Trim58 (tripartite motif-containing 58)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Trim58 (tripartite motif-containing 58) Rattus norvegicus

Analyze

Symbol:

Trim58

Name:

tripartite motif-containing 58

RGD ID:

1566174

Description:

Predicted to enable several functions, including dynein heavy chain binding activity; dynein intermediate chain binding activity; and protein homodimerization activity. Predicted to be involved in several processes, including positive regulation of canonical NF-kappaB signal transduction; positive regulation of erythrocyte enucleation; and regulation of nuclear migration along microtubule. Predicted to be active in cytosol and nucleoplasm. Orthologous to human TRIM58 (tripartite motif containing 58); INTERACTS WITH 2,3,7,8-Tetrachlorodibenzofuran; atrazine; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

E3 ubiquitin-protein ligase TRIM58; LOC303167; RGD1566174; tripartite motif-containing protein 58

RGD Orthologs

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	10	43,022,933 - 43,038,984 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	43,022,996 - 43,034,476 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	47,685,505 - 47,696,506 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	47,175,948 - 47,186,946 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	42,679,446 - 42,690,450 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	44,271,587 - 44,282,726 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	44,271,587 - 44,282,726 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	44,076,388 - 44,087,527 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	44,504,886 - 44,515,900 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	10	42,308,739 - 42,319,736 (+)	NCBI		Celera
Cytogenetic Map	10	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Cryopyrin-Associated Periodic Syndromes (ISO)

developmental and epileptic encephalopathy 54 (ISO)

gastrointestinal stromal tumor (ISO)

genetic disease (ISO)

Neurodevelopmental Disorders (ISO)

parathyroid carcinoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

2,3,7,8-Tetrachlorodibenzofuran (EXP)

atrazine (EXP,ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

chlorpyrifos (ISO)

copper(II) sulfate (ISO)

Cuprizon (EXP)

cyclophosphamide (EXP)

cyclosporin A (ISO)

diallyl trisulfide (ISO)

lead(0) (ISO)

lipopolysaccharide (ISO)

N-methyl-4-phenylpyridinium (ISO)

rotenone (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

sunitinib (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

innate immune response (IBA)

positive regulation of autophagy (IBA)

positive regulation of canonical NF-kappaB signal transduction (IBA)

positive regulation of erythrocyte enucleation (ISO)

protein autoubiquitination (IEA,ISO)

protein polyubiquitination (IBA,ISO)

regulation of nuclear migration along microtubule (ISO)

regulation of protein localization (IBA)

regulation of viral entry into host cell (IBA)

ubiquitin-dependent protein catabolic process (ISO)

Cellular Component

cytoplasm (IBA)

cytosol (IBA)

nucleoplasm (IBA)

Molecular Function

dynein heavy chain binding (ISO)

dynein intermediate chain binding (ISO)

protein homodimerization activity (IBA)

protein kinase binding (IBA)

ubiquitin protein ligase activity (IBA,ISO)

zinc ion binding (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:25241935

Genomics

Comparative Map Data

Trim58
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	10	43,022,933 - 43,038,984 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	43,022,996 - 43,034,476 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	47,685,505 - 47,696,506 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	47,175,948 - 47,186,946 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	42,679,446 - 42,690,450 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	44,271,587 - 44,282,726 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	44,271,587 - 44,282,726 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	44,076,388 - 44,087,527 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	44,504,886 - 44,515,900 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	10	42,308,739 - 42,319,736 (+)	NCBI		Celera
Cytogenetic Map	10	q22	NCBI

TRIM58
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	247,857,187 - 247,880,138 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	247,857,187 - 247,880,138 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	248,020,489 - 248,043,440 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	246,087,124 - 246,110,063 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	244,346,541 - 244,366,917	NCBI
Celera	1	221,312,583 - 221,335,224 (+)	NCBI		Celera
Cytogenetic Map	1	q44	NCBI
HuRef	1	218,409,229 - 218,432,897 (+)	NCBI		HuRef
CHM1_1	1	249,292,796 - 249,315,666 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	247,288,019 - 247,311,943 (+)	NCBI		T2T-CHM13v2.0

Trim58
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	58,531,232 - 58,543,277 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	58,531,291 - 58,543,230 (+)	Ensembl		GRCm39 Ensembl
GRCm38	11	58,640,465 - 58,652,404 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	58,640,465 - 58,652,404 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	58,453,967 - 58,465,906 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	58,456,660 - 58,468,599 (+)	NCBI		MGSCv36	mm8
MGSCv36	11	59,161,114 - 59,172,381 (+)	NCBI		MGSCv36	mm8
Celera	11	63,390,965 - 63,397,420 (+)	NCBI		Celera
Cytogenetic Map	11	B1.3	NCBI
cM Map	11	36.23	NCBI

Trim58
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955613	231,144 - 241,668 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955613	229,567 - 243,019 (+)	NCBI	ChiLan1.0	ChiLan1.0

TRIM58
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	1	1,407,306 - 1,468,264 (-)	NCBI		NHGRI_mPanPan1

TRIM58
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	14	1,582,244 - 1,599,482 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	14	1,576,272 - 1,598,487 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	14	1,219,288 - 1,238,480 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	14	1,300,759 - 1,319,951 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	14	1,304,244 - 1,319,871 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	14	1,485,747 - 1,505,115 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	14	1,271,945 - 1,291,137 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	14	1,260,175 - 1,279,371 (-)	NCBI		UU_Cfam_GSD_1.0

TRIM58
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	55,821,915 - 55,860,382 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	55,822,361 - 55,843,923 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	56,435,682 - 56,475,699 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TRIM58
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	25	84,839,882 - 84,875,608 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666055	87,269,659 - 87,289,659 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants

Variants in Trim58
386 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	107
Count of miRNA genes:	99
Interacting mature miRNAs:	103
Transcripts:	ENSRNOT00000047700
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
70223	Bp57	Blood pressure QTL 57	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	1	80676123	Rat
10401803	Kidm50	Kidney mass QTL 50			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	10	418344	45418344	Rat
631554	Bp133	Blood pressure QTL 133		0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	743364	63851208	Rat
2313064	Bmd71	Bone mineral density QTL 71	0.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	10	5387014	50387014	Rat
2313066	Bss63	Bone structure and strength QTL 63	1.4	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	10	5387014	50387014	Rat
2313081	Bss64	Bone structure and strength QTL 64	1.3	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	10	5387014	50387014	Rat
2313095	Bss62	Bone structure and strength QTL 62	1.5	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	5387014	50387014	Rat
2313104	Bss61	Bone structure and strength QTL 61	0.9	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	10	5387014	50387014	Rat
2298544	Neuinf9	Neuroinflammation QTL 9	4.6		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	10	5801990	62146030	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6154182	73453136	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6357896	96121100	Rat
1578761	Stresp21	Stress response QTL 21	3.3		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	6375746	51375746	Rat
2303118	Mamtr7	Mammary tumor resistance QTL 7		0.003	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	9658275	104670812	Rat
9590310	Scort19	Serum corticosterone level QTL 19	6.3	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
9590268	Scort13	Serum corticosterone level QTL 13	3.26	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
9589136	Insul27	Insulin level QTL 27	10.46	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	10	11474010	56474010	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14487011	89062041	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14487011	104060283	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14487011	107057807	Rat
1354587	Kidm21	Kidney mass QTL 21	3.3		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	10	15028513	60430477	Rat
631564	Apr3	Acute phase response QTL 3	3.9		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	10	15275955	60275955	Rat
6893350	Bw99	Body weight QTL 99	0.87	0.16	body mass (VT:0001259)	body weight (CMO:0000012)	1	15906665	60906665	Rat
6893352	Bw100	Body weight QTL 100	0.33	0.6	body mass (VT:0001259)	body weight (CMO:0000012)	1	15906665	60906665	Rat
631532	Cm50	Cardiac mass QTL 50	6.6		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	10	17907113	51786432	Rat
1598852	Anxrr19	Anxiety related response QTL 19	5.07		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	10	18167841	63167841	Rat
2313055	Bw96	Body weight QTL 96	3.6	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	10	19606483	64606483	Rat
