Advanced Search (OLGA)

Gene: Zdhhc17 (zinc finger DHHC-type palmitoyltransferase 17) Rattus norvegicus

Analyze

Symbol:

Zdhhc17

Name:

zinc finger DHHC-type palmitoyltransferase 17

RGD ID:

1595790

Description:

Predicted to enable identical protein binding activity; protein-cysteine S-palmitoyltransferase activity; and signaling receptor binding activity. Predicted to be involved in several processes, including lipoprotein transport; peptidyl-L-cysteine S-palmitoylation; and regulation of signal transduction. Predicted to be located in Golgi membrane and Golgi-associated vesicle membrane. Predicted to be active in glutamatergic synapse; perforant pathway to dendrate granule cell synapse; and postsynaptic Golgi apparatus. Orthologous to human ZDHHC17 (zinc finger DHHC-type palmitoyltransferase 17); INTERACTS WITH 6-propyl-2-thiouracil; amitrole; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

acyltransferase ZDHHC17; acyltransferase ZDHHC7; LOC366889; membrane-associated DHHC17 zinc finger protein; palmitoyltransferase ZDHHC17; zinc finger DHHC domain-containing protein 17; zinc finger, DHHC domain containing 17; zinc finger, DHHC-type containing 17

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ZDHHC17 (zinc finger DHHC-type palmitoyltransferase 17)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):	Zdhhc17 (zinc finger, DHHC domain containing 17)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Zdhhc17 (zDHHC palmitoyltransferase 17)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ZDHHC17 (zDHHC palmitoyltransferase 17)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ZDHHC17 (zinc finger DHHC-type palmitoyltransferase 17)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Zdhhc17 (zDHHC palmitoyltransferase 17)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ZDHHC17 (zinc finger DHHC-type palmitoyltransferase 17)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ZDHHC17 (zDHHC palmitoyltransferase 17)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Zdhhc17 (zDHHC palmitoyltransferase 17)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	ACTR1A (actin related protein 1A)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	ZDHHC17 (zinc finger DHHC-type palmitoyltransferase 17)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Zdhhc17 (zinc finger, DHHC domain containing 17)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	zdhhc17 (zinc finger, DHHC-type containing 17)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	AKR1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Hip14	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	dhhc-13	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	dhhc-14	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	AKR2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	zdhhc17	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	48,256,269 - 48,320,000 (-)	NCBI		GRCr8
mRatBN7.2	7	46,369,963 - 46,433,691 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	46,369,988 - 46,433,764 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	48,271,200 - 48,333,114 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	50,474,329 - 50,536,243 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	50,252,059 - 50,313,974 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	53,651,529 - 53,715,007 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	53,653,116 - 53,714,879 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	53,662,715 - 53,726,527 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	49,933,342 - 49,995,838 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	7	43,177,128 - 43,238,754 (-)	NCBI		Celera
Cytogenetic Map	7	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Huntington's disease (ISS)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

3,4-methylenedioxymethamphetamine (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-diaminodiphenylmethane (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

amitrole (EXP)

aristolochic acid A (ISO)

arsenite(3-) (ISO)

beta-lapachone (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP)

bisphenol F (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

CGP 52608 (ISO)

coumestrol (ISO)

dexamethasone (ISO)

Dibutyl phosphate (ISO)

dicrotophos (ISO)

ethanol (ISO)

folic acid (ISO)

gentamycin (EXP)

gold atom (ISO)

gold(0) (ISO)

hydralazine (ISO)

indometacin (ISO)

ivermectin (ISO)

methidathion (ISO)

N-methyl-4-phenylpyridinium (EXP)

perfluorooctane-1-sulfonic acid (ISO)

resveratrol (ISO)

sodium arsenite (ISO)

temozolomide (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

triptonide (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

axonogenesis (IBA,IEA,ISO,ISS)

lipoprotein transport (IEA,ISO)

peptidyl-L-cysteine S-palmitoylation (ISO)

positive regulation of canonical NF-kappaB signal transduction (ISO)

protein palmitoylation (ISO,ISS)

regulation of ERK1 and ERK2 cascade (IEA,ISO,ISS)

regulation of modification of synapse structure, modulating synaptic transmission (IEA,ISO)

regulation of neurotrophin TRK receptor signaling pathway (IEA,ISO,ISS)

regulation of programmed cell death (IEA,ISO)

Cellular Component

cell projection (IEA)

cytoplasmic vesicle (IEA)

cytoplasmic vesicle membrane (IEA)

glutamatergic synapse (IEA,ISO)

Golgi apparatus (IEA,ISO,ISS)

Golgi membrane (IEA,ISO)

Golgi-associated vesicle membrane (IEA,ISO)

intracellular membrane-bounded organelle (IEA,ISO)

membrane (IEA)

perforant pathway to dendrate granule cell synapse (IEA,ISO)

plasma membrane (IEA)

postsynaptic Golgi apparatus (IEA,ISO)

presynaptic membrane (IEA)

synapse (IEA)

Molecular Function

acyltransferase activity (IEA)

identical protein binding (IEA,ISO)

palmitoyltransferase activity (IEA,ISO,ISS)

protein binding (ISO)

protein-cysteine S-myristoyltransferase activity (IEA)

protein-cysteine S-palmitoyltransferase activity (IEA,ISO,ISS)

protein-cysteine S-stearoyltransferase activity (IEA)

signaling receptor binding (IEA,ISO)

transferase activity (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12761501	PMID:15603740	PMID:15603741	PMID:16647879	PMID:18596047	PMID:18794299	PMID:21705657	PMID:23034182	PMID:24705354	PMID:25253725

Genomics

Comparative Map Data

Zdhhc17
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	48,256,269 - 48,320,000 (-)	NCBI		GRCr8
mRatBN7.2	7	46,369,963 - 46,433,691 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	46,369,988 - 46,433,764 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	48,271,200 - 48,333,114 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	50,474,329 - 50,536,243 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	50,252,059 - 50,313,974 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	53,651,529 - 53,715,007 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	53,653,116 - 53,714,879 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	53,662,715 - 53,726,527 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	49,933,342 - 49,995,838 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	7	43,177,128 - 43,238,754 (-)	NCBI		Celera
Cytogenetic Map	7	q22	NCBI

ZDHHC17
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	76,764,115 - 76,853,701 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	76,764,103 - 76,853,696 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	12	77,157,895 - 77,247,481 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	75,681,985 - 75,771,605 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	12	75,659,835 - 75,749,942	NCBI
Celera	12	76,823,537 - 76,912,998 (+)	NCBI		Celera
Cytogenetic Map	12	q21.2	NCBI
HuRef	12	74,210,859 - 74,300,399 (+)	NCBI		HuRef
CHM1_1	12	77,123,422 - 77,213,014 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	12	76,742,025 - 76,831,585 (+)	NCBI		T2T-CHM13v2.0

Zdhhc17
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	110,777,640 - 110,848,587 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	110,777,641 - 110,846,001 (-)	Ensembl		GRCm39 Ensembl
GRCm38	10	110,941,779 - 111,010,066 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	110,941,780 - 111,010,140 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	10	110,378,835 - 110,447,122 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	10	110,347,147 - 110,414,118 (-)	NCBI		MGSCv36	mm8
Celera	10	112,871,081 - 112,938,382 (-)	NCBI		Celera
Cytogenetic Map	10	D1	NCBI
cM Map	10	57.86	NCBI

Zdhhc17
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955405	15,915,756 - 15,997,777 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955405	15,915,756 - 15,997,777 (+)	NCBI	ChiLan1.0	ChiLan1.0

ZDHHC17
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	84,801,702 - 84,891,322 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	84,798,140 - 84,887,713 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	74,281,716 - 74,371,885 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	77,132,723 - 77,222,514 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	77,132,723 - 77,222,509 (+)	Ensembl	panpan1.1		panPan2

ZDHHC17
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	15	19,631,719 - 19,727,089 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	15	19,499,445 - 19,724,341 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	15	20,122,502 - 20,265,878 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	15	19,977,362 - 20,120,795 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	15	19,977,325 - 20,066,267 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	15	19,577,052 - 19,720,418 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	15	19,634,946 - 19,778,238 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	15	19,763,733 - 19,907,136 (+)	NCBI		UU_Cfam_GSD_1.0

Zdhhc17
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	40,675,912 - 40,768,530 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936568	4,959,790 - 5,052,245 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936568	4,959,796 - 5,052,254 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ZDHHC17
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	5	104,300,876 - 104,394,260 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	5	104,300,869 - 104,394,255 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	5	109,481,712 - 109,553,113 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ZDHHC17
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	72,341,708 - 72,431,178 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	11	72,342,335 - 72,431,675 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666037	173,112,637 - 173,202,071 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Zdhhc17
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624750	21,225,768 - 21,308,927 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624750	21,224,049 - 21,309,089 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Zdhhc17
264 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	153
Count of miRNA genes:	115
Interacting mature miRNAs:	132
Transcripts:	ENSRNOT00000005078
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354644	Spl4	Serum phospholipid level QTL 4	4.9		blood phospholipid amount (VT:0006084)	blood phospholipid level (CMO:0001169)	7	19654317	49753746	Rat
7411569	Bw137	Body weight QTL 137		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	7	21921195	66921195	Rat
1300179	Kidm5	Kidney mass QTL 5	3.51		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	43747012	135012528	Rat
10053722	Scort27	Serum corticosterone level QTL 27	2.41	0.0083	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	7	43228750	88228750	Rat
9590102	Sffal5	Serum free fatty acids level QTL 5	8.62	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	7	5329019	50329019	Rat
1578652	Bmd15	Bone mineral density QTL 15	5.2		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	7	9866467	60460686	Rat
1641885	Alcrsp9	Alcohol response QTL 9			alcohol metabolism trait (VT:0015089)	blood ethanol level (CMO:0000535)	7	24099606	69099606	Rat
1549840	Bss5	Bone structure and strength QTL 5	9.8		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	7	24751841	69751841	Rat
10755438	Coatc9	Coat color QTL 9		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	3529280	48529280	Rat
1300127	Srn1	Serum renin concentration QTL 1	3.87		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	7	29409683	84928080	Rat
1358361	Sradr5	Stress Responsive Adrenal Weight QTL 5	5.55		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	7	43747012	108555253	Rat
2298547	Neuinf5	Neuroinflammation QTL 5	3.7		nervous system integrity trait (VT:0010566)	spinal cord Cd74 protein level (CMO:0002131)	7	9462246	58265113	Rat
631513	Scl7	Serum cholesterol level QTL 7	4.1		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	7	37960569	82960569	Rat
10059592	Kidm45	Kidney mass QTL 45	3.95	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	7	7573985	52573985	Rat
10755440	Coatc10	Coat color QTL 10		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	7496499	52496499	Rat
1354637	Scl30	Serum cholesterol level QTL 30	3.7		blood cholesterol amount (VT:0000180)	blood total cholesterol level (CMO:0000051)	7	19654317	49753746	Rat
10755453	Coatc12	Coat color QTL 12		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	31112832	76112832	Rat
631504	Cm27	Cardiac mass QTL 27	3.45		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	7	44421311	118198041	Rat
1354639	Spl5	Serum phospholipid level QTL 5	3.9		blood LDL phospholipid amount (VT:0010505)	blood low density lipoprotein phospholipid level (CMO:0001568)	7	19654317	52888450	Rat
10755451	Coatc11	Coat color QTL 11		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	17944357	62944357	Rat
634326	Hc3	Hypercalciuria QTL 3	2.1		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	7	42787314	87787314	Rat
2317059	Aia15	Adjuvant induced arthritis QTL 15	2.46		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	7	17004598	62004598	Rat
7411605	Foco14	Food consumption QTL 14	24.1	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	34293282	79293282	Rat
1643004	Pain2	Pain QTL 2	1		mechanical nociception trait (VT:0002734)	self mutilation severity score (CMO:0002145)	7	9462246	98011544	Rat
1300149	Cm6	Cardiac mass QTL 6	4.09		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	7	43747099	102228765	Rat
631534	Lnnr1	Liver neoplastic nodule remodeling QTL 1	3.85	0.001	liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number to liver total tumorous lesion number ratio (CMO:0001705)	7	34293282	79293282	Rat
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	924703	115097879	Rat
61357	Bp38	Blood pressure QTL 38	1.6	0.052	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	41333674	119109060	Rat
2303629	Vencon3	Ventilatory control QTL 3	7.25		respiration trait (VT:0001943)	respiration rate (CMO:0000289)	7	41109692	56793354	Rat
70190	Mcs6	Mammary carcinoma susceptibility QTL 6	2.29		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	7	26737401	63902784	Rat
61428	Scl3	Serum cholesterol level QTL 3	3.2		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	7	44867533	89867533	Rat
1300132	Bp182	Blood pressure QTL 182	3.49		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	7	19654317	84928080	Rat
1300138	Hrtrt9	Heart rate QTL 9	4.72		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	7	29409683	53612950	Rat
10402855	Bp379	Blood pressure QTL 379		0.21	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	29409683	74409683	Rat
738033	Anxrr6	Anxiety related response QTL 6	4.1		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	7	15573889	60573889	Rat

Markers in Region

D7Rat210

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	7	48,318,188 - 48,318,327 (+)	Marker Load Pipeline
mRatBN7.2	7	46,431,884 - 46,432,023 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	53,713,129 - 53,713,267	NCBI	Rnor6.0
Rnor_5.0	7	53,724,672 - 53,724,810	UniSTS	Rnor5.0
RGSC_v3.4	7	49,994,087 - 49,994,222	RGD	RGSC3.4
RGSC_v3.4	7	49,994,088 - 49,994,226	UniSTS	RGSC3.4
RGSC_v3.1	7	50,014,358 - 50,014,493	RGD
Celera	7	43,237,004 - 43,237,142	UniSTS
SHRSP x BN Map	7	29.74	UniSTS
SHRSP x BN Map	7	29.74	RGD
Cytogenetic Map	7	q21	UniSTS

AU048827

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	46,429,160 - 46,429,424 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	53,710,405 - 53,710,668	NCBI	Rnor6.0
Rnor_5.0	7	53,721,948 - 53,722,211	UniSTS	Rnor5.0
RGSC_v3.4	7	49,991,057 - 49,991,320	UniSTS	RGSC3.4
Celera	7	43,234,298 - 43,234,561	UniSTS
Cytogenetic Map	7	q21	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001039340	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063264044	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063264045	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AY886533	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ223229	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000005078 ⟹ ENSRNOP00000005078

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	46,369,988 - 46,433,764 (-)	Ensembl
Rnor_6.0 Ensembl	7	53,653,116 - 53,714,879 (-)	Ensembl

RefSeq Acc Id:

NM_001039340 ⟹ NP_001034429

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	48,257,855 - 48,319,939 (-)	NCBI
mRatBN7.2	7	46,371,549 - 46,433,635 (-)	NCBI
Rnor_6.0	7	53,653,115 - 53,714,879 (-)	NCBI
Rnor_5.0	7	53,662,715 - 53,726,527 (-)	NCBI
RGSC_v3.4	7	49,933,342 - 49,995,838 (-)	RGD
Celera	7	43,177,128 - 43,238,754 (-)	RGD

Sequence:

show sequence

ACACCAAGATGGCGGACGGCCCGGATGAGTACGATACCGAAACGGGCTGTGTGCCCCTTCTCCA
CCCGGAGGAGATCAAACCACAGAGCCATTATAACCATGGGTATGGTGAGCCTCTTGGGCGGAAA
ACCCATGTTGATGACTACAGCACATGGGACATTGTCAAGGCTACACAATACGGAATATATGAAC
GCTGCCGAGAATTGGTGGAAGCAGGTTATGACGTACGGCAACCGGACAAAGAGAACGTTACACT
TCTTCACTGGGCTGCCATCAATAACAGAATAGATTTAGTCAAATACTATATTTCGAAAGGTGCT
ATTGTGGATCAACTTGGAGGAGACCTGAATTCAACTCCATTGCACTGGGCCACAAGACAAGGCC
ATTTATCCATGGTTGTACAACTAATGAAATATGGTGCAGATCCCTCATTGATCGATGGTGAAGG
GTGCAGCTGTATCCACTTGGCTGCTCAGTTTGGACATACCTCAATTGTTGCTTACCTTATAGCA
AAAGGACAGGATGTAGATATGATGGATCAGAACGGAATGACACCTTTAATGTGGGCAGCTTATA
GAACACATAGTGTGGATCCAACTAGATTGCTTTTAACATTCAATGTTTCAGTTAACCTTGGTGA
CAAGTATCACAAAAACACTGCTCTGCACTGGGCAGTCCTAGCAGGGAACACCACAGTCATTAGT
CTTCTTCTGGAAGCTGGAGGGAACGTGGATGCCCAGAATGTCAAGGGCGAATCAGCACTTGATT
TGGCAAAGCAAAGAAAAAACGTGTGGATGATCAACCATTTGCAGGAGGCAAGGCAGGCGAAGGG
TTACGACAACCCGTCCTTCCTCAGAAAGCTGAAGGCTGACAAGGAATTTCGGCAGAAAGTAATG
CTAGGAACTCCATTCCTAGTGATTTGGCTAGTTGGGTTTATAGCAGACCTGAACATTGATTCTT
GGCTCATTAAAGGGTTAATGTATGGTGGTGTTTGGGCTACAGTACAATTTCTTTCCAAGTCCTT
TTTTGATCATTCAATGCACAGCGCATTGCCCCTTGGGATATATTTGGCAACCAAATTCTGGATG
TATGTGACATGGTTCTTCTGGTTTTGGAATGATCTCAGCTTCTTATCCATCCACCTGCCCTTCC
TCGCCAACAGTGTTGCTCTTTTCTACAATTTTGGAAAGTCTTGGAAATCAGATCCAGGGATCAT
TAAAGCTACAGAAGAACAAAAGAAGAAGACAATAGTTGAACTTGCAGAGACCGGCAGTCTGGAC
CTCAGTATATTCTGCAGCACCTGCTTGATTCGGAAGCCGGTGAGGTCCAAACACTGTGGTGTGT
GCAACCGCTGTATAGCGAAATTTGATCACCATTGCCCATGGGTGGGTAACTGTGTATGTGCAGG
CAACCATAGATACTTTATGGGCTACCTATTCTTCTTGCTTTTTATGATCTGCTGGATGATTTAT
GGTTGTGTTTCTTACTGGGGACTTCACTGTGAGACCACGTACACGAAGGATGGCTTCTGGACAT
ATATTACTCAGATTGCCACATGCTCTCCTTGGATGTTTTGGATGTTTCTGAACAGTGTGTTTCA
TTTCATGTGGGTGGCCGTGCTACTCATGTGTCAGATGTACCAGATAACATGTTTAGGTATTACT
ACAAATGAAAGAATGAATGCCAGGAGATACAAGCACTTTAAAGTTACAACAACATCTATAGAGA
GCCCATTCAACCATGGATGTGTAAGGAATATTATAGACTTCTTTGAATTTCGATGCTGTGGCCT
CTTTCGTCCTGTTATCGTGGACTGGACCAGGCAATACACAATAGAGTATGACCAAATATCAGGA
TCTGGGTACCAGCTGGTGTAGCAGCATCCGTATGCCAGGAAACATTGCTGCTGAGTGGGGCCTG
AAGATTGTCTGTCCCTGTCTCTCTCCCTGGGATCCACATCCTTGGAACAAATAGCATGCTATAT
GTAGGGCTAACCGTGAACTTGACAGCCTTCATTCAGTACTTTATTAACAAAAGCAAACATGGAC
AGAACACACTGCCACGTCTAGGAAGAAAAGATCATAAGAGGAATTTTCACAGTTCTTAATGTTT
GAATTCACATCATACTCTACTTTTTGGTTTTGTTCTCATAACATTTTTCATGAAAATCTGAACT
TATTCTGTTACTAGAGATGGCAATACTGAGGATAAATGTTGTTATAACTCAAACTAAATTTACG
TTATACAGCTAAATTGTACTGTGCAGTACTTACAAGTATTGCATTTAATCCAAGAAAATTGTCT
TAACTCGATGACTAGTATTATGTGCATTTTAGATGTACATGTAAATACTGTGATGAAAATCATG
TGGTTTTATTAGAGGTCTGCTGTACTGTGTCCCCAAGGCACGGGAAAATAATGTTCATGGAAAC
GGGCTTGCTCTTCTGTTGCCTCCAGCTCTTGGGATGCTGGCTTATTTCTAGTTCAGCGAAATAA
TTTCTAGTGACTGTGCTCTGAGGTCCCATAGTCTGATAATAAAGCACTTGCATGAGTATACTAA
GTCATAATATTTTGTTGAAATTTGAAGCCCTACTGCATGCATGATACACCGCATAGAATGTATA
CTAGCAGATGCTGTCCAGAGAAGCATAGATTAGGTTTGAATTTCATGTGCAAAACAGCCCAATT
TTTTAAAGAGTTAAGGTGGATTTTCAACAAGAAGCAAAACAAATAAGCTAATGCAAAATTTTTT
ATTAATAGAGATAAGTGGATATGCTTTTTAAATTCTGAGCTGAAAAATAAGTTGTAGACAAAAT
AATGGAGTCTAGGCTAAAAATGGAGCATGATCTCTGTACATAGCACATGCGAATAAATGAAAAG
CTAGGGAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_063264044 ⟹ XP_063120114

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	48,256,269 - 48,320,000 (-)	NCBI

RefSeq Acc Id:

XM_063264045 ⟹ XP_063120115

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	48,256,269 - 48,281,073 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001034429	(Get FASTA)	NCBI Sequence Viewer
	XP_063120114	(Get FASTA)	NCBI Sequence Viewer
	XP_063120115	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAX73395	(Get FASTA)	NCBI Sequence Viewer
	E9PTT0	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000005078

RefSeq Acc Id:

NP_001034429 ⟸ NM_001039340

- UniProtKB:

Q2TGJ2 (UniProtKB/Swiss-Prot), E9PTT0 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MADGPDEYDTETGCVPLLHPEEIKPQSHYNHGYGEPLGRKTHVDDYSTWDIVKATQYGIYERCR
ELVEAGYDVRQPDKENVTLLHWAAINNRIDLVKYYISKGAIVDQLGGDLNSTPLHWATRQGHLS
MVVQLMKYGADPSLIDGEGCSCIHLAAQFGHTSIVAYLIAKGQDVDMMDQNGMTPLMWAAYRTH
SVDPTRLLLTFNVSVNLGDKYHKNTALHWAVLAGNTTVISLLLEAGGNVDAQNVKGESALDLAK
QRKNVWMINHLQEARQAKGYDNPSFLRKLKADKEFRQKVMLGTPFLVIWLVGFIADLNIDSWLI
KGLMYGGVWATVQFLSKSFFDHSMHSALPLGIYLATKFWMYVTWFFWFWNDLSFLSIHLPFLAN
SVALFYNFGKSWKSDPGIIKATEEQKKKTIVELAETGSLDLSIFCSTCLIRKPVRSKHCGVCNR
CIAKFDHHCPWVGNCVCAGNHRYFMGYLFFLLFMICWMIYGCVSYWGLHCETTYTKDGFWTYIT
QIATCSPWMFWMFLNSVFHFMWVAVLLMCQMYQITCLGITTNERMNARRYKHFKVTTTSIESPF
NHGCVRNIIDFFEFRCCGLFRPVIVDWTRQYTIEYDQISGSGYQLV

hide sequence

Ensembl Acc Id:

ENSRNOP00000005078 ⟸ ENSRNOT00000005078

RefSeq Acc Id:	XP_063120114 ⟸ XM_063264044
- Peptide Label:	isoform X1
- UniProtKB:	Q2TGJ2 (UniProtKB/Swiss-Prot), E9PTT0 (UniProtKB/Swiss-Prot), A0A8L2Q2M2 (UniProtKB/TrEMBL), A6IGF5 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063120115 ⟸ XM_063264045
- Peptide Label:	isoform X2

Protein Domains

DHHC Palmitoyltransferase DHHC

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-E9PTT0-F1-model_v2	AlphaFold	E9PTT0	1-622	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13695187

Promoter ID:

EPDNEW_R5712

Type:

single initiation site

Name:

Zdhhc17_1

Description:

zinc finger, DHHC-type containing 17

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	7	53,714,880 - 53,714,940	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1595790	AgrOrtholog
BioCyc Gene	G2FUF-34140	BioCyc
Ensembl Genes	ENSRNOG00000003803	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000005078	ENTREZGENE
Gene3D-CATH	1.25.40.20	UniProtKB/Swiss-Prot
InterPro	Ankyrin_rpt	UniProtKB/Swiss-Prot
	Ankyrin_rpt-contain_sf	UniProtKB/Swiss-Prot
	Palmitoyltrfase_DHHC	UniProtKB/Swiss-Prot
KEGG Report	rno:366889	UniProtKB/Swiss-Prot
NCBI Gene	366889	ENTREZGENE
PANTHER	ANK_REP_REGION DOMAIN-CONTAINING PROTEIN-RELATED	UniProtKB/Swiss-Prot
	PTHR24161:SF18	UniProtKB/Swiss-Prot
Pfam	Ank_2	UniProtKB/Swiss-Prot
	DHHC	UniProtKB/Swiss-Prot
PhenoGen	Zdhhc17	PhenoGen
PRINTS	ANKYRIN	UniProtKB/Swiss-Prot
PROSITE	ANK_REP_REGION	UniProtKB/Swiss-Prot
	ANK_REPEAT	UniProtKB/Swiss-Prot
	DHHC	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000003803	RatGTEx
SMART	ANK	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF48403	UniProtKB/Swiss-Prot
UniProt	A0A8L2Q2M2	ENTREZGENE, UniProtKB/TrEMBL
	A6IGF5	ENTREZGENE, UniProtKB/TrEMBL
	E9PTT0	ENTREZGENE
	Q2TGJ2	ENTREZGENE
	ZDH17_RAT	UniProtKB/Swiss-Prot
UniProt Secondary	Q2TGJ2	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2019-11-11	Zdhhc17	zinc finger DHHC-type palmitoyltransferase 17	Zdhhc17	zinc finger, DHHC-type containing 17	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-12-15	Zdhhc17	zinc finger, DHHC-type containing 17	Zdhhc17	zinc finger, DHHC domain containing 17	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-05	Zdhhc17	zinc finger, DHHC domain containing 17	LOC366889	membrane-associated DHHC17 zinc finger protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-20	LOC366889	membrane-associated DHHC17 zinc finger protein			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - MGI