Myl4 (myosin, light chain 4) - Rat Genome Database

Name: Myl4
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Myl4 (myosin, light chain 4) Rattus norvegicus

Analyze

Symbol:

Myl4

Name:

myosin, light chain 4

RGD ID:

1591197

Description:

Predicted to enable actin filament binding activity and actin monomer binding activity. Predicted to be involved in cardiac muscle contraction and regulation of the force of heart contraction. Predicted to be part of myosin II complex. Predicted to be active in A band. Used to study cardiomyopathy. Human ortholog(s) of this gene implicated in cardiomyopathy and familial atrial fibrillation. Orthologous to human MYL4 (myosin light chain 4); INTERACTS WITH 2,2',5,5'-tetrachlorobiphenyl; 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC688228; myosin light chain 1, atrial isoform; myosin light chain 4; similar to Myosin light polypeptide 4 (Myosin light chain 1, atrial isoform)

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	MYL4 (myosin light chain 4)	RGD	RGD
Mus musculus (house mouse):	Myl4 (myosin, light polypeptide 4)	RGD	RGD
Chinchilla lanigera (long-tailed chinchilla):	Myl4 (myosin light chain 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	MYL4 (myosin light chain 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	MYL4 (myosin light chain 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Myl4 (myosin light chain 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	MYL4 (myosin light chain 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	MYL4 (myosin light chain 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Myl4 (myosin light chain 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	MYL3 (myosin light chain 3)	HGNC	OrthoDB
Alliance orthologs ³
Homo sapiens (human):	MYL4 (myosin light chain 4)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Myl4 (myosin, light polypeptide 4)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cmlc1 (cardiac myosin light chain-1)	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER)
Danio rerio (zebrafish):	myl4 (myosin, light chain 4, alkali; atrial, embryonic)	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoInspector\|PANTHER)
Saccharomyces cerevisiae (baker's yeast):	MLC1	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	Mlc-c	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	mlc-5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	mlc-7	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	mlc-3	Alliance	DIOPT (OMA\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	mlc-6	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	myl4	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	10	89,449,456 - 89,485,365 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	89,449,443 - 89,485,363 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	94,511,646 - 94,520,766 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	93,974,829 - 93,983,953 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	89,380,244 - 89,389,346 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	92,628,356 - 92,638,100 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	92,628,356 - 92,638,100 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	92,390,125 - 92,398,028 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	10	88,169,960 - 88,178,967 (+)	NCBI		Celera
Cytogenetic Map	10	q32.1	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Atrial Dilation and Standstill (ISO)

cardiomyopathy (IMP,ISO)

familial atrial fibrillation (ISO)

Familial Atrial Fibrillation 18 (ISO)

genetic disease (ISO)

hypertrophic cardiomyopathy (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

2,2',5,5'-tetrachlorobiphenyl (EXP)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2-butoxyethanol (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

5-fluorouracil (ISO)

6-propyl-2-thiouracil (EXP,ISO)

aconitine (EXP)

acrylamide (EXP)

aflatoxin B1 (ISO)

amiodarone (ISO)

arotinoid acid (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

atrazine (EXP)

azoxystrobin (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

bleomycin A2 (EXP)

capsaicin (ISO)

carbamazepine (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

CHIR 99021 (ISO)

clothianidin (ISO)

cobalt atom (ISO)

cortisol (ISO)

curcumin (ISO)

cytarabine (ISO)

deguelin (ISO)

dextran sulfate (ISO)

diarsenic trioxide (ISO)

dioxygen (EXP,ISO)

doxorubicin (ISO)

Echimidine (EXP)

endosulfan (EXP)

fipronil (EXP)

genistein (ISO)

gentamycin (EXP)

Heliotrine (EXP)

hydrogen peroxide (ISO)

Indeno[1,2,3-cd]pyrene (ISO)

isotretinoin (ISO)

L-ascorbic acid (ISO)

L-ascorbic acid 2-phosphate (ISO)

N-methyl-4-phenylpyridinium (EXP)

nitrofen (EXP)

ozone (ISO)

paracetamol (ISO)

paraquat (EXP)

