Zmat2 (zinc finger, matrin type 2)

Advanced Search (OLGA)

Gene: Zmat2 (zinc finger, matrin type 2) Rattus norvegicus

Analyze

Symbol:

Zmat2

Name:

zinc finger, matrin type 2

RGD ID:

1583592

Description:

Predicted to enable ATP binding activity; nucleic acid binding activity; and zinc ion binding activity. Predicted to be involved in mRNA splicing, via spliceosome. Predicted to be located in nucleus. Predicted to be part of U2-type precatalytic spliceosome and U4/U6 x U5 tri-snRNP complex. Orthologous to human ZMAT2 (zinc finger matrin-type 2); PARTICIPATES IN spliceosome pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; amitrole.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC679898; similar to zinc finger, matrin type 2; zinc finger matrin-type protein 2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ZMAT2 (zinc finger matrin-type 2)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Zmat2 (zinc finger, matrin type 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Zmat2 (zinc finger matrin-type 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ZMAT2 (zinc finger matrin-type 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ZMAT2 (zinc finger matrin-type 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Zmat2 (zinc finger matrin-type 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ZMAT2 (zinc finger matrin-type 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ZMAT2 (zinc finger matrin-type 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Zmat2 (zinc finger matrin-type 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	HARS2 (histidyl-tRNA synthetase 2, mitochondrial)	HGNC	EggNOG, Ensembl, Inparanoid, OrthoDB, Treefam
Alliance orthologs ³
Homo sapiens (human):	ZMAT2 (zinc finger matrin-type 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Zmat2 (zinc finger, matrin type 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	zmat2 (zinc finger, matrin-type 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG11586	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	SNU23	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	snu-23	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	zmat2	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	18	28,683,617 - 28,688,252 (+)	NCBI		GRCr8
mRatBN7.2	18	28,409,606 - 28,414,241 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	28,398,795 - 28,414,747 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	18	28,536,739 - 28,541,374 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	29,298,815 - 29,303,450 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	28,634,043 - 28,638,678 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	29,639,991 - 29,644,626 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	29,639,872 - 29,644,652 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	18	29,343,457 - 29,348,092 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	18	29,493,269 - 29,497,904 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	18	28,130,152 - 28,134,786 (+)	NCBI		Celera
Cytogenetic Map	18	p11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autosomal dominant intellectual developmental disorder 31 (ISO)

familial adenomatous polyposis 1 (ISO)

Hereditary Neoplastic Syndromes (ISO)

Neurodevelopmental Disorders (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

6-propyl-2-thiouracil (EXP)

acrolein (ISO)

aflatoxin B1 (ISO)

alpha-pinene (ISO)

amitrole (EXP)

aristolochic acid A (ISO)

benzo[a]pyrene (ISO)

beta-lapachone (ISO)

bisphenol A (EXP,ISO)

CGP 52608 (ISO)

chlorpyrifos (ISO)

copper atom (ISO)

copper(0) (ISO)

dicrotophos (ISO)

disulfiram (ISO)

doxorubicin (ISO)

folic acid (ISO)

methimazole (EXP)

mono(2-ethylhexyl) phthalate (ISO)

N-nitrosodiethylamine (EXP)

ozone (ISO)

paracetamol (ISO)

pentachlorophenol (ISO)

phenobarbital (EXP)

sulfadimethoxine (EXP)

titanium dioxide (ISO)

trichloroethene (EXP)

triphenyl phosphate (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Yessotoxin (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

histidyl-tRNA aminoacylation (IBA)

mRNA splicing, via spliceosome (IBA,ISO)

Cellular Component

cytosol (IBA)

mitochondrion (IBA)

nucleus (ISO)

U2-type precatalytic spliceosome (ISO)

U4/U6 x U5 tri-snRNP complex (IBA)

Molecular Function

ATP binding (IEA)

histidine-tRNA ligase activity (IBA)

identical protein binding (IBA)

nucleic acid binding (IEA)

protein binding (ISO)

RNA binding (IBA)

zinc ion binding (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

spliceosome pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
3.	GOA pipeline	RGD automated data pipeline
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:28781166	PMID:32005145

Genomics

Comparative Map Data

Zmat2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	18	28,683,617 - 28,688,252 (+)	NCBI		GRCr8
mRatBN7.2	18	28,409,606 - 28,414,241 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	28,398,795 - 28,414,747 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	18	28,536,739 - 28,541,374 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	29,298,815 - 29,303,450 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	28,634,043 - 28,638,678 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	29,639,991 - 29,644,626 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	29,639,872 - 29,644,652 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	18	29,343,457 - 29,348,092 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	18	29,493,269 - 29,497,904 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	18	28,130,152 - 28,134,786 (+)	NCBI		Celera
Cytogenetic Map	18	p11	NCBI

ZMAT2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	140,700,447 - 140,706,686 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	140,698,680 - 140,706,686 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	5	140,080,032 - 140,086,271 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	140,060,216 - 140,066,423 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	5	140,060,215 - 140,066,423	NCBI
Celera	5	136,156,780 - 136,162,987 (+)	NCBI		Celera
Cytogenetic Map	5	q31.3	NCBI
HuRef	5	135,225,283 - 135,231,489 (+)	NCBI		HuRef
CHM1_1	5	139,513,287 - 139,519,494 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	5	141,225,840 - 141,232,080 (+)	NCBI		T2T-CHM13v2.0

Zmat2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	18	36,926,976 - 36,932,713 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	18	36,926,929 - 36,932,719 (+)	Ensembl		GRCm39 Ensembl
GRCm38	18	36,793,923 - 36,799,660 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	18	36,793,876 - 36,799,666 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	18	36,953,577 - 36,959,314 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	18	36,919,897 - 36,925,634 (+)	NCBI		MGSCv36	mm8
Celera	18	37,245,957 - 37,251,695 (+)	NCBI		Celera
Cytogenetic Map	18	B2	NCBI
cM Map	18	19.46	NCBI

Zmat2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955418	1,633 - 10,844 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955418	4,335 - 10,844 (-)	NCBI	ChiLan1.0	ChiLan1.0

ZMAT2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	4	135,958,207 - 135,964,505 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	5	134,097,839 - 134,104,056 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	136,065,016 - 136,071,333 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	142,180,981 - 142,187,294 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	142,180,981 - 142,187,292 (+)	Ensembl	panpan1.1		panPan2

ZMAT2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	35,851,972 - 35,860,818 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	35,852,109 - 35,858,065 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	32,891,058 - 32,899,813 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	36,307,705 - 36,316,471 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	36,307,742 - 36,316,471 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	33,359,792 - 33,368,549 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	34,227,918 - 34,236,665 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	34,980,511 - 34,989,269 (+)	NCBI		UU_Cfam_GSD_1.0

Zmat2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	151,971,143 - 151,978,212 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936531	9,630,958 - 9,641,948 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936531	9,633,460 - 9,640,366 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ZMAT2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	142,411,089 - 142,419,137 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	142,410,970 - 142,417,012 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	148,355,582 - 148,361,604 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ZMAT2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	23	43,333,078 - 43,340,082 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	23	43,333,164 - 43,339,163 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666034	34,516,814 - 34,523,942 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Zmat2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624743	33,444,432 - 33,451,490 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Zmat2
9 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	204
Count of miRNA genes:	146
Interacting mature miRNAs:	161
Transcripts:	ENSRNOT00000021516
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331733	Bp233	Blood pressure QTL 233	3.97196		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	24796977	79788953	Rat
1358358	Sradr6	Stress Responsive Adrenal Weight QTL 6	2.49		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	18	11944299	59330563	Rat
1331735	Rf44	Renal function QTL 44	2.981		urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	18	18234564	31359530	Rat
61382	Bp46	Blood pressure QTL 46	18.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	11941791	31393320	Rat
2301413	Bp318	Blood pressure QTL 318		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	26548082	46969551	Rat
1331741	Bp232	Blood pressure QTL 232	3.59112		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	21372893	83213037	Rat
61388	Bp2	Blood pressure QTL 2	3.23		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	1	35374722	Rat
6903359	Bp355	Blood pressure QTL 355	3.6		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	11944544	59796478	Rat
12904668	Bw188	Body weight QTL 188		0.03	body mass (VT:0001259)	body weight (CMO:0000012)	18	26548082	46969551	Rat
2313082	Bss85	Bone structure and strength QTL 85	0.8	0.0001	long bone metaphysis morphology trait (VT:0000133)	tibia midshaft total cross-sectional area (CMO:0001715)	18	14951337	59951337	Rat
12904669	Cm125	Cardiac mass QTL 125		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	18	26548082	46969551	Rat
1641923	Colcr8	Colorectal carcinoma resistance QTL 8	3.1	0.0014	intestine integrity trait (VT:0010554)	poorly differentiated malignant colorectal tumor number (CMO:0002076)	18	22066242	52293055	Rat
12904670	Cm126	Cardiac mass QTL 126		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	18	26548082	46969551	Rat
2312568	Glom21	Glomerulus QTL 21	2	0.005	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	18	5185858	40503530	Rat
12904677	Kidm72	Kidney mass QTL 72		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	18	26548082	46969551	Rat
1331766	Bp236	Blood pressure QTL 236	3.022		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	11944299	31359530	Rat
1358193	Emca2	Estrogen-induced mammary cancer QTL 2	1.6		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	18	18007599	63571040	Rat
12904673	Cm127	Cardiac mass QTL 127		0.005	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	18	26548082	46969551	Rat
12904675	Am19	Aortic mass QTL 19		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	18	26548082	46969551	Rat
631264	Scl22	Serum cholesterol level QTL 22	6.2		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	18	11941791	31393320	Rat
1331775	Bp235	Blood pressure QTL 235	3.201		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	18234564	31359530	Rat
2325839	Bp348	Blood pressure QTL 348		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	25570985	70570985	Rat
1600373	Mamtr6	Mammary tumor resistance QTL 6			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	18	19278901	83218561	Rat
2293708	Bss46	Bone structure and strength QTL 46	8.8	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	18	11791518	63636873	Rat
9589153	Insul31	Insulin level QTL 31	7.15	0.05	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	18	1	42547119	Rat
1578667	Bss21	Bone structure and strength QTL 21	3.5		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	18	11791518	83218561	Rat
2312598	Bp340	Blood pressure QTL 340		0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	1	30558703	Rat
2300180	Bmd67	Bone mineral density QTL 67	4.8	0.0001	femur mineral mass (VT:0010011)	bone mineral density (CMO:0001226)	18	1	34291613	Rat
2299160	Iddm35	Insulin dependent diabetes mellitus QTL 35	2.79		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	18	4207941	60377792	Rat
1578661	Bss20	Bone structure and strength QTL 20	3.7		femur morphology trait (VT:0000559)	femoral neck cross-sectional area (CMO:0001697)	18	11791518	83218561	Rat
1331753	Bp231	Blood pressure QTL 231	3.643		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	11944299	52293055	Rat
2293661	Bss50	Bone structure and strength QTL 50	4.64	0.0003	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	18	1	34291613	Rat
61375	Bp41	Blood pressure QTL 41	2.4		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	18	11944299	41122201	Rat

Markers in Region

RH131148

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	28,407,852 - 28,408,035 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	29,638,238 - 29,638,420	NCBI	Rnor6.0
Rnor_5.0	18	29,341,704 - 29,341,886	UniSTS	Rnor5.0
RGSC_v3.4	18	29,491,516 - 29,491,698	UniSTS	RGSC3.4
Celera	18	28,128,399 - 28,128,581	UniSTS
Cytogenetic Map	18	p11	UniSTS

RH132656

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	28,413,866 - 28,414,085 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	29,644,252 - 29,644,470	NCBI	Rnor6.0
Rnor_5.0	18	29,347,718 - 29,347,936	UniSTS	Rnor5.0
RGSC_v3.4	18	29,497,530 - 29,497,748	UniSTS	RGSC3.4
Celera	18	28,134,412 - 28,134,630	UniSTS
RH 3.4 Map	18	419.2	UniSTS
Cytogenetic Map	18	p11	UniSTS

UniSTS:237786

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	28,413,146 - 28,413,271 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	29,643,532 - 29,643,656	NCBI	Rnor6.0
Rnor_5.0	18	29,346,998 - 29,347,122	UniSTS	Rnor5.0
RGSC_v3.4	18	29,496,810 - 29,496,934	UniSTS	RGSC3.4
Cytogenetic Map	18	p11	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001135582	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473974	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219839	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220026	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ224899	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000018	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000021516 ⟹ ENSRNOP00000021516

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	18	28,409,600 - 28,414,747 (+)	Ensembl
Rnor_6.0 Ensembl	18	29,639,872 - 29,644,652 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000021797 ⟹ ENSRNOP00000021797

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	18	28,398,817 - 28,408,062 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000095646 ⟹ ENSRNOP00000078926

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	18	28,398,817 - 28,408,062 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000097043 ⟹ ENSRNOP00000085580

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	18	28,401,158 - 28,408,075 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000104252 ⟹ ENSRNOP00000090091

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	18	28,398,811 - 28,413,484 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000112291 ⟹ ENSRNOP00000085665

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	18	28,398,795 - 28,407,560 (+)	Ensembl

RefSeq Acc Id:

NM_001135582 ⟹ NP_001129054

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	28,683,617 - 28,688,252 (+)	NCBI
mRatBN7.2	18	28,409,606 - 28,414,241 (+)	NCBI
Rnor_6.0	18	29,639,991 - 29,644,626 (+)	NCBI
Rnor_5.0	18	29,343,457 - 29,348,092 (+)	NCBI
RGSC_v3.4	18	29,493,269 - 29,497,904 (+)	RGD
Celera	18	28,130,152 - 28,134,786 (+)	RGD

Sequence:

show sequence

ATGGCGTCTGGCAGCGGGACAAAAAACTTGGACTTTCGCCGAAAGTGGGACAAAGATGAATATG
AGAAGCTCGCGGAGAAGAGACTCACAGAAGAGAGAGAAAAGAAGGATGGAAAACCAGTGCAGCC
AGTTAAGCGGGAGCTTCTACGGCACAGGGATTACAAGGTGGACTTGGAGTCCAAGCTTGGGAAG
ACAATTGTTATCACCAAGACCACCCCACAGTCTGAAATGGGAGGCTACTACTGCAATGTCTGTG
ACTGTGTGGTGAAGGACTCCATTAACTTCCTGGATCACATTAATGGAAAGAAACATCAGCGAAA
CCTGGGTATGTCTATGCGCGTGGAACGTTCCACTCTGGATCAGGTAAAGAAACGTTTTGAGGTT
AACAAGAAGAAGATGGAGGAGAAGCAGAAAGATTATGATTTTGAGGAAAGGATGAAGGAGCTCA
GAGAAGAGGAGGAAAAGGCTAAAGCATACAAGAAAGAGAAACAGAAGGAGAAGAAAAGGAGGGC
CGAGGAGGACTTGACTTTTGAGGAGGAGGATGAAATGGCAGCTGTGATGGGCTTCTCTGGCTTT
GGTTCTACCAAGAAGAGTTACTGAAGCGTTCTCTGTGGCCTAACTTTGGCCTTTACTGGACCTA
ACTTTGAGTGTGTGTTGAGGTGGGGTGGGGGTGTCATTTCTTTTTTGGGTACTGGAGAAGGTCC
TTAAGAGTGTTAATGGGCAGGGCTAGAGGGTGGGTGTTTGTGGTTTCCCTCTACGTTAGGAGAG
GGCACAGGATGTAGAGGAGACGCTGTGGCGTATTCCTTCTGCCTCAGTACATTACTGGAGTCAC
AGAACCTCTGCCCGTCTGTGTTCCCAATAAAGAAAGATCTCCCTCTTTGAGACTGCTTTCCCCA
AATTCCCCTGCATCTTTCCCTCTTCATCTTTCCACCTTTTGTCTGAACATCCTCCTTTTTCCTG
TGTCCTGCTATTGTTTTAATTTTTACTTTTGTTCAGCTTGCAACAGAAGGGTTTTCTGAGTCTC
CAGTATGCAGGTGCTGGCATATCCTTGGCCCAGCTCTTCCTCCCATCCCACCCAGCGGTTCTCT
ACCCACTTGTGCATGCATGTGATTTCTGCCTGGGTCAATGTGTGTGTGGGTATGTGTGCATGAT
GTGTCACAAAGAGGGGACCTGGGCTAGAATCTCAGAGCATTGTTGCCCTGAGACCTAATGTTCT
TGGTTTCCTCGGTGCATGTAACAGGATATTAAATGGGATGAGTGTTTGGTGTGGTTTGTGTCTG
GTGAGTTTTTAACCTTGTTTCTTCCGTTTCACTTCATTGAGGATTTCTGGTTTTGTCTTCCTTG
GGAATGGTTCTTGGAAGAACCTGTTTGATGCAAAAAAGAAAGCAACAAAACAACCCTAAAACCA
AACAAAGAAACTCATGCGGGGAGACCCCGGTTCTCAGACACTGTTCAACATGTACAATAAATGA
CAGTGATGAGGCCTGCTTCACATTTGTTGGGAACATGTCCATATCATTCCCTGCCCCACACATT
CCTACACCAAGAATTTCTATAGAGCCTTTCTATAGAGCCTTTCAACACCCCTCCCCCCTTACAT
AGAGGTTTCCTTAGTGTGAGTTTTTCCCTCTGCAGATAGGCACAGGATCTGTGCCCTTGGGAGT
CCAAACAAAACATTTCAGTCCCCTATAATTTTCGTCCCCTCTGATCTTCCTAGGAGAACTCAGG
GTTAAACTTAACTATCTGCACTTGGGCGGGCACTTGACTCTGCTTGCCTCTCCAGTGTTGAGAT
TAAAGGTGTGCCCTCCA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001129054	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL76323	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000021516.4
	ENSRNOP00000085580.1
	ENSRNOP00000085665.1
	ENSRNOP00000090091.1

RefSeq Acc Id:

NP_001129054 ⟸ NM_001135582

- UniProtKB:

D4AD01 (UniProtKB/TrEMBL), A6J341 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MASGSGTKNLDFRRKWDKDEYEKLAEKRLTEEREKKDGKPVQPVKRELLRHRDYKVDLESKLGK
TIVITKTTPQSEMGGYYCNVCDCVVKDSINFLDHINGKKHQRNLGMSMRVERSTLDQVKKRFEV
NKKKMEEKQKDYDFEERMKELREEEEKAKAYKKEKQKEKKRRAEEDLTFEEEDEMAAVMGFSGF
GSTKKSY

hide sequence

Ensembl Acc Id:

ENSRNOP00000021516 ⟸ ENSRNOT00000021516

Ensembl Acc Id:

ENSRNOP00000085665 ⟸ ENSRNOT00000112291

Ensembl Acc Id:

ENSRNOP00000078926 ⟸ ENSRNOT00000095646

Ensembl Acc Id:

ENSRNOP00000021797 ⟸ ENSRNOT00000021797

Ensembl Acc Id:

ENSRNOP00000085580 ⟸ ENSRNOT00000097043

Ensembl Acc Id:

ENSRNOP00000090091 ⟸ ENSRNOT00000104252

Protein Domains

Aminoacyl-transfer RNA synthetases class-II family U1-type

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4AD01-F1-model_v2	AlphaFold	D4AD01	1-199	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13700732

Promoter ID:

EPDNEW_R11256

Type:

multiple initiation site

Name:

Zmat2_1

Description:

zinc finger, matrin type 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	18	29,639,977 - 29,640,037	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1583592	AgrOrtholog
BioCyc Gene	G2FUF-7854	BioCyc
Ensembl Genes	ENSRNOG00000016016	Ensembl
	ENSRNOG00000016087	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000021516.8	UniProtKB/TrEMBL
	ENSRNOT00000097043.1	UniProtKB/TrEMBL
	ENSRNOT00000104252.1	UniProtKB/TrEMBL
	ENSRNOT00000112291.1	UniProtKB/TrEMBL
Gene3D-CATH	3.40.50.800	UniProtKB/TrEMBL
	Classic Zinc Finger	UniProtKB/TrEMBL
InterPro	aa-tRNA-synth_II	UniProtKB/TrEMBL
	aa-tRNA-synth_II/BPL/LPL	UniProtKB/TrEMBL
	Anticodon-bd	UniProtKB/TrEMBL
	Anticodon-bd_dom_sf	UniProtKB/TrEMBL
	His-tRNA-ligase	UniProtKB/TrEMBL
	HisRS-like_core	UniProtKB/TrEMBL
	HisRS/HisZ	UniProtKB/TrEMBL
	HisRS_anticodon	UniProtKB/TrEMBL
	Snu23	UniProtKB/TrEMBL
	Znf_C2H2_jaz	UniProtKB/TrEMBL
	Znf_C2H2_sf	UniProtKB/TrEMBL
	Znf_U1	UniProtKB/TrEMBL
KEGG Report	rno:679898	UniProtKB/TrEMBL
NCBI Gene	679898	ENTREZGENE
PANTHER	HISTIDINE--TRNA LIGASE, MITOCHONDRIAL	UniProtKB/TrEMBL
	HISTIDYL-TRNA SYNTHETASE	UniProtKB/TrEMBL
	PTHR45986	UniProtKB/TrEMBL
	ZINC FINGER MATRIN-TYPE PROTEIN 2	UniProtKB/TrEMBL
Pfam	HGTP_anticodon	UniProtKB/TrEMBL
	tRNA-synt_His	UniProtKB/TrEMBL
	zf-C2H2_jaz	UniProtKB/TrEMBL
PhenoGen	Zmat2	PhenoGen
PIRSF	His-tRNA_synth	UniProtKB/TrEMBL
PROSITE	AA_TRNA_LIGASE_II	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000016016	RatGTEx
	ENSRNOG00000016087	RatGTEx
SMART	ZnF_U1	UniProtKB/TrEMBL
Superfamily-SCOP	Class II aaRS ABD-related	UniProtKB/TrEMBL
	SSF55681	UniProtKB/TrEMBL
	SSF57667	UniProtKB/TrEMBL
UniProt	A0A8I6A401_RAT	UniProtKB/TrEMBL
	A0A8I6AB48_RAT	UniProtKB/TrEMBL
	A0A8I6GD20_RAT	UniProtKB/TrEMBL
	A6J341	ENTREZGENE, UniProtKB/TrEMBL
	D4AD01	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-05-24	Zmat2	zinc finger, matrin type 2	LOC683048	similar to zinc finger, matrin type 2	Data merged from RGD:1591560	1643240	APPROVED
2008-03-13	Zmat2	zinc finger, matrin type 2	LOC679898	similar to zinc finger, matrin type 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-20	LOC683048	similar to zinc finger, matrin type 2			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-19	LOC679898	similar to zinc finger, matrin type 2			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Annotations - KEGG (archival)