Advanced Search (OLGA)

Gene: Chmp6 (charged multivesicular body protein 6) Rattus norvegicus

Analyze

Symbol:

Chmp6

Name:

charged multivesicular body protein 6

RGD ID:

1565325

Description:

Predicted to be involved in several processes, including midbody abscission; plasma membrane repair; and vacuolar transport. Predicted to be located in several cellular components, including bounding membrane of organelle; kinetochore microtubule; and midbody. Predicted to be part of ESCRT III complex and nuclear pore. Predicted to be active in multivesicular body. Orthologous to human CHMP6 (charged multivesicular body protein 6); PARTICIPATES IN endocytosis pathway; INTERACTS WITH 2,3,7,8-Tetrachlorodibenzofuran; 2,4-dinitrotoluene; 4-amino-2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

chromatin modifying protein 6; LOC287873; RGD1565325; similar to hypothetical protein FLJ11749

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CHMP6 (charged multivesicular body protein 6)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Chmp6 (charged multivesicular body protein 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Chmp6 (charged multivesicular body protein 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CHMP6 (charged multivesicular body protein 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CHMP6 (charged multivesicular body protein 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Chmp6 (charged multivesicular body protein 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CHMP6 (charged multivesicular body protein 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CHMP6 (charged multivesicular body protein 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Chmp6 (charged multivesicular body protein 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Chmp6 (charged multivesicular body protein 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	KRTAP24-1 (keratin associated protein 24-1)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	CHMP6 (charged multivesicular body protein 6)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Chmp6 (charged multivesicular body protein 6)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	chmp6a (charged multivesicular body protein 6a)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	chmp6b (charged multivesicular body protein 6b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	chmp6b (charged multivesicular body protein 6b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	VPS20	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):	VPS20	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Vps20	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	vps-20	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	vps-20	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	chmp6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	chmp6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	105,690,400 - 105,696,070 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	10	105,690,398 - 105,696,333 (+)	Ensembl				GRCr8
mRatBN7.2	10	105,191,972 - 105,197,642 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	105,191,950 - 105,197,640 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	10	110,295,524 - 110,301,195 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	109,758,557 - 109,764,228 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	105,112,529 - 105,118,199 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	109,073,678 - 109,079,348 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	109,073,678 - 109,079,348 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	10	108,673,903 - 108,679,573 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	10	109,317,687 - 109,323,357 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	10	103,737,639 - 103,743,309 (+)	NCBI		Celera
Cytogenetic Map	10	q32.3	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

1,2-dimethylhydrazine (ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2,4-dinitrotoluene (EXP)

4,4'-sulfonyldiphenol (ISO)

4-amino-2,6-dinitrotoluene (EXP)

acrylamide (ISO)

antimycin A (ISO)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

atrazine (ISO)

azoxystrobin (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

caffeine (ISO)

captan (ISO)

carbon nanotube (ISO)

chlorpyrifos (ISO)

chromium(6+) (ISO)

clofibrate (ISO)

cobalt dichloride (ISO)

copper(II) sulfate (ISO)

Dibutyl phosphate (ISO)

dioxygen (ISO)

disodium selenite (ISO)

epoxiconazole (ISO)

flutamide (EXP)

folpet (ISO)

gentamycin (EXP)

GSK-J4 (ISO)

iron dichloride (ISO)

methidathion (ISO)

perfluorooctanoic acid (ISO)

picoxystrobin (ISO)

potassium chromate (ISO)

pyrimidifen (ISO)

rotenone (ISO)

sodium arsenite (ISO)

thioacetamide (EXP)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

autophagosome maturation (IEA,ISO)

autophagy (IEA,ISO)

late endosome to lysosome transport (IEA,ISO)

late endosome to vacuole transport via multivesicular body sorting pathway (IBA)

midbody abscission (IEA,ISO)

mitotic metaphase chromosome alignment (IEA,ISO)

multivesicular body sorting pathway (IEA,ISO)

negative regulation of epidermal growth factor-activated receptor activity (ISO)

nuclear membrane reassembly (IEA,ISO)

nucleus organization (IEA,ISO)

plasma membrane repair (IEA,ISO)

protein transport (IEA)

regulation of exosomal secretion (ISO)

regulation of mitotic spindle assembly (IEA,ISO)

regulation of protein catabolic process (IEA,ISO)

ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway (IEA,ISO)

vacuolar transport (IEA)

vesicle budding from membrane (IBA)

viral budding from plasma membrane (IEA,ISO)

viral budding via host ESCRT complex (IEA,ISO)

Cellular Component

amphisome membrane (IEA,ISO)

autophagosome membrane (IEA,ISO)

endosome membrane (IEA,ISO)

ESCRT III complex (IBA,IEA,ISO)

kinetochore (IEA,ISO)

kinetochore microtubule (IEA,ISO)

lysosomal membrane (IEA,ISO)

midbody (IEA,ISO)

multivesicular body (IBA)

multivesicular body membrane (IEA,ISO)

nuclear pore (IEA,ISO)

plasma membrane (IEA,ISO)

Molecular Function

protein binding (ISO)

protein-containing complex binding (IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

endocytosis pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:16973552	PMID:18606141	PMID:19056867	PMID:19946888	PMID:20458337	PMID:20616062	PMID:22660413	PMID:23376485	PMID:24878737

Genomics

Comparative Map Data

Chmp6
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	105,690,400 - 105,696,070 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	10	105,690,398 - 105,696,333 (+)	Ensembl				GRCr8
mRatBN7.2	10	105,191,972 - 105,197,642 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	105,191,950 - 105,197,640 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	10	110,295,524 - 110,301,195 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	109,758,557 - 109,764,228 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	105,112,529 - 105,118,199 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	109,073,678 - 109,079,348 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	109,073,678 - 109,079,348 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	10	108,673,903 - 108,679,573 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	10	109,317,687 - 109,323,357 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	10	103,737,639 - 103,743,309 (+)	NCBI		Celera
Cytogenetic Map	10	q32.3	NCBI

CHMP6
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	80,991,841 - 81,000,133 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	80,991,598 - 81,009,517 (+)	Ensembl			hg38	GRCh38
GRCh37	17	78,965,641 - 78,973,933 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	76,580,290 - 76,588,528 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	17	75,596,098 - 75,601,620 (+)	NCBI		Celera
Cytogenetic Map	17	q25.3	NCBI
HuRef	17	74,403,895 - 74,412,145 (+)	NCBI		HuRef
CHM1_1	17	79,052,232 - 79,060,446 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	17	81,898,759 - 81,907,012 (+)	NCBI		T2T-CHM13v2.0

Chmp6
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	119,803,874 - 119,810,378 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	119,804,267 - 119,810,374 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	11	119,913,409 - 119,919,552 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	119,913,441 - 119,919,548 (+)	Ensembl			mm10	GRCm38
MGSCv37	11	119,775,124 - 119,780,866 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	11	119,729,531 - 119,735,642 (+)	NCBI		MGSCv36	mm8
Celera	11	131,647,559 - 131,653,301 (+)	NCBI		Celera
Cytogenetic Map	11	E2	NCBI
cM Map	11	83.96	NCBI

Chmp6
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955506	1,987,195 - 1,994,666 (-)	Ensembl
ChiLan1.0	NW_004955506	1,987,710 - 1,994,731 (-)	NCBI	ChiLan1.0	ChiLan1.0

CHMP6
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	97,567,775 - 97,577,420 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	102,468,505 - 102,476,733 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	75,415,055 - 75,423,279 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	81,145,786 - 81,151,962 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	17	81,144,837 - 81,151,962 (+)	Ensembl			panPan2	panpan1.1

CHMP6
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	997,951 - 1,001,659 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	9	998,653 - 1,002,538 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	1,615,818 - 1,621,713 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	1,607,437 - 1,613,332 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
UMICH_Zoey_3.1	9	1,631,431 - 1,637,326 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	1,756,958 - 1,762,857 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	1,837,617 - 1,843,512 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Chmp6
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	1,636,773 - 1,642,591 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936594	4,769,466 - 4,774,293 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936594	4,769,409 - 4,775,186 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CHMP6
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	12	1,691,823 - 1,698,305 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	12	1,691,821 - 1,698,347 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	12	1,597,560 - 1,603,069 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CHMP6
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	72,943,048 - 72,951,121 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	16	72,943,122 - 72,950,694 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666077	44,313,234 - 44,321,355 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Chmp6
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624801	10,063,614 - 10,070,320 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624801	10,063,284 - 10,070,322 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Chmp6
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	9	64,098,428 - 64,104,141 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Chmp6
39 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	164
Count of miRNA genes:	127
Interacting mature miRNAs:	142
Transcripts:	ENSRNOT00000005379
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
7387312	Bw125	Body weight QTL 125	3	0.0047	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight (CMO:0000356)	10	65390777	107713808	Rat
1354641	Bvd2	Brain ventricular dilatation QTL 2	6.36	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	10	93723381	107556066	Rat
8657410	Bp374	Blood pressure QTL 374			heart left ventricle size trait (VT:0002753)	heart left ventricle end-diastolic diameter (CMO:0000982)	10	67476608	107713808	Rat
61449	Ciaa2	CIA Autoantibody QTL 2	7.1		blood autoantibody amount (VT:0003725)	calculated serum anti-type 2 collagen antibody titer (CMO:0001279)	10	63719161	107713808	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	52269185	107713808	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
1298078	Stresp5	Stress response QTL 5	2.99	0.00025	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	42546145	107713808	Rat
12903252	Cm113	Cardiac mass QTL 113		0.047	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	66817119	107713808	Rat
61396	Bp9	Blood pressure QTL 9	4.8	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	68920187	107713808	Rat
2298548	Neuinf7	Neuroinflammation QTL 7	3.4		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	10	64939013	107713808	Rat
1358915	Stresp7	Stress response QTL 7	3.52		blood norepinephrine amount (VT:0005663)	plasma norepinephrine level (CMO:0001010)	10	65307813	107713808	Rat
1302404	Cia27	Collagen induced arthritis QTL 27	2.6	0.0045	joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	10	76951790	107713808	Rat
70168	Eae12	Experimental allergic encephalomyelitis QTL 12		0.0009	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	10	73599825	107713808	Rat
634320	Niddm49	Non-insulin dependent diabetes mellitus QTL 49	4.41		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	10	89039175	107713808	Rat
70171	Cari1	Carrageenan-induced inflammation QTL 1	4.9	0.0005	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	10	54296227	107713808	Rat
70363	Bp71	Blood pressure QTL 71		0.04	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	61843496	106843496	Rat
6893366	Bw106	Body weight QTL 106	0.3	0.47	body mass (VT:0001259)	body weight (CMO:0000012)	10	70698731	107713808	Rat
12903269	Am15	Aortic mass QTL 15		0.042	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	66817119	107713808	Rat
1576313	Pia25	Pristane induced arthritis QTL 25			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	96620293	107713808	Rat
12903266	Cm114	Cardiac mass QTL 114		0.02	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	10	66817119	107713808	Rat
1578672	Bmd16	Bone mineral density QTL 16	6.2		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	10	97202388	107556066	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
1576307	Cia28	Collagen induced arthritis QTL 28			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	96620293	107713808	Rat
631269	Cia22	Collagen induced arthritis QTL 22	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40535708	107713808	Rat
1576308	Schws1	Schwannoma susceptibility QTL 1		0.0041	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	40535708	107713808	Rat
2313103	Bss80	Bone structure and strength QTL 80	2	0.0001	tibia strength trait (VT:1000284)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	10	62556066	107556066	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14991535	107713808	Rat
631270	Cia23	Collagen induced arthritis QTL 23	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40535708	107713808	Rat
1581559	Eae18	Experimental allergic encephalomyelitis QTL 18		0.00002	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	10	66108888	107555881	Rat
12880372	Am12	Aortic mass QTL 12		0.003	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	66817119	107713808	Rat
70193	Mcs7	Mammary carcinoma susceptibility QTL 7	2.38		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	10	72724423	107713808	Rat
2313105	Bss79	Bone structure and strength QTL 79	1.8	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	62556066	107556066	Rat
12880375	Kidm66	Kidney mass QTL 66		0.009	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	10	66817119	107713808	Rat
61363	Oia3	Oil induced arthritis QTL 3		0.001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	87807758	107713808	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14991535	107556066	Rat
12880370	Cm105	Cardiac mass QTL 105		0.008	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	10	66817119	107713808	Rat
12880371	Cm106	Cardiac mass QTL 106		0.007	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	66817119	107713808	Rat
1600367	Mcs15	Mammary carcinoma susceptibility QTL 15	4.5		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	10	72724423	107713808	Rat
631537	Oia4	Oil induced arthritis QTL 4			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	76128947	107713808	Rat
1300137	Bp186	Blood pressure QTL 186	3.57		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	10	91127270	107556066	Rat
634354	Rends3	Renal damage susceptibility QTL 3		0.05	kidney blood vessel morphology trait (VT:0000530)	organ lesion measurement (CMO:0000677)	10	61997479	106997479	Rat
61436	Cia5	Collagen induced arthritis QTL 5	4.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	91727883	107713808	Rat
11565453	Kidm58	Kidney mass QTL 58		0.002	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	10	66817119	107713808	Rat
2301405	Cm69	Cardiac mass QTL 69		0.031	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	10	66817119	107713808	Rat
1578663	Bss18	Bone structure and strength QTL 18	3.6		femur width (VT:1000666)	femoral neck width (CMO:0001695)	10	97202388	107556066	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	161	91	90	59	92	59	6	356	192	11	140	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001105856	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC070963	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000005379 ⟹ ENSRNOP00000005379

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	105,690,400 - 105,696,070 (+)	Ensembl
mRatBN7.2 Ensembl	10	105,191,950 - 105,197,640 (+)	Ensembl
Rnor_6.0 Ensembl	10	109,073,678 - 109,079,348 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000107202 ⟹ ENSRNOP00000096043

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	105,690,398 - 105,696,333 (+)	Ensembl
mRatBN7.2 Ensembl	10	105,191,986 - 105,197,636 (+)	Ensembl

RefSeq Acc Id:

NM_001105856 ⟹ NP_001099326

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	105,690,400 - 105,696,070 (+)	NCBI
mRatBN7.2	10	105,191,972 - 105,197,642 (+)	NCBI
Rnor_6.0	10	109,073,678 - 109,079,348 (+)	NCBI
Rnor_5.0	10	108,673,903 - 108,679,573 (+)	NCBI
RGSC_v3.4	10	109,317,687 - 109,323,357 (+)	RGD
Celera	10	103,737,639 - 103,743,309 (+)	RGD

Sequence:

show sequence

GGGGCGGCGGCGACGGGCTCGGCCGGCCGGCGCGGGGCCGCCATGGGCAACCTGTTCGGTCGCA
AGAAGCAGAGCCGGGTCACTGAACAGGACAGGGCCATCCTGCAACTGAAGCAGCAGAGAGACAA
GCTGAGGCAGTACCAGAAGAGGGTCACGCAGCAGCTGGAGAGGGAACGGGCTTTGGCCAGGCAG
CTGCTTCGGGATGGCAGGAAAGAACGGGCCAAGCTGCTACTCAAGAAGAAGAGGTACCGGGAGC
AACTGCTCGATAGGACAGAAAACCAGATCAGCAGCCTGGAAGCCATGGTTCAGAGCATTGAGTT
CACGCAGATCGAGATGAAGGTGATGGAGGGGCTTCAGGTGGGGAACGAATGTCTGAATAAGATG
CACCAGGTGATGTCCATAGAGGAGGTGGAGAGGATCCTGGACGAGACCCAGGAGGCCGTGGAGT
ACCAGCGGCAAATTGATGAGCTGCTGGCAGGAAGTTTCACCCAGGAGGACGAGGATGCCATCCT
GGAAGAGCTGAATGCAATCACTCAGGAACAAATCGAGTTACCAGAGGTTCCTTCGGAGCCCCTG
CCTGACACAAGCCCAGAAGCCCCTGCCAAGGCCAGATCCAGGCAGGCAGAGCTGGTGGCCGCTT
CGTAACCTCCAGGGACTCATAGGGATTCTCCGAGGACTGTCCCACAGAGCCTTTGGCTGCGAGT
CAACCCTGAGGGCTCCCAGGAGGCCTGAAGGGCTGGACGGGCCAGTGCAGGTGCCGATGGCTGG
AGCAGCAGCTTACACGGGAGCTGATGTCAGGGCGCCACGTTGTGCAATTTAGTCTGGATGCACC
TTCATCTCTGCTCCTGGACTAAGTGGACACTCGGCCAGCCAGGCGCAGCTTCAGGCCGCTGTGG
ACCCCACGTTGGCCGCAGCCCACTACTCCTGGTGCTGTTCTCATGCTGACCCAGCCCGTGTGAC
CTGCACTCTTCTGTGAGGAAGCACCTCAGACCTCGGGGTCCCTGTGCTCCCTTCTCTTGTATCT
CCTGCTCACATGAGCTGGTGGGGGCTTCAGTTGAGGAGTTCTTACCTTGCCTGGCATCCTGATA
TCCCTGTTTCCCTGCAGGCTAGTGACAGAAACCCTAGGATACTGGTGTTCTCCAAATCTCTTGG
AGCATCTTTGGCACCTCAGACTTGATTGAGCCTCTTATGTTGGGGGAGGTGGACCAGGGGCCAT
CCTGCTGAATGGACAAATCTAGGAGCCTGACTTGGGAGTCTGTTCACAGAAGAAAGGCATGTTG
AAGTTGGTGACAAGACCCTGTTTTAATGGACATGTACCCGATGGTGTCCTGGACACACTAAGCC
ACCAACGCCCAGGAGGCACAGAACTGGGAGGACCTCCAGAGCCCTACACTTGTTTGATAATGGA
CAATCTCTGGTCCTCTAGTCTTTGAGGAACAAAGGGTCTTACATACCCTTAGGGCCTACCAGGA
AAGGAGGGCACCTCTTCCTTAACCCAAAACAGGTCAACCTCAGTATTAAAGTTGACCCCTGCAT
GGTCTTTGGCCTCTTGCACTTG

hide sequence

Protein Sequences


Protein RefSeqs	NP_001099326	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM06802	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000005379
	ENSRNOP00000005379.5
	ENSRNOP00000096043.2

RefSeq Acc Id:

NP_001099326 ⟸ NM_001105856

- UniProtKB:

D3ZDR2 (UniProtKB/TrEMBL), A6HL97 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MGNLFGRKKQSRVTEQDRAILQLKQQRDKLRQYQKRVTQQLERERALARQLLRDGRKERAKLLL
KKKRYREQLLDRTENQISSLEAMVQSIEFTQIEMKVMEGLQVGNECLNKMHQVMSIEEVERILD
ETQEAVEYQRQIDELLAGSFTQEDEDAILEELNAITQEQIELPEVPSEPLPDTSPEAPAKARSR
QAELVAAS

hide sequence

Ensembl Acc Id:

ENSRNOP00000005379 ⟸ ENSRNOT00000005379

Ensembl Acc Id:

ENSRNOP00000096043 ⟸ ENSRNOT00000107202

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZDR2-F1-model_v2	AlphaFold	D3ZDR2	1-200	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13697947

Promoter ID:

EPDNEW_R8472

Type:

initiation region

Name:

Chmp6_1

Description:

charged multivesicular body protein 6

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	10	109,073,689 - 109,073,749	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1565325	AgrOrtholog
BioCyc Gene	G2FUF-22472	BioCyc
Ensembl Genes	ENSRNOG00000004014	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000005379	ENTREZGENE
	ENSRNOT00000005379.8	UniProtKB/TrEMBL
	ENSRNOT00000107202.2	UniProtKB/TrEMBL
Gene3D-CATH	ESAT-6-like	UniProtKB/TrEMBL
InterPro	Snf7	UniProtKB/TrEMBL
KEGG Report	rno:287873	UniProtKB/TrEMBL
NCBI Gene	287873	ENTREZGENE
PANTHER	CHARGED MULTIVESICULAR BODY PROTEIN 6	UniProtKB/TrEMBL
	PTHR22761	UniProtKB/TrEMBL
Pfam	Snf7	UniProtKB/TrEMBL
PhenoGen	Chmp6	PhenoGen
RatGTEx	ENSRNOG00000004014	RatGTEx
UniProt	A0A8I6AQ75_RAT	UniProtKB/TrEMBL
	A6HL97	ENTREZGENE, UniProtKB/TrEMBL
	D3ZDR2	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2011-09-29	Chmp6	charged multivesicular body protein 6	Chmp6	chromatin modifying protein 6	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Chmp6	chromatin modifying protein 6	Chmp6_predicted	chromatin modifying protein 6 (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-30	Chmp6_predicted	chromatin modifying protein 6 (predicted)	RGD1565325_predicted	similar to hypothetical protein FLJ11749 (predicted)	Symbol and Name updated	1299863	APPROVED
2006-03-07	RGD1565325_predicted	similar to hypothetical protein FLJ11749 (predicted)	LOC287873	similar to hypothetical protein FLJ11749	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC287873	similar to hypothetical protein FLJ11749			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Annotations - KEGG (archival)