PCB138 (EXP)

perfluorooctane-1-sulfonic acid (ISO)

picoxystrobin (ISO)

pirinixic acid (ISO)

serpentine asbestos (ISO)

sunitinib (ISO)

tebufenpyrad (ISO)

thifluzamide (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

triclosan (ISO)

trimellitic anhydride (ISO)

tungsten (ISO)

valproic acid (ISO)

XAV939 (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cardiac muscle contraction (IBA,ISO)

regulation of the force of heart contraction (ISO)

Cellular Component

A band (IBA,ISO)

myosin II complex (IBA)

Molecular Function

actin filament binding (ISO)

actin monomer binding (IBA,ISO)

calcium ion binding (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Dysfunction of Myosin Light-Chain 4 (MYL4) Leads to Heritable Atrial Cardiomyopathy With Electrical, Contractile, and Structural Components: Evidence From Genetically-Engineered Rats.	Peng W, etal., J Am Heart Assoc. 2017 Oct 28;6(11). pii: JAHA.117.007030. doi: 10.1161/JAHA.117.007030.
3.	GOA pipeline	RGD automated data pipeline
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:2326197	PMID:9180271	PMID:9738905	PMID:14985854	PMID:16675844	PMID:36645977

Genomics

Comparative Map Data

Myl4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	10	89,449,456 - 89,485,365 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	89,449,443 - 89,485,363 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	94,511,646 - 94,520,766 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	93,974,829 - 93,983,953 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	89,380,244 - 89,389,346 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	92,628,356 - 92,638,100 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	92,628,356 - 92,638,100 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	92,390,125 - 92,398,028 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	10	88,169,960 - 88,178,967 (+)	NCBI		Celera
Cytogenetic Map	10	q32.1	NCBI

MYL4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	47,189,433 - 47,227,650 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	47,200,446 - 47,223,679 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	17	45,286,394 - 45,301,045 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	42,641,427 - 42,656,044 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	17	42,641,712 - 42,656,044	NCBI
Celera	17	41,736,487 - 41,751,114 (+)	NCBI		Celera
Cytogenetic Map	17	q21.32	NCBI
HuRef	17	40,664,504 - 40,679,131 (+)	NCBI		HuRef
CHM1_1	17	45,351,368 - 45,365,994 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	17	48,071,363 - 48,090,003 (+)	NCBI		T2T-CHM13v2.0

Myl4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	104,427,604 - 104,478,041 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	104,441,489 - 104,486,579 (+)	Ensembl		GRCm39 Ensembl
GRCm38	11	104,546,017 - 104,587,215 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	104,550,663 - 104,595,753 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	104,411,977 - 104,448,533 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	104,366,753 - 104,403,309 (+)	NCBI		MGSCv36	mm8
Celera	11	116,278,527 - 116,315,212 (+)	NCBI		Celera
Cytogenetic Map	11	E1	NCBI
cM Map	11	67.79	NCBI

Myl4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955478	9,877,710 - 9,928,053 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955478	9,878,074 - 9,927,793 (-)	NCBI	ChiLan1.0	ChiLan1.0

MYL4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	17	19,756,135 - 19,790,542 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	10,224,756 - 10,259,227 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	10,439,346 - 10,454,272 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	17	10,439,346 - 10,454,272 (-)	Ensembl	panpan1.1		panPan2

MYL4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	9,251,998 - 9,265,213 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	9	9,251,998 - 9,281,025 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	11,017,405 - 11,044,701 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	10,842,528 - 10,869,856 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	10,842,533 - 10,869,923 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	9,856,692 - 9,883,995 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	17,640,415 - 17,667,703 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	17,587,089 - 17,614,390 (+)	NCBI		UU_Cfam_GSD_1.0

Myl4
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	16,402,379 - 16,432,097 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936541	2,780,047 - 2,791,603 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936541	2,779,669 - 2,792,219 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MYL4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	12	16,775,471 - 16,792,213 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	12	16,774,655 - 16,792,213 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	12	16,798,622 - 16,815,378 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

MYL4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	59,457,500 - 59,497,705 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666077	30,174,355 - 30,209,750 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Myl4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624849	1,982,068 - 1,994,930 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624849	1,982,217 - 2,027,005 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Myl4
382 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	125
Count of miRNA genes:	104
Interacting mature miRNAs:	110
Transcripts:	ENSRNOT00000072480
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6357896	96121100	Rat
2303118	Mamtr7	Mammary tumor resistance QTL 7		0.003	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	9658275	104670812	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14487011	104060283	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14487011	107057807	Rat
1554317	Bmd4	Bone mineral density QTL 4	9.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	19816042	99406971	Rat
724556	Pur2	Proteinuria QTL 2	5.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	22427500	90627625	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
1298069	Bp168	Blood pressure QTL 168	5.5		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	10	26521957	98003205	Rat
631542	Bp82	Blood pressure QTL 82	6.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	26521957	98952741	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29299504	107211142	Rat
1576308	Schws1	Schwannoma susceptibility QTL 1		0.0041	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	40035094	102359817	Rat
631269	Cia22	Collagen induced arthritis QTL 22	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
631270	Cia23	Collagen induced arthritis QTL 23	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
1298078	Stresp5	Stress response QTL 5	2.99	0.00025	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	42045676	104670812	Rat
2300218	Hpcl2	Hepatic cholesterol level QTL 2			liver cholesterol amount (VT:0010498)	liver cholesterol level (CMO:0001597)	10	45029650	95600334	Rat
631547	Bp87	Blood pressure QTL 87	4.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	47369470	92369470	Rat
1549846	Scl47	Serum cholesterol level QTL 47	3.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	10	50574707	95574707	Rat
70364	Bp72	Blood pressure QTL 72			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	51121100	96121100	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	51770177	107211142	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	51770177	107211142	Rat
1359017	Hrtrt21	Heart rate QTL 21	2.4		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	10	51772940	96772940	Rat
631530	Tls3	T-lymphoma susceptibility QTL 3	0	0.0001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	10	51774612	95600334	Rat
631535	Cm51	Cardiac mass QTL 51	3		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	10	51786282	91669536	Rat
70171	Cari1	Carrageenan-induced inflammation QTL 1	4.9	0.0005	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	10	53797385	107211142	Rat
70164	Bw21	Body weight QTL 21	4.36	0.00005	body mass (VT:0001259)	body weight (CMO:0000012)	10	53797494	98952626	Rat
1354608	Cm33	Cardiac mass QTL 33	2.8		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	10	54809292	99809292	Rat
2312662	Slep8	Serum leptin concentration QTL 8		0.05	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	10	57134272	102134272	Rat
2312668	Scl65	Serum cholesterol level QTL 65		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	10	57134272	102134272	Rat
2312672	Insul15	Insulin level QTL 15		0.01	blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	10	57134272	102134272	Rat
1549831	Bss6	Bone structure and strength QTL 6	4		lumbar vertebra strength trait (VT:0010574)	vertebra ultimate force (CMO:0001678)	10	57576521	102576521	Rat
2293698	Bss43	Bone structure and strength QTL 43	5.33	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra cross-sectional area (CMO:0001689)	10	59209888	104209888	Rat
2306970	Anxrr22	Anxiety related response QTL 22	5.95		fear/anxiety-related behavior trait (VT:1000241)	number of periods of voluntary immobility (CMO:0001045)	10	61345276	98211570	Rat
6893336	Cm75	Cardiac mass QTL 75	0.1	0.87	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	10	61345276	99703528	Rat
1558643	Cm44	Cardiac mass QTL 44	4.8	0.0000368	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	61345276	99703528	Rat
2313103	Bss80	Bone structure and strength QTL 80	2	0.0001	tibia strength trait (VT:1000284)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	10	62057807	107057807	Rat