2313087	Bmd80	Bone mineral density QTL 80	3.2	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	10	19606483	64606483	Rat
1554317	Bmd4	Bone mineral density QTL 4	9.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	19816042	99406971	Rat
1581497	Esta1	Estrogen-induced thymic atrophy QTL 1			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	21329805	61345413	Rat
724556	Pur2	Proteinuria QTL 2	5.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	22427500	90627625	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
70224	Eae3	Experimental allergic encephalomyelitis QTL 3	4.1		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	10	26521957	61345413	Rat
1298069	Bp168	Blood pressure QTL 168	5.5		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	10	26521957	98003205	Rat
631542	Bp82	Blood pressure QTL 82	6.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	26521957	98952741	Rat
2300171	Bmd58	Bone mineral density QTL 58	4.9	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	26944628	71944628	Rat
10402859	Bp381	Blood pressure QTL 381		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
2292441	Bp308	Blood pressure QTL 308			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
724527	Bp148	Blood pressure QTL 148		0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	28453136	73453136	Rat
1600371	Mcs21	Mammary carcinoma susceptibility QTL 21	3		mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	28875650	52200160	Rat
1331762	Rf40	Renal function QTL 40	3.873		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	10	29299504	64155584	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29299504	107211142	Rat
631557	Bp136	Blood pressure QTL 136		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	30632053	75632053	Rat
1576311	Pia26	Pristane induced arthritis QTL 26			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	31224026	75632053	Rat
1578779	Tcas10	Tongue tumor susceptibility QTL 10	3.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	10	31297439	76297439	Rat
1576319	Cia29	Collagen induced arthritis QTL 29			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	33973921	78973921	Rat
61332	Eau3	Experimental allergic uveoretinitis QTL 3		0.004	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	10	34490559	45579777	Rat
1354614	Hpcl1	Hepatic cholesterol level QTL 1	3.3		liver cholesterol amount (VT:0010498)	liver cholesterol level (CMO:0001597)	10	35392267	51793994	Rat
1358897	Stresp6	Stress response QTL 6	4.17	0.022	blood norepinephrine amount (VT:0005663)	plasma norepinephrine level (CMO:0001010)	10	35392267	64155584	Rat
61441	Btemp1	Thermal response to stress QTL 1	4		body temperature trait (VT:0005535)	core body temperature (CMO:0001036)	10	35392457	63642539	Rat
2317042	Aia20	Adjuvant induced arthritis QTL 20	3.38		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	10	37565079	82565079	Rat
2317043	Aia7	Adjuvant induced arthritis QTL 7	3.82		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	10	37565079	82565079	Rat
1576308	Schws1	Schwannoma susceptibility QTL 1		0.0041	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	40035094	102359817	Rat
631269	Cia22	Collagen induced arthritis QTL 22	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
631270	Cia23	Collagen induced arthritis QTL 23	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
631552	Vetf2	Vascular elastic tissue fragility QTL 2	4.5	0.0002	aorta elastic tissue integrity trait (VT:0010556)	artery internal elastic lamina non-tumorous lesion count (CMO:0001913)	10	41142633	86142633	Rat
61463	Bp12	Blood pressure QTL 12	6.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	41333258	86333258	Rat
8552805	Bw145	Body weight QTL 145	2.2		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	10	41944526	78307017	Rat
1298078	Stresp5	Stress response QTL 5	2.99	0.00025	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	42045676	104670812	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	42323132	87323132	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	42323132	87323132	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	42323132	87323132	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	42323132	87323132	Rat
70198	BpQTLcluster9	Blood pressure QTL cluster 9	2.94		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	42323132	87323132	Rat
6893342	Cm78	Cardiac mass QTL 78	0.1	0.88	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	10	42876766	79813922	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium		4	16	16	7	16
Low		18	8	8	4	8			15	12	25	4
Below cutoff	1	18	19	7	7	7	3	3	49	6	5	6	3

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001191641	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085945	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085946	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085947	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005489808	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005489809	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005489810	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	FQ232670	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000219	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000047700 ⟹ ENSRNOP00000049077

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	43,022,996 - 43,034,476 (+)	Ensembl
Rnor_6.0 Ensembl	10	44,271,587 - 44,282,726 (+)	Ensembl

RefSeq Acc Id:

NM_001191641 ⟹ NP_001178570

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	10	43,022,996 - 43,034,014 (+)	NCBI
Rnor_6.0	10	44,271,587 - 44,282,726 (+)	NCBI
Rnor_5.0	10	44,076,388 - 44,087,527 (+)	NCBI
Celera	10	42,308,739 - 42,319,736 (+)	NCBI

Sequence:

show sequence

ATGGCCACAGCACCCGGGGAGCGGCTGCAGGAGGAGGCACGGTGCTCAGTGTGCCTGGACTTCC
TGCAGGAGCCCATCAGCGTTGACTGTGGTCACAGCTTCTGTCTGCGGTGCATATCTGAGCTCTG
CGAGAAATCGGACAGCGCTCAGGGAGTCTATGCTTGTCCCCAGTGCAGGGGTCCCTTCAGGCCC
TCCAGCTTCAGACCCAACCGGCAGCTGGCCAGCCTGGTGGACACCGTGCGGCAGCTGGGGCTGG
GCACCGGACACGCGGGGTCGCGTCAGTGTTCGAGGCACGGTGAGGACCTGAGCCACTTCTGTGA
AGAGGACCAAGCGATGGTGTGCTGGGTCTGCGACACCAGCCCTGAGCACCGGAGCCACCGCACT
GAGCCGCTGCAGGAGGCAGCCAGCCGCTACCAGAGGATGCTCCAAGTGGCTTTGGAACTTGTGA
AGAAGGAAATGGAGGAGGCTCTGACCCAGGAGGCCAACGTGGGAAAGAAGACCATCATCTGGAA
GGAGAAAGTGGAGATGCAGAGACAACGTTTCAGGCTGGAGTTTGAGAAACACCGGGGCTTTCTG
GCCCAGGAGGAGCAGCTGCAGCTGAGGCGACTGGAAGAGGAGGAGCGAGCAACCCTGCAGAGAC
TGCGTGACAGTAGGAACAGGCTGGCCCAACAGAACAAAGCCCTGAAGGAACTGGCTGAAGAGCT
GGAGGAGATGAGTCAGAGGCCAGCGGTAGCACTGCTGGAGGGAGCGAGAGGAGTCTTGACGCGA
AGCGAAGCTATGACCAGGCTGGAACCAGAGGCTGTCCCTATGGAGCTGAAGACCGTGTGCCGCA
TCCCTGGGATGAGGGAGATGCTGAGGAAGTTCCAAGTGGACGTGAAACTCGATCCCGCCACTGC
CCACCCAAGCTTGCTCTTAACGACGGATCTGCGCAGTGTGCAGGATGCGGAGGTCTGGAGGGAT
GTCCCGAGCAACCCTGAGCGCTTTGACACCTGGCCCTGCATCCTGGGCCTGCAGGGCTTCTCCT
CCGGGAGGCATTACTGGGAAGTCATCGTGGGGGAAAGAGCAGAGTGGGGGCTAGGGGTCTGCCA
AGACTCAGTGCTTAGAAAAGGGGAGACCACACCGTCCCCAGAGAATGGTGTCTGGGCCATGTGG
CTCCTGAGGGGGAGCGAGTACATGGTCCTGTCCTCTCCCTCGGTGCCTGTGTTCCAAGATGAGC
GACCTCGTCGCATCGGGATCTTTTTGGACTACGAAGCCGGCCAAATCTCCTTCTACAATGTCAC
AAATGGGTCTTACATCTACACATTTAACCATCTCTTCTCCGGTGTTCTCAGGCCCTATTTCTTC
GTCTGTGACACAACTCCTCTTATCTTGCCACCCATGACAGAAGCAGGACCTGGAAACTGGACTT
CCAGGGGTCTCCTTGATTTTGCTGTTGCTGCCAGAAGTGAGGAATACTAA

hide sequence

RefSeq Acc Id:

XM_039085945 ⟹ XP_038941873

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	10	43,022,935 - 43,038,984 (+)	NCBI

RefSeq Acc Id:

XM_039085946 ⟹ XP_038941874

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	10	43,022,936 - 43,036,030 (+)	NCBI

RefSeq Acc Id:

XM_039085947 ⟹ XP_038941875

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	10	43,022,936 - 43,033,322 (+)	NCBI

RefSeq Acc Id:

XM_039085948 ⟹ XP_038941876

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	10	43,022,937 - 43,036,052 (+)	NCBI

RefSeq Acc Id:

XR_005489808

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	10	43,022,934 - 43,033,465 (+)	NCBI

RefSeq Acc Id:

XR_005489809

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	10	43,022,933 - 43,036,052 (+)	NCBI

RefSeq Acc Id:

XR_005489810

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	10	43,022,933 - 43,033,911 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001178570	(Get FASTA)	NCBI Sequence Viewer
	XP_038941873	(Get FASTA)	NCBI Sequence Viewer
	XP_038941874	(Get FASTA)	NCBI Sequence Viewer
	XP_038941875	(Get FASTA)	NCBI Sequence Viewer
	XP_038941876	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001178570 ⟸ NM_001191641

- UniProtKB:

D3ZYF5 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MATAPGERLQEEARCSVCLDFLQEPISVDCGHSFCLRCISELCEKSDSAQGVYACPQCRGPFRP
SSFRPNRQLASLVDTVRQLGLGTGHAGSRQCSRHGEDLSHFCEEDQAMVCWVCDTSPEHRSHRT
EPLQEAASRYQRMLQVALELVKKEMEEALTQEANVGKKTIIWKEKVEMQRQRFRLEFEKHRGFL
AQEEQLQLRRLEEEERATLQRLRDSRNRLAQQNKALKELAEELEEMSQRPAVALLEGARGVLTR
SEAMTRLEPEAVPMELKTVCRIPGMREMLRKFQVDVKLDPATAHPSLLLTTDLRSVQDAEVWRD
VPSNPERFDTWPCILGLQGFSSGRHYWEVIVGERAEWGLGVCQDSVLRKGETTPSPENGVWAMW
LLRGSEYMVLSSPSVPVFQDERPRRIGIFLDYEAGQISFYNVTNGSYIYTFNHLFSGVLRPYFF
VCDTTPLILPPMTEAGPGNWTSRGLLDFAVAARSEEY

hide sequence

RefSeq Acc Id:

ENSRNOP00000049077 ⟸ ENSRNOT00000047700

RefSeq Acc Id:	XP_038941873 ⟸ XM_039085945
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038941874 ⟸ XM_039085946
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_038941875 ⟸ XM_039085947
- Peptide Label:	isoform X3

RefSeq Acc Id:	XP_038941876 ⟸ XM_039085948
- Peptide Label:	isoform X4

Protein Domains

B box-type B30.2/SPRY RING-type

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZYF5-F1-model_v2	AlphaFold	D3ZYF5	1-485	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1566174	AgrOrtholog
BioCyc Gene	G2FUF-24961	BioCyc
Ensembl Genes	ENSRNOG00000026430	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000049077	ENTREZGENE
	ENSRNOP00000049077.2	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000047700	ENTREZGENE
	ENSRNOT00000047700.3	UniProtKB/TrEMBL
Gene3D-CATH	2.60.120.920	UniProtKB/TrEMBL
	3.30.40.10	UniProtKB/TrEMBL
	Classic Zinc Finger	UniProtKB/TrEMBL
InterPro	B30.2/SPRY_sf	UniProtKB/TrEMBL
	B302	UniProtKB/TrEMBL
	Butyrophylin	UniProtKB/TrEMBL
	ConA-like_dom	UniProtKB/TrEMBL
	PRY	UniProtKB/TrEMBL
	SPRY/PRY_TRIM58	UniProtKB/TrEMBL
	SPRY_rcpt	UniProtKB/TrEMBL
	TRIM58_RING-HC	UniProtKB/TrEMBL
	Znf_B-box	UniProtKB/TrEMBL
	Znf_RING	UniProtKB/TrEMBL
	Znf_RING/FYVE/PHD	UniProtKB/TrEMBL
	Znf_RING_CS	UniProtKB/TrEMBL
KEGG Report	rno:303167	UniProtKB/TrEMBL
NCBI Gene	303167	ENTREZGENE
PANTHER	E3 UBIQUITIN-PROTEIN LIGASE TRIM	UniProtKB/TrEMBL
	E3 UBIQUITIN-PROTEIN LIGASE TRIM58	UniProtKB/TrEMBL
Pfam	PRY	UniProtKB/TrEMBL
	SPRY	UniProtKB/TrEMBL
	zf-B_box	UniProtKB/TrEMBL
	zf-C3HC4_4	UniProtKB/TrEMBL
PhenoGen	Trim58	PhenoGen
PRINTS	BUTYPHLNCDUF	UniProtKB/TrEMBL
PROSITE	B302_SPRY	UniProtKB/TrEMBL
	ZF_BBOX	UniProtKB/TrEMBL
	ZF_RING_1	UniProtKB/TrEMBL
	ZF_RING_2	UniProtKB/TrEMBL
SMART	BBOX	UniProtKB/TrEMBL
	PRY	UniProtKB/TrEMBL
	RING	UniProtKB/TrEMBL
	SPRY	UniProtKB/TrEMBL
Superfamily-SCOP	B-box zinc-binding domain	UniProtKB/TrEMBL
	ConA_like_lec_gl	UniProtKB/TrEMBL
	RING/U-box	UniProtKB/TrEMBL
UniProt	D3ZYF5	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-04-30	Trim58	tripartite motif-containing 58	Trim58_predicted	tripartite motif-containing 58 (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-30	Trim58_predicted	tripartite motif-containing 58 (predicted)	RGD1566174_predicted	similar to novel protein (predicted)	Symbol and Name updated	1299863	APPROVED
2006-03-07	RGD1566174_predicted	similar to novel protein (predicted)	LOC303167	similar to novel protein	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC303167	similar to novel protein			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar