Snrpd2 (small nuclear ribonucleoprotein D2 polypeptide)

Advanced Search (OLGA)

Gene: Snrpd2 (small nuclear ribonucleoprotein D2 polypeptide) Rattus norvegicus

Analyze

Symbol:

Snrpd2

Name:

small nuclear ribonucleoprotein D2 polypeptide

RGD ID:

1593018

Description:

Enables U1 snRNP binding activity. Predicted to be involved in spliceosomal snRNP assembly. Part of U1 snRNP. Human ortholog(s) of this gene implicated in systemic lupus erythematosus. Orthologous to human SNRPD2 (small nuclear ribonucleoprotein D2 polypeptide); PARTICIPATES IN spliceosome pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; bisphenol A; cadmium dichloride.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC680309; similar to small nuclear ribonucleoprotein D2; small nuclear ribonucleoprotein D2; small nuclear ribonucleoprotein Sm D2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SNRPD2 (small nuclear ribonucleoprotein D2 polypeptide)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Snrpd2 (small nuclear ribonucleoprotein D2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Snrpd2 (small nuclear ribonucleoprotein D2 polypeptide)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SNRPD2 (small nuclear ribonucleoprotein D2 polypeptide)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SNRPD2 (small nuclear ribonucleoprotein D2 polypeptide)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Snrpd2 (small nuclear ribonucleoprotein D2 polypeptide)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SNRPD2 (small nuclear ribonucleoprotein D2 polypeptide)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SNRPD2 (small nuclear ribonucleoprotein D2 polypeptide)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Snrpd2 (small nuclear ribonucleoprotein D2 polypeptide)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	RPL23A (ribosomal protein L23a)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	SNRPD2 (small nuclear ribonucleoprotein D2 polypeptide)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Snrpd2 (small nuclear ribonucleoprotein D2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	snrpd2 (small nuclear ribonucleoprotein D2 polypeptide)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	SmD2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	SMD2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	snr-4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	snrpd2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)

Related Pseudogenes:

Snrpd2l

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	87,926,030 - 87,929,259 (+)	NCBI		GRCr8
mRatBN7.2	1	78,798,377 - 78,801,227 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	78,798,377 - 78,803,351 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	84,187,409 - 84,190,259 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	92,745,052 - 92,747,904 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	85,942,511 - 85,945,361 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	80,057,140 - 80,059,990 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	80,056,755 - 80,059,996 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	81,324,033 - 81,326,883 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	78,509,142 - 78,511,992 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	1	73,264,040 - 73,266,890 (+)	NCBI		Celera
Cytogenetic Map	1	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

systemic lupus erythematosus (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-alpha-phellandrene (ISO)

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

4,4'-sulfonyldiphenol (ISO)

acrolein (ISO)

actinomycin D (ISO)

alpha-phellandrene (ISO)

alpha-pinene (ISO)

Aroclor 1254 (ISO)

arsenite(3-) (ISO)

beauvericin (ISO)

benzatropine (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

cadmium dichloride (EXP,ISO)

chloropicrin (ISO)

chromium(6+) (ISO)

clobetasol (ISO)

clozapine (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

dibutyl phthalate (ISO)

dihydroartemisinin (ISO)

enniatin (ISO)

enzyme inhibitor (ISO)

epoxiconazole (ISO)

flutamide (EXP)

folic acid (ISO)

FR900359 (ISO)

glafenine (EXP)

haloperidol (ISO)

hinokiflavone (ISO)

hydralazine (ISO)

ivermectin (ISO)

methyl methanesulfonate (ISO)

methylparaben (ISO)

N-methyl-4-phenylpyridinium (ISO)

Nutlin-3 (ISO)

oxaliplatin (EXP)

ozone (EXP,ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

resveratrol (ISO)

sodium arsenite (ISO)

thiram (ISO)

titanium dioxide (ISO)

toluene (EXP)

topotecan (EXP)

trimellitic anhydride (ISO)

triphenyl phosphate (ISO)

tungsten (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

mRNA splicing, via spliceosome (ISO)

spliceosomal snRNP assembly (IBA,ISO)

Cellular Component

catalytic step 2 spliceosome (IBA,ISO)

cytosol (ISO)

methylosome (ISO)

nucleus (ISO)

pICln-Sm protein complex (IBA,ISO)

precatalytic spliceosome (IBA)

SMN-Sm protein complex (ISO)

spliceosomal complex (ISO)

U1 snRNP (IBA,IDA,ISO)

U12-type spliceosomal complex (ISO)

U2 snRNP (IBA)

U2-type catalytic step 2 spliceosome (ISO)

U2-type precatalytic spliceosome (ISO)

U2-type spliceosomal complex (ISO)

U4 snRNP (ISO)

U4/U6 x U5 tri-snRNP complex (IBA,ISO)

U5 snRNP (IBA)

Molecular Function

protein binding (ISO)

RNA binding (IEA)

U1 snRNP binding (IDA)

Molecular Pathway Annotations Click to see Annotation Detail View

spliceosome pathway (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Proteomic analysis of in vivo-assembled pre-mRNA splicing complexes expands the catalog of participating factors.	Chen YI, etal., Nucleic Acids Res. 2007;35(12):3928-44. Epub 2007 May 30.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Anti-sm autoantibodies in systemic lupus target highly basic surface structures of complexed spliceosomal autoantigens.	McClain MT, etal., J Immunol. 2002 Feb 15;168(4):2054-62.
4.	Separation of nuclear protein complexes by blue native polyacrylamide gel electrophoresis.	Novakova Z, etal., Electrophoresis. 2006 Apr;27(7):1277-87.
5.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Comprehensive gene review and curation	RGD comprehensive gene curation
8.	The spliceosome: design principles of a dynamic RNP machine.	Wahl MC, etal., Cell. 2009 Feb 20;136(4):701-18. doi: 10.1016/j.cell.2009.02.009.

Additional References at PubMed

PMID:11991638	PMID:12477932	PMID:15146077	PMID:18984161	PMID:20458337	PMID:21113136	PMID:21516107	PMID:22658674	PMID:23376485	PMID:25555158	PMID:26912367	PMID:28076346
PMID:28781166	PMID:31505169

Genomics

Comparative Map Data

Snrpd2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	87,926,030 - 87,929,259 (+)	NCBI		GRCr8
mRatBN7.2	1	78,798,377 - 78,801,227 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	78,798,377 - 78,803,351 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	84,187,409 - 84,190,259 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	92,745,052 - 92,747,904 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	85,942,511 - 85,945,361 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	80,057,140 - 80,059,990 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	80,056,755 - 80,059,996 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	81,324,033 - 81,326,883 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	78,509,142 - 78,511,992 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	1	73,264,040 - 73,266,890 (+)	NCBI		Celera
Cytogenetic Map	1	q21	NCBI

SNRPD2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	45,687,454 - 45,692,316 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	45,687,460 - 45,692,569 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	46,190,712 - 46,195,574 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	50,882,558 - 50,887,282 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	50,882,557 - 50,887,282	NCBI
Celera	19	42,996,835 - 43,001,568 (-)	NCBI		Celera
Cytogenetic Map	19	q13.32	NCBI
HuRef	19	42,619,677 - 42,624,410 (-)	NCBI		HuRef
CHM1_1	19	46,194,181 - 46,198,916 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	19	48,514,991 - 48,519,856 (-)	NCBI		T2T-CHM13v2.0

Snrpd2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	18,883,370 - 18,886,659 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	18,883,647 - 18,887,467 (+)	Ensembl		GRCm39 Ensembl
GRCm38	7	19,149,445 - 19,152,734 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	19,149,722 - 19,153,542 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	19,735,187 - 19,738,075 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	18,308,360 - 18,311,248 (+)	NCBI		MGSCv36	mm8
Celera	7	16,561,189 - 16,564,077 (+)	NCBI		Celera
Cytogenetic Map	7	A3	NCBI
cM Map	7	9.46	NCBI

Snrpd2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955574	157,769 - 164,947 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955574	157,769 - 164,947 (-)	NCBI	ChiLan1.0	ChiLan1.0

SNRPD2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	51,849,077 - 51,853,700 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	53,720,533 - 53,725,113 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	42,692,963 - 42,697,512 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	51,230,822 - 51,235,661 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	51,230,822 - 51,235,661 (-)	Ensembl	panpan1.1		panPan2

SNRPD2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	109,891,253 - 109,896,712 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	109,891,223 - 109,896,711 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	109,376,402 - 109,381,860 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	110,424,516 - 110,429,978 (+)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	1	110,100,067 - 110,105,533 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	109,734,707 - 109,740,174 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	110,603,576 - 110,609,034 (+)	NCBI		UU_Cfam_GSD_1.0

Snrpd2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	17,717,972 - 17,721,426 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936706	2,065,419 - 2,067,487 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936706	2,065,315 - 2,068,709 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SNRPD2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	52,035,134 - 52,042,474 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	52,035,900 - 52,042,474 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

SNRPD2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	39,127,974 - 39,134,771 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	39,127,877 - 39,134,626 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666073	18,755,632 - 18,760,350 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Snrpd2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624832	7,488,674 - 7,495,306 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624832	7,488,259 - 7,495,305 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Snrpd2
15 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	47
Count of miRNA genes:	46
Interacting mature miRNAs:	47
Transcripts:	ENSRNOT00000021221
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2313059	Bss55	Bone structure and strength QTL 55	3.2	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
631688	Hcas2	Hepatocarcinoma susceptibility QTL 2	3	0.0001	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	5925874	115540829	Rat
1578649	Bmd8	Bone mineral density QTL 8	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	49393172	94393172	Rat
1582234	Gluco18	Glucose level QTL 18	3.4	0.0003	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	78479925	123479925	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	30882023	123479925	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	49393289	199050459	Rat
4889929	Bss87	Bone structure and strength QTL 87	6.7		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	53895117	82174945	Rat
2313062	Bmd73	Bone mineral density QTL 73	3.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	11481312	82174945	Rat
8552900	Pigfal1	Plasma insulin-like growth factor 1 level QTL 1	7.4		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	34836858	79836858	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	49393172	159356837	Rat
1554320	Bmd1	Bone mineral density QTL 1	12.2	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	509108	86060548	Rat
2302059	Pia36	Pristane induced arthritis QTL 36	3.8	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	1	43333002	88333002	Rat
2313065	Bss67	Bone structure and strength QTL 67	3.1	0.0001	tibia area (VT:1000281)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
1300121	Hrtrt1	Heart rate QTL 1	3.7		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	65789093	115540829	Rat
7421628	Bp361	Blood pressure QTL 361		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	66023617	118608521	Rat
2313069	Bss68	Bone structure and strength QTL 68	2.9	0.0001	tibia size trait (VT:0100001)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	22340647	102268831	Rat
2313075	Bss66	Bone structure and strength QTL 66	3.4	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	11481312	82174945	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32356093	162846471	Rat
631512	Scl6	Serum cholesterol level QTL 6	9.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	72197680	90508767	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	57336763	151090257	Rat
2313072	Bss53	Bone structure and strength QTL 53	4.3	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	43284731	118944897	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
2313078	Bss54	Bone structure and strength QTL 54	3.5	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
2313077	Bss69	Bone structure and strength QTL 69	3.5	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	11481312	82174945	Rat
1549903	Bp267	Blood pressure QTL 267			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	77876254	106047988	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	48963584	144267916	Rat
61342	Bp27	Blood pressure QTL 27	3.4	0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	56732668	98773277	Rat
1300172	Bp172	Blood pressure QTL 172	3.56		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	32737273	90665040	Rat
4889962	Bss94	Bone structure and strength QTL 94	3.8		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	49361465	82174945	Rat
61344	Bp29	Blood pressure QTL 29	7.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	78350581	123350581	Rat
1358192	Ept13	Estrogen-induced pituitary tumorigenesis QTL 13	3.4		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	77494165	122494165	Rat
2313094	Bss58	Bone structure and strength QTL 58	3.7	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	43284731	118944897	Rat
6903308	Scl36	Serum cholesterol QTL 36	2	0.0125	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	53863041	90532583	Rat
2313092	Bmd72	Bone mineral density QTL 72	2.5	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	11481312	82174945	Rat
2300164	Bmd44	Bone mineral density QTL 44	5.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	1	56949932	101949932	Rat
2313099	Bss56	Bone structure and strength QTL 56	2.4	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	1	43284731	118944897	Rat
2313098	Bmd70	Bone mineral density QTL 70	3.6	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	43284731	118944897	Rat
2313097	Bss70	Bone structure and strength QTL 70	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
9589820	Insglur3	Insulin/glucose ratio QTL 3	10.75	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	1	34836858	79836858	Rat
10054135	Gmadr2	Adrenal mass QTL 2	1.97	0.0129	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	77857876	122857876	Rat
7411712	Strs4	Sensitivity to stroke QTL 4	8.7		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	1	78430536	123430536	Rat
4889919	Bss86	Bone structure and strength QTL 86	4.1		tibia area (VT:1000281)	tibia midshaft total cross-sectional area (CMO:0001715)	1	53895117	82174945	Rat
8552948	Pigfal11	Plasma insulin-like growth factor 1 level QTL 11	4.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	34836858	79836858	Rat
2313051	Bss57	Bone structure and strength QTL 57	3.7	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	43284731	118944897	Rat
61433	Cia2	Collagen induced arthritis QTL 2	5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	78430754	91209302	Rat

Markers in Region

RH126590

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	21,282,218 - 21,282,416 (+)	MAPPER	mRatBN7.2
mRatBN7.2	1	78,799,838 - 78,801,063 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	80,058,602 - 80,059,826	NCBI	Rnor6.0
Rnor_6.0	6	22,457,430 - 22,457,627	NCBI	Rnor6.0
Rnor_5.0	6	32,343,125 - 32,343,322	UniSTS	Rnor5.0
Rnor_5.0	1	81,325,495 - 81,326,719	UniSTS	Rnor5.0
RGSC_v3.4	1	78,510,604 - 78,511,828	UniSTS	RGSC3.4
RGSC_v3.4	6	21,245,180 - 21,245,377	UniSTS	RGSC3.4
Celera	6	20,839,275 - 20,839,472	UniSTS
Celera	1	73,265,502 - 73,266,726	UniSTS
Cytogenetic Map	6	q13	UniSTS
Cytogenetic Map	1	q21	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001109399	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063273625	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC120692	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC168781	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473979	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ222619	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228670	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000021221 ⟹ ENSRNOP00000021221

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	78,799,579 - 78,801,226 (+)	Ensembl
Rnor_6.0 Ensembl	1	80,056,755 - 80,059,996 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000109557 ⟹ ENSRNOP00000081057

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	78,798,377 - 78,803,351 (+)	Ensembl

RefSeq Acc Id:

NM_001109399 ⟹ NP_001102869

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	87,926,409 - 87,929,259 (+)	NCBI
mRatBN7.2	1	78,798,377 - 78,801,227 (+)	NCBI
Rnor_6.0	1	80,057,140 - 80,059,990 (+)	NCBI
Rnor_5.0	1	81,324,033 - 81,326,883 (+)	NCBI
RGSC_v3.4	1	78,509,142 - 78,511,992 (+)	RGD
Celera	1	73,264,040 - 73,266,890 (+)	RGD

Sequence:

show sequence

CTTCTCTTGCTGTGCTCCAAAGGCTAAAGCAACGCGCTTGGAGGCGGGAGTGATCTGCTAGCGA
AACCTTCACCATGAGTCTCCTCAATAAACCCAAGAGTGAGATGACCCCAGAGGAGCTGCAGAAG
CGGGAGGAGGAGGAATTCAACACAGGTCCCCTCTCGGTGCTCACACAGTCGGTCAAAAACAACA
CGCAAGTGCTCATTAACTGTCGAAACAACAAGAAGCTCCTGGGCCGGGTGAAGGCCTTTGACAG
GCACTGCAACATGGTGCTGGAAAATGTGAAGGAGATGTGGACTGAGGTCCCCAAGAGCGGCAAG
GGCAAGAAGAAGTCCAAGCCTGTCAACAAGGACCGCTACATCTCCAAGATGTTCCTGCGCGGGG
ACTCAGTCATTGTGGTGCTGCGGAACCCGCTCATCGCTGGCAAGTAAACTAGAGGCCAGCCTCA
GCCCGCTGAGAGCCTGCTCCCTGCCCAGCCAAGTCCCGCAGAGCCCTGCCCAATGAGCTAGAAA
TAAAACCCTGTGCTTTTTGTTTTTTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_063273625 ⟹ XP_063129695

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	87,926,030 - 87,929,259 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001102869	(Get FASTA)	NCBI Sequence Viewer
	XP_063129695	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI68781	(Get FASTA)	NCBI Sequence Viewer
	EDM08232	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000021221.3
	ENSRNOP00000065798.1
	ENSRNOP00000081057.1

RefSeq Acc Id:	NP_001102869 ⟸ NM_001109399
- UniProtKB:	B5DES0 (UniProtKB/TrEMBL), M0R8K2 (UniProtKB/TrEMBL)
- Sequence:	show sequence MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCN MVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK hide sequence

Ensembl Acc Id:

ENSRNOP00000021221 ⟸ ENSRNOT00000021221

Ensembl Acc Id:

ENSRNOP00000081057 ⟸ ENSRNOT00000109557

RefSeq Acc Id:	XP_063129695 ⟸ XM_063273625
- Peptide Label:	isoform X1
- UniProtKB:	M0R8K2 (UniProtKB/TrEMBL), B5DES0 (UniProtKB/TrEMBL)

Protein Domains

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B5DES0-F1-model_v2	AlphaFold	B5DES0	1-118	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13689763

Promoter ID:

EPDNEW_R287

Type:

multiple initiation site

Name:

Snrpd2_1

Description:

small nuclear ribonucleoprotein D2 polypeptide

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	80,057,140 - 80,057,200	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1593018	AgrOrtholog
BioCyc Gene	G2FUF-60528	BioCyc
Ensembl Genes	ENSRNOG00000015844	Ensembl, UniProtKB/TrEMBL
	ENSRNOG00000048758	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000021221.5	UniProtKB/TrEMBL
	ENSRNOT00000071064.2	UniProtKB/TrEMBL
	ENSRNOT00000109557.1	UniProtKB/TrEMBL
Gene3D-CATH	2.30.30.100	UniProtKB/TrEMBL
InterPro	IPR047575	UniProtKB/TrEMBL
	LSM_domain	UniProtKB/TrEMBL
	LSM_related_domain	UniProtKB/TrEMBL
	Sm_D2	UniProtKB/TrEMBL
KEGG Report	rno:680309	UniProtKB/TrEMBL
NCBI Gene	680309	ENTREZGENE
PANTHER	PTHR12777	UniProtKB/TrEMBL
	SMALL NUCLEAR RIBONUCLEOPROTEIN SM D2	UniProtKB/TrEMBL
Pfam	LSM	UniProtKB/TrEMBL
PhenoGen	Snrpd2	PhenoGen
PROSITE	PS52002	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000015844	RatGTEx
	ENSRNOG00000048758	RatGTEx
SMART	SM00651	UniProtKB/TrEMBL
Superfamily-SCOP	Sm_like_riboprot	UniProtKB/TrEMBL
UniProt	A0A8I5ZR44_RAT	UniProtKB/TrEMBL
	B5DES0	ENTREZGENE, UniProtKB/TrEMBL
	F7FB70_RAT	UniProtKB/TrEMBL
	M0R8K2	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-05-24	Snrpd2	small nuclear ribonucleoprotein D2 polypeptide	LOC686737	similar to small nuclear ribonucleoprotein D2	Data merged from RGD:1593724	1643240	APPROVED
2009-10-22	Snrpd2	small nuclear ribonucleoprotein D2 polypeptide	Snrpd2	small nuclear ribonucleoprotein D2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-05	Snrpd2	small nuclear ribonucleoprotein D2	LOC680309	similar to small nuclear ribonucleoprotein D2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-20	LOC680309	similar to small nuclear ribonucleoprotein D2			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-20	LOC686737	similar to small nuclear ribonucleoprotein D2			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

RGD Manual Annotations

Imported Annotations - KEGG (archival)