2313105	Bss79	Bone structure and strength QTL 79	1.8	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	62057807	107057807	Rat
61449	Ciaa2	CIA Autoantibody QTL 2	7.1		blood autoantibody amount (VT:0003725)	calculated serum anti-type 2 collagen antibody titer (CMO:0001279)	10	63221094	107211142	Rat
1357344	Bp249	Blood pressure QTL 249		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	66743655	98003205	Rat
2317029	Aia19	Adjuvant induced arthritis QTL 19	2.98		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	10	66978955	107211142	Rat
2317039	Aia6	Adjuvant induced arthritis QTL 6	4.31		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	10	66978955	107211142	Rat
10450498	Bp384	Blood pressure QTL 384		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	67750049	107211142	Rat
1642980	Bp300	Blood pressure QTL 300			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	68383129	107211142	Rat
61396	Bp9	Blood pressure QTL 9	4.8	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	68420376	107211142	Rat
2300172	Bmd57	Bone mineral density QTL 57	9.8	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	10	69738412	107211142	Rat
2293646	Bss25	Bone structure and strength QTL 25	10.96	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	10	69738412	107211142	Rat
2293663	Bss33	Bone structure and strength QTL 33	9.34	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	10	69738412	107211142	Rat
6893366	Bw106	Body weight QTL 106	0.3	0.47	body mass (VT:0001259)	body weight (CMO:0000012)	10	70199100	107211142	Rat
70193	Mcs7	Mammary carcinoma susceptibility QTL 7	2.38		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	10	72224939	107211142	Rat
2298548	Neuinf7	Neuroinflammation QTL 7	3.4		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	10	72224939	107211142	Rat
2306793	Ean5	Experimental allergic neuritis QTL 5	4.7		nervous system integrity trait (VT:0010566)	IFNG-secreting splenocyte count (CMO:0002122)	10	72552416	93995749	Rat
1358188	Ept9	Estrogen-induced pituitary tumorigenesis QTL 9	3.9		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	10	73453136	96120911	Rat
2292617	Ept18	Estrogen-induced pituitary tumorigenesis QTL 18	3.9		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	10	73453136	96120911	Rat
1579919	Bp281	Blood pressure QTL 281		0.01	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	74372084	94965338	Rat
10450495	Bp383	Blood pressure QTL 383		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	76246085	94965338	Rat
2292438	Bp311	Blood pressure QTL 311			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	76246085	107211142	Rat
1302404	Cia27	Collagen induced arthritis QTL 27	2.6	0.0045	joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	10	76452683	107211142	Rat
4889492	Pancm2	Pancreatic morphology QTL 2	3.2		pancreatic beta cell morphology trait (VT:0005217)	ratio of insulin-positive cell area to total area of splenic region of pancreas (CMO:0001814)	10	76748906	107211142	Rat
1300107	Rf18	Renal function QTL 18	3.41		urine output (VT:0003620)	timed urine volume (CMO:0000260)	10	78775516	98279596	Rat
631555	Bp134	Blood pressure QTL 134		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	80515287	91230079	Rat
6893357	Bw102	Body weight QTL 102	0.5	0.36	body mass (VT:0001259)	body weight (CMO:0000012)	10	80515287	101325465	Rat
2303589	Bw87	Body weight QTL 87	2		body mass (VT:0001259)	body weight (CMO:0000012)	10	81285008	107211142	Rat
4889948	Bss91	Bone structure and strength QTL 91	4		tibia area (VT:1000281)	tibia midshaft total cross-sectional area (CMO:0001715)	10	82564856	92369470	Rat
2317754	Glom25	Glomerulus QTL 25	3.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	82685200	107211142	Rat
12880055	Am11	Aortic mass QTL 11		0.004	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	84007272	95933025	Rat
2301398	Kidm38	Kidney mass QTL 38		0.002	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	10	84007272	95933025	Rat
2306792	Ean4	Experimental allergic neuritis QTL 4	4		nervous system integrity trait (VT:0010566)	IFNG-secreting splenocyte count (CMO:0002122)	10	84022321	93995963	Rat
1600367	Mcs15	Mammary carcinoma susceptibility QTL 15	4.5		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	10	85565469	103884409	Rat
631538	Oia5	Oil induced arthritis QTL 5			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	87055121	107211142	Rat
2313856	Bp342	Blood pressure QTL 342	4.4	0.0001	life span trait (VT:0005372)	age at time of death (CMO:0001193)	10	87307617	96121100	Rat
61363	Oia3	Oil induced arthritis QTL 3		0.001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	87307617	107211142	Rat
634320	Niddm49	Non-insulin dependent diabetes mellitus QTL 49	4.41		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	10	88539139	107211142	Rat

Markers in Region

D11Mit58

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	89,475,269 - 89,475,528 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	92,627,420 - 92,627,678	NCBI	Rnor6.0
Rnor_5.0	10	92,389,189 - 92,389,447	UniSTS	Rnor5.0
Celera	10	88,169,024 - 88,169,282	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High		26
Medium	2	14	6	4	2	4	8	11			16	9	8
Low	1	3	49	35	17	35			74	29	25	2
Below cutoff			2	2		2				6

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001109495	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039086841	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039086842	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039086843	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039086844	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ217482	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000220	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000072480 ⟹ ENSRNOP00000064224

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	89,449,443 - 89,485,361 (+)	Ensembl
Rnor_6.0 Ensembl	10	92,628,356 - 92,638,100 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000101539 ⟹ ENSRNOP00000077343

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	89,449,443 - 89,485,363 (+)	Ensembl

RefSeq Acc Id:

NM_001109495 ⟹ NP_001102965

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	10	89,476,206 - 89,485,365 (+)	NCBI
Rnor_6.0	10	92,628,356 - 92,638,100 (+)	NCBI
Rnor_5.0	10	92,390,125 - 92,398,028 (+)	NCBI
Celera	10	88,169,960 - 88,178,967 (+)	RGD

Sequence:

show sequence

CCATCTTCCTCTCAGGAGCCACCTTTCCTCAGTTTTTAGGTCCCACGTCCACTGGAGATCCTAA
GGCAGCATGCCTCCCAAGAAGCCTGAGCCCAAGAAGGAGACTGCCAAGGCAGCCGCAGCCCCTG
CCCCAGCTCCTGCCCCAGCTCCCGAGCCCCTCAGGGACTCTGCCTTTGATCCCAAGAGTGTGAA
GATAGACTTCAGTGCCGACCAGATCGAAGAATTCAAAGAGGCCTTTTCATTGTTTGACCGGACT
CCAACTGGAGAGATGAAAATCACCTATGGGCAGTGTGGGGACGTGCTGCGGGCCCTGGGCCAGA
ACCCCACCAACGCAGAGGTGCTGCGAGTTTTGGGCAAACCCAAGCCTGAAGAGATGAATTCCAA
GACACTGGACTTCGAGATGTTCCTGCCCATCCTGCAGCACATCTCCCGCAACAAGGAGCAGGGC
ACCTATGAGGACTTCGTGGAGGGGCTGCGGGTCTTTGACAAAGAAAGCAACGGCACAGTCATGG
GCGCCGAGCTTCGGCATGTCCTCGCCACCCTGGGAGAGAAGATGAGCGAGGCTGAGGTGGAGCA
GCTGTTGACTGGGCAGGAGGATGCCAACGGATGCATCAACTATGAAGCCTTTGTCAAGCATGTC
ATGTCCGGGTAAAGACATTTCTCCAAGGTGCTTGGCCCCGCGTGAGTAAGGGAGAGAGCCATGG
TGGTTGTTACGGAGCACTGGACTCATACTGGCCTCGCAGACCCACGGCCTCCCCTGTAAATAAA
GAAGCCCAGTGTGGAGTCTCACCAATC

hide sequence

RefSeq Acc Id:

XM_039086841 ⟹ XP_038942769

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	10	89,449,938 - 89,485,363 (+)	NCBI

RefSeq Acc Id:

XM_039086842 ⟹ XP_038942770

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	10	89,449,456 - 89,485,363 (+)	NCBI

RefSeq Acc Id:

XM_039086843 ⟹ XP_038942771

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	10	89,449,784 - 89,485,363 (+)	NCBI

RefSeq Acc Id:

XM_039086844 ⟹ XP_038942772

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	10	89,449,963 - 89,485,363 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001102965	(Get FASTA)	NCBI Sequence Viewer
	XP_038942769	(Get FASTA)	NCBI Sequence Viewer
	XP_038942770	(Get FASTA)	NCBI Sequence Viewer
	XP_038942771	(Get FASTA)	NCBI Sequence Viewer
	XP_038942772	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM06319	(Get FASTA)	NCBI Sequence Viewer
	P17209	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001102965 ⟸ NM_001109495
- UniProtKB:	M0R4E1 (UniProtKB/TrEMBL), A6HJW5 (UniProtKB/TrEMBL), A0A8I5YBR7 (UniProtKB/TrEMBL)
- Sequence:	show sequence MPPKKPEPKKETAKAAAAPAPAPAPAPEPLRDSAFDPKSVKIDFSADQIEEFKEAFSLFDRTPT GEMKITYGQCGDVLRALGQNPTNAEVLRVLGKPKPEEMNSKTLDFEMFLPILQHISRNKEQGTY EDFVEGLRVFDKESNGTVMGAELRHVLATLGEKMSEAEVEQLLTGQEDANGCINYEAFVKHVMS G hide sequence

RefSeq Acc Id:

ENSRNOP00000064224 ⟸ ENSRNOT00000072480

RefSeq Acc Id:	XP_038942770 ⟸ XM_039086842
- Peptide Label:	isoform X1
- UniProtKB:	M0R4E1 (UniProtKB/TrEMBL), A6HJW5 (UniProtKB/TrEMBL), A0A8I5YBR7 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038942771 ⟸ XM_039086843
- Peptide Label:	isoform X1
- UniProtKB:	M0R4E1 (UniProtKB/TrEMBL), A6HJW5 (UniProtKB/TrEMBL), A0A8I5YBR7 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038942769 ⟸ XM_039086841
- Peptide Label:	isoform X1
- UniProtKB:	M0R4E1 (UniProtKB/TrEMBL), A6HJW5 (UniProtKB/TrEMBL), A0A8I5YBR7 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038942772 ⟸ XM_039086844
- Peptide Label:	isoform X1
- UniProtKB:	M0R4E1 (UniProtKB/TrEMBL), A6HJW5 (UniProtKB/TrEMBL), A0A8I5YBR7 (UniProtKB/TrEMBL)

RefSeq Acc Id:

ENSRNOP00000077343 ⟸ ENSRNOT00000101539

Protein Domains

EF-hand

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P17209-F1-model_v2	AlphaFold	P17209	1-193	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1591197	AgrOrtholog
BioCyc Gene	G2FUF-23014	BioCyc
Ensembl Genes	ENSRNOG00000050675	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000064224	ENTREZGENE
	ENSRNOP00000064224.1	UniProtKB/TrEMBL
	ENSRNOP00000077343.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000072480	ENTREZGENE
	ENSRNOT00000072480.2	UniProtKB/TrEMBL
	ENSRNOT00000101539.1	UniProtKB/TrEMBL
Gene3D-CATH	EF-hand	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	EF-hand-dom_pair	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	EF_hand_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:688228	UniProtKB/TrEMBL
NCBI Gene	688228	ENTREZGENE
PANTHER	MYOSIN LIGHT CHAIN 1, 3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	MYOSIN LIGHT CHAIN 4	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Myl4	PhenoGen
PROSITE	EF_HAND_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF47473	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I5YBR7	ENTREZGENE, UniProtKB/TrEMBL
	A6HJW5	ENTREZGENE, UniProtKB/TrEMBL
	M0R4E1	ENTREZGENE, UniProtKB/TrEMBL
	MYL4_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2011-01-13	Myl4	myosin, light chain 4	Myl4	myosin, light chain 4	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2010-11-29	Myl4	myosin, light chain 4	LOC688228	similar to Myosin light polypeptide 4 (Myosin light chain 1, atrial isoform)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-20	LOC688228	similar to Myosin light polypeptide 4 (Myosin light chain 1, atrial isoform)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM