body weight QTL 7	3.6		body mass (VT:0001259)	body weight (CMO:0000012)	15	19856566	34924750	Rat
1578660	Bss19	Bone structure and strength QTL 19	4.3		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	15	22806240	98288169	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	36	86	66	65	35	54	35	5	239	119	9	67	61	67	30	16	16

Sequence

Nucleotide Sequences


RefSeq Transcripts	XM_006221929	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006251919	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC129736	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000015	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000060521 ⟹ ENSRNOP00000057264

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	15	27,179,740 - 27,182,861 (+)	Ensembl
mRatBN7.2 Ensembl	15	24,706,529 - 24,708,625 (+)	Ensembl
Rnor_6.0 Ensembl	15	28,413,461 - 28,415,554 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000101358 ⟹ ENSRNOP00000081194

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	15	27,179,740 - 27,183,056 (+)	Ensembl
mRatBN7.2 Ensembl	15	24,706,529 - 24,708,555 (+)	Ensembl

RefSeq Acc Id:

XM_006251919 ⟹ XP_006251981

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	27,180,029 - 27,182,607 (+)	NCBI
mRatBN7.2	15	24,706,517 - 24,709,107 (+)	NCBI
Rnor_6.0	15	28,413,414 - 28,416,039 (+)	NCBI
Rnor_5.0	15	32,221,865 - 32,226,503 (+)	NCBI

Sequence:

show sequence

AATGAGCTTTTCCAATCCAGGAAATACCTGTTACAGCCAAGTGAGCGATGGATCAAAATGTTGA
TCAGCCAAGGCAGGAGGAGCCCAGCCTTCGCCTGGAAAAACTACAACACTGGGCAAAACGCAGG
CACAGTGGACATCTACTGGTGCTGGCGGTGAGCCAACTATGGCTGGCAATAGCTGTGGTCCCCT
TTACTCTCTCGGTTTCCTGCTTGAACTCTGCCTGTCACCTGGCCACAGTGCTGCCACTTTGGCC
TGGAGCCTCGGGTCTCCTCACTGGCATCGTTACCCTTGAATTTCGAAGAGCACCTTGCATCTGG
AAGGTGCGGGCCATGATGATATCCAACACCTTGAACCTGATCTTGGGCTTCATTGCGGTGGTGA
TGGAGGTGATCAAGACAGCCTTGGGGACTGCCTCTGCTGACTCCTCCCAGTCGACAGGGTTGCT
GGTGCTAGAGCTCAGCGCCGAGGCCTTCACCCTAGGGGGAGTGCTGTTCTCAACATACGCTCTA
TTCTTGCTGAGCCAGAGGAAGCCTGGATCCTTCAAGAAGTCAAGGCTGCAGTACCAGGAGCTAC
AGGAGGGTCTCTCTGAGGTGGAGGAGGTTTCTGGTTTGGAGAATGATCCCGTGGTGGCTAGCAC
AGGAAATAGAACGGAGGAGTGAGTGGGAAAGACAGGTGCCACTGTCCTCCTACGCCAAGGGGAG
TATCTCCAGGCACTTCTGCATCGTGCACCTCTCTTGGACTATAACTGGACTCCCCCAAGATGTG
CATGAAGCCCAAAGGAGTGTTCTCAGTTTCCCCTCAAACCAGGCCCATTTCTCTTCTCTTCTCC
ATTAGAGGAAGATAATCTCTGGACTAGAGACCTCCCTCACCTCACTCCTTGTCAAGCAGCTTCT
TTCCTTGCATTCTTCGCCTTCTTCCTCCCTGCCTCTCCATCCAGCTTCACGTCTGCCTCATCTC
ACTGTTCACCTTTCACAATCCCATCCACTCCAAGCCCGGCTGCTGCACCAGCCAACCCAGAATC
CGCGTCGGTTGTGCTCCAGGTCTCCCTTGGATCCGGGTCCTGCCTAATTTACCAGACTACAAAT
CCCAGGATGCCCCGCTACCCCGTGACCTACTGCAAAATAAAGAGCCTTCCCTCGGC

hide sequence

Protein Sequences


Protein RefSeqs	XP_006251981	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000057264
	ENSRNOP00000057264.1
	ENSRNOP00000081194.1

RefSeq Acc Id:

XP_006251981 ⟸ XM_006251919

- UniProtKB:

D4ACQ1 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MDQNVDQPRQEEPSLRLEKLQHWAKRRHSGHLLVLAVSQLWLAIAVVPFTLSVSCLNSACHLAT
VLPLWPGASGLLTGIVTLEFRRAPCIWKVRAMMISNTLNLILGFIAVVMEVIKTALGTASADSS
QSTGLLVLELSAEAFTLGGVLFSTYALFLLSQRKPGSFKKSRLQYQELQEGLSEVEEVSGLEND
PVVASTGNRTEE

hide sequence

Ensembl Acc Id:

ENSRNOP00000057264 ⟸ ENSRNOT00000060521

Ensembl Acc Id:

ENSRNOP00000081194 ⟸ ENSRNOT00000101358

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4ACQ1-F1-model_v2	AlphaFold	D4ACQ1	1-204	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1597322	AgrOrtholog
BioCyc Gene	G2FUF-13996	BioCyc
Ensembl Genes	ENSRNOG00000039489	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000060521	ENTREZGENE
	ENSRNOT00000060521.3	UniProtKB/TrEMBL
	ENSRNOT00000101358.1	UniProtKB/TrEMBL
InterPro	TMEM253	UniProtKB/TrEMBL
KEGG Report	rno:690368	UniProtKB/TrEMBL
NCBI Gene	690368	ENTREZGENE
PANTHER	PTHR37359	UniProtKB/TrEMBL
	TRANSMEMBRANE PROTEIN 253	UniProtKB/TrEMBL
PhenoGen	Tmem253	PhenoGen
RatGTEx	ENSRNOG00000039489	RatGTEx
UniProt	A0A8I6G7N0_RAT	UniProtKB/TrEMBL
	D4ACQ1	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2012-11-07	Tmem253	transmembrane protein 253	LOC690368	hypothetical protein LOC690368	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-01-09	LOC690368	hypothetical protein LOC690368	LOC686761	hypothetical protein LOC686761	Data merged from RGD:1593701	1643240	APPROVED
2006-11-20	LOC690368	hypothetical protein LOC690368			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-20	LOC686761	hypothetical protein LOC686761			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar