Lyrm7 (LYR motif containing 7) - Rat Genome Database

Name: Lyrm7
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Advanced Search (OLGA)

Gene: Lyrm7 (LYR motif containing 7) Rattus norvegicus

Analyze

Symbol:

Lyrm7

Name:

LYR motif containing 7

RGD ID:

1596391

Description:

Predicted to enable protein folding chaperone. Predicted to be involved in cellular respiration and mitochondrial respiratory chain complex III assembly. Predicted to be located in mitochondrial membrane. Predicted to be active in mitochondrial matrix. Human ortholog(s) of this gene implicated in mitochondrial complex III deficiency nuclear type 8. Orthologous to human LYRM7 (LYR motif containing 7); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; bisphenol A; gentamycin.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

complex III assembly factor LYRM7; hypothetical protein LOC686506; LOC686506; LYR motif-containing protein 7; MGC188005

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	LYRM7 (LYR motif containing 7)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB
Mus musculus (house mouse):	Lyrm7 (LYR motif containing 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Lyrm7 (LYR motif containing 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	LYRM7 (LYR motif containing 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	LYRM7 (LYR motif containing 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Lyrm7 (LYR motif containing 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	LYRM7 (LYR motif containing 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	LYRM7 (LYR motif containing 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Lyrm7 (LYR motif containing 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	LYRM7 (LYR motif containing 7)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Lyrm7 (LYR motif containing 7)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	lyrm7 (LYR motif containing 7)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	MZM1	Alliance	DIOPT (Hieranoid\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	CG34150	Alliance	DIOPT (Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	lyrm7	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	39,465,019 - 39,483,973 (-)	NCBI		GRCr8
mRatBN7.2	10	38,964,299 - 38,983,628 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	38,964,311 - 38,983,601 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	43,652,949 - 43,671,938 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	43,143,040 - 43,162,029 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	38,646,749 - 38,665,739 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	40,183,061 - 40,201,992 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	40,183,078 - 40,201,992 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	39,955,356 - 39,974,260 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	40,246,614 - 40,265,653 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	10	38,302,508 - 38,321,410 (-)	NCBI		Celera
Cytogenetic Map	10	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

familial adenomatous polyposis 1 (ISO)

genetic disease (ISO)

Hereditary Neoplastic Syndromes (ISO)

mitochondrial complex III deficiency nuclear type 1 (ISO)

mitochondrial complex III deficiency nuclear type 8 (ISO)

Neurodevelopmental Disorders (ISO)

systemic primary carnitine deficiency disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

antirheumatic drug (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (EXP,ISO)

crotonaldehyde (ISO)

cyclosporin A (ISO)

DDE (ISO)

dexamethasone (ISO)

Dibutyl phosphate (ISO)

diquat (ISO)

enzyme inhibitor (ISO)

folic acid (ISO)

genistein (ISO)

gentamycin (EXP)

indometacin (ISO)

lead diacetate (ISO)

manganese(II) chloride (EXP)

Mesaconitine (EXP)

methyl methanesulfonate (ISO)

methylmercury chloride (ISO)

N(4)-hydroxycytidine (ISO)

N-methyl-4-phenylpyridinium (EXP)

paracetamol (EXP)

perfluorooctane-1-sulfonic acid (ISO)

potassium dichromate (ISO)

resveratrol (ISO)

sodium arsenite (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

triphenyl phosphate (ISO)

triptonide (ISO)

valproic acid (ISO)

zinc protoporphyrin (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular respiration (ISO)

mitochondrial respiratory chain complex III assembly (IBA,IEA,ISO)

protein folding (IEA)

Cellular Component

mitochondrial matrix (IBA,IEA,ISO)

mitochondrial membrane (ISO)

mitochondrion (ISO)

Molecular Function

protein binding (ISO)

protein folding chaperone (IBA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:18614015	PMID:23168492	PMID:34800366

Genomics

Comparative Map Data

Lyrm7
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	39,465,019 - 39,483,973 (-)	NCBI		GRCr8
mRatBN7.2	10	38,964,299 - 38,983,628 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	38,964,311 - 38,983,601 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	43,652,949 - 43,671,938 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	43,143,040 - 43,162,029 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	38,646,749 - 38,665,739 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	40,183,061 - 40,201,992 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	40,183,078 - 40,201,992 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	39,955,356 - 39,974,260 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	40,246,614 - 40,265,653 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	10	38,302,508 - 38,321,410 (-)	NCBI		Celera
Cytogenetic Map	10	q22	NCBI

LYRM7
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	131,170,944 - 131,205,428 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	131,170,944 - 131,205,428 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	5	130,506,637 - 130,541,121 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	130,534,540 - 130,569,018 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	5	126,637,021 - 126,671,498 (+)	NCBI		Celera
Cytogenetic Map	5	q23.3-q31.1	NCBI
HuRef	5	125,697,670 - 125,732,168 (+)	NCBI		HuRef
CHM1_1	5	129,939,626 - 129,974,083 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	5	131,689,921 - 131,724,424 (+)	NCBI		T2T-CHM13v2.0

Lyrm7
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	54,717,692 - 54,751,738 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	54,717,692 - 54,751,742 (-)	Ensembl		GRCm39 Ensembl
GRCm38	11	54,826,866 - 54,860,921 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	54,826,866 - 54,860,916 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	54,652,791 - 54,674,093 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	54,670,291 - 54,704,339 (-)	NCBI		MGSCv36	mm8
Celera	11	59,426,595 - 59,447,857 (-)	NCBI		Celera
Cytogenetic Map	11	B1.3	NCBI
cM Map	11	32.13	NCBI

Lyrm7
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955408	2,684,060 - 2,707,400 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955408	2,684,390 - 2,707,400 (+)	NCBI	ChiLan1.0	ChiLan1.0

LYRM7
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	4	126,494,615 - 126,529,249 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	5	124,634,179 - 124,668,813 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	126,599,521 - 126,629,796 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	132,767,112 - 132,797,421 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	132,767,112 - 132,797,409 (+)	Ensembl	panpan1.1		panPan2

LYRM7
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	11	19,560,143 - 19,585,350 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	11	19,560,250 - 19,584,881 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	11	18,358,049 - 18,382,832 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	11	20,338,845 - 20,363,869 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	11	20,338,979 - 20,364,148 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	11	19,067,199 - 19,092,228 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	11	18,913,354 - 18,938,854 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	11	19,512,810 - 19,538,097 (+)	NCBI		UU_Cfam_GSD_1.0

Lyrm7
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	116,809,518 - 116,835,030 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936647	3,812,284 - 3,837,732 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936647	3,812,284 - 3,837,754 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

LYRM7
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	133,480,080 - 133,514,659 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	133,480,083 - 133,683,881 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	138,829,293 - 138,849,571 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

LYRM7
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	23	34,030,526 - 34,060,030 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	23	34,031,308 - 34,058,783 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666034	43,905,954 - 43,935,324 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Lyrm7
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624733	40,868,569 - 40,890,107 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624733	40,711,143 - 40,939,867 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Lyrm7
105 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	292
Count of miRNA genes:	182
Interacting mature miRNAs:	212
Transcripts:	ENSRNOT00000075311
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61441	Btemp1	Thermal response to stress QTL 1	4		body temperature trait (VT:0005535)	core body temperature (CMO:0001036)	10	35392457	63642539	Rat
9589136	Insul27	Insulin level QTL 27	10.46	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	10	11474010	56474010	Rat
152025229	Scl83	Serum cholesterol level QTL 83	4.33		blood cholesterol amount (VT:0000180)		10	35710580	68663659	Rat
1578779	Tcas10	Tongue tumor susceptibility QTL 10	3.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	10	31297439	76297439	Rat
631564	Apr3	Acute phase response QTL 3	3.9		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	10	15275955	60275955	Rat
1298069	Bp168	Blood pressure QTL 168	5.5		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	10	26521957	98003205	Rat
631554	Bp133	Blood pressure QTL 133		0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	743364	63851208	Rat
631557	Bp136	Blood pressure QTL 136		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	30632053	75632053	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
1578761	Stresp21	Stress response QTL 21	3.3		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	6375746	51375746	Rat
2298544	Neuinf9	Neuroinflammation QTL 9	4.6		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	10	5801990	62146030	Rat
61332	Eau3	Experimental allergic uveoretinitis QTL 3		0.004	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	10	34490559	45579777	Rat
10401803	Kidm50	Kidney mass QTL 50			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	10	418344	45418344	Rat
1554317	Bmd4	Bone mineral density QTL 4	9.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	19816042	99406971	Rat
1598852	Anxrr19	Anxiety related response QTL 19	5.07		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	10	18167841	63167841	Rat
1581497	Esta1	Estrogen-induced thymic atrophy QTL 1			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	21329805	61345413	Rat
2313095	Bss62	Bone structure and strength QTL 62	1.5	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	5387014	50387014	Rat
724527	Bp148	Blood pressure QTL 148		0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	28453136	73453136	Rat
1358897	Stresp6	Stress response QTL 6	4.17	0.022	blood norepinephrine amount (VT:0005663)	plasma norepinephrine level (CMO:0001010)	10	35392267	64155584	Rat
1331762	Rf40	Renal function QTL 40	3.873		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	10	29299504	64155584	Rat
2300171	Bmd58	Bone mineral density QTL 58	4.9	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	26944628	71944628	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14487011	89062041	Rat
2303118	Mamtr7	Mammary tumor resistance QTL 7		0.003	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	9658275	104670812	Rat
2313104	Bss61	Bone structure and strength QTL 61	0.9	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	10	5387014	50387014	Rat
9590310	Scort19	Serum corticosterone level QTL 19	6.3	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
10402859	Bp381	Blood pressure QTL 381		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14487011	107057807	Rat
6893352	Bw100	Body weight QTL 100	0.33	0.6	body mass (VT:0001259)	body weight (CMO:0000012)	1	15906665	60906665	Rat
724556	Pur2	Proteinuria QTL 2	5.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	22427500	90627625	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6154182	73453136	Rat
2313066	Bss63	Bone structure and strength QTL 63	1.4	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	10	5387014	50387014	Rat
2313064	Bmd71	Bone mineral density QTL 71	0.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	10	5387014	50387014	Rat
70223	Bp57	Blood pressure QTL 57	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	1	80676123	Rat
1354587	Kidm21	Kidney mass QTL 21	3.3		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	10	15028513	60430477	Rat
6893350	Bw99	Body weight QTL 99	0.87	0.16	body mass (VT:0001259)	body weight (CMO:0000012)	1	15906665	60906665	Rat
2317043	Aia7	Adjuvant induced arthritis QTL 7	3.82		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	10	37565079	82565079	Rat
70224	Eae3	Experimental allergic encephalomyelitis QTL 3	4.1		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	10	26521957	61345413	Rat
2317042	Aia20	Adjuvant induced arthritis QTL 20	3.38		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	10	37565079	82565079	Rat
2313081	Bss64	Bone structure and strength QTL 64	1.3	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	10	5387014	50387014	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29299504	107211142	Rat
2313087	Bmd80	Bone mineral density QTL 80	3.2	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	10	19606483	64606483	Rat
1354614	Hpcl1	Hepatic cholesterol level QTL 1	3.3		liver cholesterol amount (VT:0010498)	liver cholesterol level (CMO:0001597)	10	35392267	51793994	Rat
631532	Cm50	Cardiac mass QTL 50	6.6		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	10	17907113	51786432	Rat
1576319	Cia29	Collagen induced arthritis QTL 29			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	33973921	78973921	Rat
7411611	Foco17	Food consumption QTL 17	18.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	10	1	42315980	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
1600371	Mcs21	Mammary carcinoma susceptibility QTL 21	3		mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	28875650	52200160	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14487011	104060283	Rat
9590268	Scort13	Serum corticosterone level QTL 13	3.26	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
1576311	Pia26	Pristane induced arthritis QTL 26			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	31224026	75632053	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6357896	96121100	Rat
2292441	Bp308	Blood pressure QTL 308			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
2313055	Bw96	Body weight QTL 96	3.6	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	10	19606483	64606483	Rat
631542	Bp82	Blood pressure QTL 82	6.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	26521957	98952741	Rat

Markers in Region

RH141003

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	38,965,473 - 38,965,657 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	40,184,224 - 40,184,407	NCBI	Rnor6.0
Rnor_5.0	10	39,956,519 - 39,956,702	UniSTS	Rnor5.0
RGSC_v3.4	10	40,247,777 - 40,247,960	UniSTS	RGSC3.4
Celera	10	38,303,671 - 38,303,854	UniSTS
RH 3.4 Map	10	405.19	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001134729	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC168191	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000075311 ⟹ ENSRNOP00000065804

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	38,964,311 - 38,983,601 (-)	Ensembl
Rnor_6.0 Ensembl	10	40,183,078 - 40,201,992 (-)	Ensembl

RefSeq Acc Id:

NM_001134729 ⟹ NP_001128201

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	39,465,019 - 39,483,973 (-)	NCBI
mRatBN7.2	10	38,964,311 - 38,983,263 (-)	NCBI
Rnor_6.0	10	40,183,061 - 40,201,992 (-)	NCBI
Rnor_5.0	10	39,955,356 - 39,974,260 (-)	NCBI
RGSC_v3.4	10	40,246,614 - 40,265,653 (-)	RGD
Celera	10	38,302,508 - 38,321,410 (-)	RGD

Sequence:

show sequence

GTCAGCGGCGTGGGCAGCCATGGGTCAGCCAGCCAAGGTTTTACAGCTCTTTAAAACACTGCAC
AGGACCAGACAACAAGTTTTTAAAAACGATAAGAGGGCATTGGAAGCAGCCAGAGTAAAGATAA
ACGAAGAATTCAAAAAACATAAAAACGAGACATCTCCAGAGAAAATAAAAGAGATGCTGAAAAT
AGGTTCTGATGTTGAATTATTGCTCAGAACATCTGTTATTCAAGGAATCCACACTGACCACGAC
ACACTGCAACTGGTCCCCAGGAAAGATCTTCTTACAGAAAATGTGCCGTACTGTGATGCACCAA
CCCAGAAGCTGTAAAGCTTCCAGGATAAAACCCGCCTCTGCTCCTTCCCACTTTAAATATATGC
CTGGCAAAGTCCTGATGCACATGATTCTCTGTGAAGCGGCACGTTGCAAATGAGCGGCAGGCTG
AGGGCTACAGAGCACTGCCATGCTCTGAGGACATAGACGTGCGTGTCACTGACAGGCAGCCCTT
ACGGGCGACTGAATGCTTGGGGAGGTGGGACACCCTCTCTTTCCCTTTGGTAGGTGTTTTGGTC
TTACCAAAGCTGTTTGCGGATGAAGCACTTTACCAAGTTGGTGACTTTTCATCTCATGGGAAAC
ACACCTGCTAAATATAAAATGCTACATTAGATGGATGTTTAATCCCCAAAATGTTGGTAAAAAA
ATTAACATTTTTCCGCCAGCTCTCTACTGAAAGCAGCCATTGTTTCCCAAAGTCCCGTGGTTAT
TTCTGTGGCAGACAAGTAATTATGTAGTGTATTTCTCGGCATTCTTATGAAGACAACTCTCCCC
TTTCTGTTTTGTATGCATGGGTGTTTTGCCTGCATAAATGTCTATGCAGTGTGTGTGTGCAGTG
CCTGCAGAGGTCAGGAGAGGGTATTGGATCCCCTGGAGTTATAGATGGTCACGAGTTTCCTAGA
AGAGCAACCAGTGCTCTAAAGTACTGAGCTCTCTCTAGCCCCTATAAAGTCATTTTAAACAGTC
TTCTGAAGTTAGATAGATGAAATATCAAAGTAACTCTGGGCCACTATAGAATAAGACATCCTAA
CATTTTTAGGAAGTAGTGGCCCTCTGTCAGGTGGCTGTGGTCTTCATAGAATTAGCTGTATTTA
GTTTACAGTTAGACTTTACTGAGAGGTGCTGTAGATGACCAAATTCTCTTTCTCCCCCACCCCT
GTCTCTTTCTCTCTCTCCCTCTTTCCCTCTCTCCCTCTCTCCCTCTCCCACTCTCCCTCCCTCC
GTCTCCTTCTCTCCCTCTCTTTTGAGACAGGATCTCCCTGTGCCGTCCTAGCCTTGAACTCTCA
GATCCAATTGCCTCTGCCCCCCCAGTGCTTTACATAATCTGATCTCCAGTGCTCCAAATAGATA
AACATAGTAATAATAATTGGACTTTATCACAGTTAAAAACATTTGCATAACTATTAGTGAACAA
TTTCAGATGAGGTGATGTCTGTCATATATCTGATGACTTTATACAATATATGTTACCAGGGATG
TAAAAAGAGTTATCAGACCATATAAAGAACTTCAAGTATAAGAAAGCAAGCAGGGGCTGAGACT
GCTCAGAGGTCAACAACTCTGCTCTTCCTTAGGACCTGAGTTCAGTTCCTAGAACCCTTGTCAG
GTAACTCCATCTCCAGGGGATCCAGTGCCCTCTACTGGCCTCCGAGGGCACTGCATCATAAGTA
TAAACTCAAACCAACAGTAACATACATACACATAATAAAGAAATCTTGAAGCAAGCAACAATTA
AAAAAAATTAAAACAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001128201	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI68191	(Get FASTA)	NCBI Sequence Viewer
	B4F7A1	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000065804.2

RefSeq Acc Id:	NP_001128201 ⟸ NM_001134729
- UniProtKB:	B4F7A1 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MGQPAKVLQLFKTLHRTRQQVFKNDKRALEAARVKINEEFKKHKNETSPEKIKEMLKIGSDVEL LLRTSVIQGIHTDHDTLQLVPRKDLLTENVPYCDAPTQKL hide sequence

Ensembl Acc Id:

ENSRNOP00000065804 ⟸ ENSRNOT00000075311

Protein Domains

Complex 1 LYR protein

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B4F7A1-F1-model_v2	AlphaFold	B4F7A1	1-104	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13697190

Promoter ID:

EPDNEW_R7715

Type:

multiple initiation site

Name:

Lyrm7_1

Description:

LYR motif containing 7

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	10	40,201,992 - 40,202,052	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1596391	AgrOrtholog
BioCyc Gene	G2FUF-25099	BioCyc
Ensembl Genes	ENSRNOG00000045961	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000075311.2	UniProtKB/TrEMBL
InterPro	Complex1_LYR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Complex1_LYR_LYRM7	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	MZM1/LYRM7	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:686506	UniProtKB/Swiss-Prot
NCBI Gene	686506	ENTREZGENE
PANTHER	COMPLEX III ASSEMBLY FACTOR LYRM7	UniProtKB/Swiss-Prot
	COMPLEX III ASSEMBLY FACTOR LYRM7	UniProtKB/Swiss-Prot
	COMPLEX III ASSEMBLY FACTOR LYRM7	UniProtKB/TrEMBL
	COMPLEX III ASSEMBLY FACTOR LYRM7	UniProtKB/TrEMBL
Pfam	Complex1_LYR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Lyrm7	PhenoGen
RatGTEx	ENSRNOG00000045961	RatGTEx
UniProt	A0A8L2QWZ4_RAT	UniProtKB/TrEMBL
	B4F7A1	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2012-10-02	Lyrm7	LYR motif containing 7	Lyrm7	LYR motif containing 7	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-10-02	Lyrm7	LYR motif containing 7	LOC686506	hypothetical protein LOC686506	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-20	LOC686506	hypothetical protein LOC686506			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM