Rdh14 (retinol dehydrogenase 14) - Rat Genome Database

Name: Rdh14
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Advanced Search (OLGA)

Gene: Rdh14 (retinol dehydrogenase 14) Rattus norvegicus

Analyze

Symbol:

Rdh14

Name:

retinol dehydrogenase 14

RGD ID:

1565196

Description:

Predicted to enable all-trans-retinol dehydrogenase (NADP+) activity. Predicted to act upstream of or within retinol metabolic process. Predicted to be located in cytosol; endoplasmic reticulum; and nucleoplasm. Orthologous to human RDH14 (retinol dehydrogenase 14); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; bisphenol A; endosulfan.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC500629; retinol dehydrogenase 14 (all-trans and 9-cis); retinol dehydrogenase 14 (all-trans and 9-cis)9; retinol dehydrogenase 14 (all-trans/9-cis/11-cis); RGD1565196; similar to alcohol dehydrogenase PAN2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RDH14 (retinol dehydrogenase 14)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Rdh14 (retinol dehydrogenase 14 (all-trans and 9-cis))	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Rdh14 (retinol dehydrogenase 14)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RDH14 (retinol dehydrogenase 14)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RDH14 (retinol dehydrogenase 14)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rdh14 (retinol dehydrogenase 14)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RDH14 (retinol dehydrogenase 14)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RDH14 (retinol dehydrogenase 14)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rdh14 (retinol dehydrogenase 14)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	TTLL13 (tubulin tyrosine ligase like 13)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	RDH14 (retinol dehydrogenase 14)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Rdh14 (retinol dehydrogenase 14 (all-trans and 9-cis))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	rdh14a (retinol dehydrogenase 14a)	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	rdh14b (retinol dehydrogenase 14b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	ENV9	Alliance	DIOPT (Hieranoid\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	dhs-22	Alliance	DIOPT (InParanoid\|OMA\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG7675	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Caenorhabditis elegans (roundworm):	DC2.5	Alliance	DIOPT (Ensembl Compara\|OMA\|SonicParanoid)
Caenorhabditis elegans (roundworm):	E04F6.15	Alliance	DIOPT (Ensembl Compara\|OMA\|SonicParanoid)
Caenorhabditis elegans (roundworm):	dhs-7	Alliance	DIOPT (Ensembl Compara\|OMA\|SonicParanoid)
Caenorhabditis elegans (roundworm):	K10H10.6	Alliance	DIOPT (Ensembl Compara\|OMA\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	PBR1	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	rdh14	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	38,875,693 - 38,880,836 (+)	NCBI		GRCr8
mRatBN7.2	6	33,156,569 - 33,161,712 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	33,156,569 - 33,161,712 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	33,449,459 - 33,454,605 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	33,765,372 - 33,770,518 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	33,237,152 - 33,242,297 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	36,106,926 - 36,112,069 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	36,107,147 - 36,112,064 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	45,868,730 - 45,873,873 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	33,867,711 - 33,872,853 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	6	32,593,617 - 32,598,763 (+)	NCBI		Celera
Cytogenetic Map	6	q14	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

intellectual disability (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-tribromophenol (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4-hydroxyphenyl retinamide (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (EXP,ISO)

cadmium dichloride (ISO)

carbamazepine (ISO)

CGP 52608 (ISO)

chromium(6+) (ISO)

copper(II) sulfate (ISO)

cypermethrin (ISO)

decabromodiphenyl ether (ISO)

dexamethasone (ISO)

Dibutyl phosphate (ISO)

dioxygen (ISO)

endosulfan (EXP)

fenthion (ISO)

fenvalerate (EXP)

finasteride (EXP)

flutamide (EXP)

folic acid (ISO)

formaldehyde (ISO)

graphite (EXP)

hydrogen peroxide (ISO)

indometacin (ISO)

ivermectin (ISO)

methapyrilene (EXP)

NADP zwitterion (ISO)

NADP(+) (ISO)

paracetamol (EXP,ISO)

phenytoin (EXP)

phlorizin (ISO)

silicon dioxide (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (ISO)

tert-butyl hydroperoxide (ISO)

thioacetamide (EXP)

trichloroethene (EXP)

triphenyl phosphate (ISO)

trovafloxacin (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

retinol metabolic process (ISO)

Cellular Component

cytosol (IEA,ISO)

endoplasmic reticulum (IEA,ISO)

nucleoplasm (IEA,ISO)

Molecular Function

alcohol dehydrogenase (NADP+) activity (ISO)

all-trans-retinol dehydrogenase (NADP+) activity (ISO)

protein binding (ISO)

steroid dehydrogenase activity (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12226107	PMID:12435598	PMID:16210410	PMID:17897319	PMID:18614015	PMID:21630459	PMID:21873635	PMID:25533474

Genomics

Comparative Map Data

Rdh14
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	38,875,693 - 38,880,836 (+)	NCBI		GRCr8
mRatBN7.2	6	33,156,569 - 33,161,712 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	33,156,569 - 33,161,712 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	33,449,459 - 33,454,605 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	33,765,372 - 33,770,518 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	33,237,152 - 33,242,297 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	36,106,926 - 36,112,069 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	36,107,147 - 36,112,064 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	45,868,730 - 45,873,873 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	33,867,711 - 33,872,853 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	6	32,593,617 - 32,598,763 (+)	NCBI		Celera
Cytogenetic Map	6	q14	NCBI

RDH14
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	18,554,723 - 18,560,653 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	18,554,723 - 18,560,679 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	18,735,989 - 18,741,919 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	18,599,473 - 18,605,381 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	2	18,657,624 - 18,663,520	NCBI
Celera	2	18,617,249 - 18,623,222 (-)	NCBI		Celera
Cytogenetic Map	2	p24.2	NCBI
HuRef	2	18,511,154 - 18,517,127 (-)	NCBI		HuRef
CHM1_1	2	18,665,393 - 18,671,366 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	2	18,586,834 - 18,592,767 (-)	NCBI		T2T-CHM13v2.0

Rdh14
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	12	10,440,752 - 10,445,562 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	12	10,440,772 - 10,445,562 (+)	Ensembl		GRCm39 Ensembl
GRCm38	12	10,390,748 - 10,395,562 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	12	10,390,772 - 10,395,562 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	12	10,397,586 - 10,402,368 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	12	10,416,788 - 10,421,569 (+)	NCBI		MGSCv36	mm8
Celera	12	10,767,241 - 10,772,010 (+)	NCBI		Celera
Cytogenetic Map	12	A1.1	NCBI
cM Map	12	5.29	NCBI

Rdh14
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955469	1,281,791 - 1,286,147 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955469	1,281,391 - 1,287,334 (-)	NCBI	ChiLan1.0	ChiLan1.0

RDH14
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	12	107,969,873 - 107,975,830 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2A	107,973,836 - 107,979,804 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2A	18,534,357 - 18,540,325 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2A	18,661,815 - 18,667,359 (-)	NCBI	panpan1.1	PanPan1.1	panPan2

RDH14
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	17	13,843,278 - 13,848,498 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	17	13,795,101 - 13,800,302 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	17	13,986,784 - 13,991,984 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	17	13,986,775 - 13,992,058 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	17	13,843,170 - 13,848,363 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	17	13,848,691 - 13,853,892 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	17	13,882,462 - 13,887,659 (-)	NCBI		UU_Cfam_GSD_1.0

Rdh14
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024406292	58,292,202 - 58,297,536 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936493	12,542,144 - 12,546,977 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl

RDH14
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	119,453,995 - 119,458,778 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	119,453,986 - 119,458,787 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	127,542,600 - 127,547,399 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RDH14
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	14	89,128,850 - 89,134,879 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	14	89,128,828 - 89,135,033 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666045	23,096,213 - 23,102,239 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rdh14
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624738	1,393,157 - 1,397,587 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Rdh14
19 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	32
Count of miRNA genes:	28
Interacting mature miRNAs:	31
Transcripts:	ENSRNOT00000006020
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
8552962	Pigfal16	Plasma insulin-like growth factor 1 level QTL 16	9.4		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	6	1	41223769	Rat
10401812	Kidm54	Kidney mass QTL 54			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	6	14368788	59368788	Rat
1331743	Uae28	Urinary albumin excretion QTL 28	4.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	6	1	34235784	Rat
2292589	Emca10	Estrogen-induced mammary cancer QTL 10		0.048	mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	6	16536140	61536140	Rat
10401800	Kidm49	Kidney mass QTL 49			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	6	14368788	59368788	Rat
1331779	Rf38	Renal function QTL 38	2.876		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	6	32074428	72227641	Rat
1300164	Rf15	Renal function QTL 15	3.12		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	6	5074497	54641141	Rat
9589129	Insul24	Insulin level QTL 24	19.06	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	6	1	41223769	Rat
1578758	Tcas9	Tongue tumor susceptibility QTL 9	3.29		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	6	1	37618905	Rat
4145119	Mcs25	Mammary carcinoma susceptibility QTL 25		0.0001	mammary gland integrity trait (VT:0010552)	ratio of deaths to total study population during a period of time (CMO:0001023)	6	10894415	110548006	Rat
7411603	Foco13	Food consumption QTL 13	5.5	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	6	1	41223769	Rat
738024	Sach5	Saccharine consumption QTL 5	3.9	0.00039	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	6	1	43394190	Rat
1598843	Cm63	Cardiac mass QTL 63	2.6		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	6	1	39036266	Rat
7411542	Bw127	Body weight QTL 127	5.5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	1	41223769	Rat
9589048	Scfw3	Subcutaneous fat weight QTL 3	4.57	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	6	1	41223769	Rat
2293839	Kiddil2	Kidney dilation QTL 2	4.8		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	20866422	81133036	Rat
1576309	Emca7	Estrogen-induced mammary cancer QTL 7	4		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	6	15107216	107351382	Rat
2293709	Bss23	Bone structure and strength QTL 23	5.18	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	6	1	42487980	Rat
2293650	Bss31	Bone structure and strength QTL 31	5.05	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	6	1	42487980	Rat
1578665	Bss16	Bone structure and strength QTL 16	4.4		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	6	11735669	72593685	Rat
7411584	Foco4	Food consumption QTL 4	4.3	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	6	1	42838846	Rat
2293841	Kiddil4	Kidney dilation QTL 4	4.4		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	20866422	81133036	Rat
1641898	Colcr4	Colorectal carcinoma resistance QTL4	3.71	0.0007	intestine integrity trait (VT:0010554)	well differentiated malignant colorectal tumor surface area measurement (CMO:0002077)	6	20338777	62613667	Rat
1300128	Rf16	Renal function QTL 16	3.89		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	6	5074497	34434305	Rat
1578668	Bmd14	Bone mineral density QTL 14	3.8		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	6	11735669	72593685	Rat
2301972	Bp325	Blood pressure QTL 325	4.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	6	1	72227641	Rat
2293656	Bss28	Bone structure and strength QTL 28	6.79	0.0001	femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	6	1	42487980	Rat
1354664	Slep2	Serum leptin concentration QTL 2	4.49		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	6	16536140	71636405	Rat

Markers in Region

RH129764

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	33,161,468 - 33,161,672 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	36,111,826 - 36,112,029	NCBI	Rnor6.0
Rnor_5.0	6	45,873,630 - 45,873,833	UniSTS	Rnor5.0
RGSC_v3.4	6	33,872,610 - 33,872,813	UniSTS	RGSC3.4
Celera	6	32,598,520 - 32,598,723	UniSTS
RH 3.4 Map	6	123.1	UniSTS
Cytogenetic Map	6	q14	UniSTS

RH130015

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	33,161,471 - 33,161,688 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	36,111,829 - 36,112,045	NCBI	Rnor6.0
Rnor_5.0	6	45,873,633 - 45,873,849	UniSTS	Rnor5.0
RGSC_v3.4	6	33,872,613 - 33,872,829	UniSTS	RGSC3.4
Celera	6	32,598,523 - 32,598,739	UniSTS
RH 3.4 Map	6	123.2	UniSTS
Cytogenetic Map	6	q14	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001109276	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473947	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000006	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000006020 ⟹ ENSRNOP00000006020

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	33,156,569 - 33,161,712 (+)	Ensembl
Rnor_6.0 Ensembl	6	36,107,147 - 36,112,064 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000092948

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	6	36,110,270 - 36,111,097 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000093003 ⟹ ENSRNOP00000076047

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	6	36,107,672 - 36,108,309 (+)	Ensembl

RefSeq Acc Id:

NM_001109276 ⟹ NP_001102746

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	38,875,693 - 38,880,836 (+)	NCBI
mRatBN7.2	6	33,156,569 - 33,161,712 (+)	NCBI
Rnor_6.0	6	36,106,926 - 36,112,069 (+)	NCBI
Rnor_5.0	6	45,868,730 - 45,873,873 (+)	NCBI
RGSC_v3.4	6	33,867,711 - 33,872,853 (+)	RGD
Celera	6	32,593,617 - 32,598,763 (+)	RGD

Sequence:

show sequence

TTGAAAAATATTTTTCAAGCTACAGTCAGGCGAGCTACTTTTCTTTAACCTAAGAATTTTTGCA
TTCCATTGCTTCTATCTGTGTAAGTTGGAATGGTGCCTCTTTAAACAAGTTTAGAGCTTTGTTA
CTTAAATTGTTTCACAAGAATCTTAATTTCCAAGAAGCATTGCTCATTTTAATTTTAGCCAGCT
AAATGAATTTCTCTGTAGCATCACGAGCGTATACCAATTTTAACACTGTTCACTTCTAAATAAA
TTCGCTGGTGGTTTCAGGTGTAGTTCATAAGATGAACTCTTTGTCAAGGCGGCCTCAGGAGGAA
AACTACAAGTCCCAGCAAGCCCCGCGCGCACTAGCCCAGGACGGCAGGCGGCGCCCCAGAGTCC
TTCGCGTGTAGGTGGCCCCCTGGACTCCGGAACCGGTGTGCTAGGCCCTGTGCACCCTGCCCGG
AAGGCTATGGCAGTGGCTAGTGTGGCCGCGGCGCTCCTGGCCGCACTGGGCGGGGCGTTGTGGC
TGGCAGCCCGGCGGTTCTCTGGGTCAAGTGGCCAGCGGCGGCAGGGAGGCGGAGACCCGGGCCT
CATGCACGGGAAGACAGTGCTGATCACCGGAGCAAACAGTGGCCTGGGCCGCGCCACGGCCGGG
GAGCTGCTACGCCTGGGGGCGCGGGTCATCATGGGATGTCGGGACCGCGCCCGAGCAGAGGAGG
CAGCGGGTCAGCTCAGGCAGGAGCTTGGTCAGGCTGGGGGTCTCGGGCCCGATGCCACCGATGG
CCAGCTGGTCGTTAAGGAGCTGGATCTCGCCTCGCTGCGCTCCGTGCGAGCCTTCTGCCAAGAA
CTGCTACAGGAGGAGCCCAGGCTAGATGTCCTGATCAATAATGCGGGGGTTTTCCAGTGCCCAT
ATACGAAGACTGAAGATGGATTTGAGATGCAGTTTGGAGTGAACCACCTGGGCCACTTCCTTCT
CACCAATCTTCTCCTTGGGCTCCTCAAAAGTTCAGCTCCCAGCAGGATTGTAGTCGTTTCCTCT
AAACTTTATAAATATGGAGACATCAACTTTGAAGACTTGAACAGTGAACAAAGCTATAATAAAA
GCTTCTGTTATAGTCGAAGCAAGCTGGCTAACATTCTTTTCACAAGGGAACTAGCCCATCGCTT
AGAAGGAACAAATGTGACTGTCAACGTGCTGCATCCTGGTATTGTGCGAACAAACCTGGGGAGG
CATATACACATCCCATTGCTGGCAAGACCACTTTTCAATTTGGTATCCTGGGCTTTTTTCAAAA
CTCCATTAGAAGGTGCCCAGACCTCCATCTACTTAGCCTCTTCACCCGATGTGGAAGGTGTATC
GGGAAGGTACTTCGGTGATTGTAAGGAGGAAGAACTCTTACCCAAAGCTATGGATGAGTCAGTG
GCAAGAAAACTGTGGGATATCAGTGAAGTGATGGTTGGCATTCTAAAATAGGAGTAAAGATAAC
AGGACTATTTATAAGATGATCCATTACACCCTTGGACAGGAATGGTATGTTGTGAGCATGTGCT
ACTTGAAAACAGCCTTGCAGCAATCCTGAGAGATGCATGTGGGCATTTGAAGGACACTGCTATT
ATTTGGGGCTAATACAAAGTTCAGCAAAGATGTTATAAATGTGGATCATAACTAAAATGTAACA
ATTCTGTTTTATTAAATATAATTGGGCAATTATAACTTAAATATACTGGTAATTTAAAAGATAT
CTTAAGAGGGTTTTCCAAAATTTTGATTTTCATGGCAAAAATGTTCAGAATTTTTACTACAATG
TTTGTTTTGTGGAAATGCCTAATGTATGCACATAAATCATCACTTGGAATAAATGTATGATGTA
GGTTTTTCA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001102746	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM03092	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000006020.4

RefSeq Acc Id:

NP_001102746 ⟸ NM_001109276

- UniProtKB:

D3ZUY0 (UniProtKB/TrEMBL), A6HAN7 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAVASVAAALLAALGGALWLAARRFSGSSGQRRQGGGDPGLMHGKTVLITGANSGLGRATAGEL
LRLGARVIMGCRDRARAEEAAGQLRQELGQAGGLGPDATDGQLVVKELDLASLRSVRAFCQELL
QEEPRLDVLINNAGVFQCPYTKTEDGFEMQFGVNHLGHFLLTNLLLGLLKSSAPSRIVVVSSKL
YKYGDINFEDLNSEQSYNKSFCYSRSKLANILFTRELAHRLEGTNVTVNVLHPGIVRTNLGRHI
HIPLLARPLFNLVSWAFFKTPLEGAQTSIYLASSPDVEGVSGRYFGDCKEEELLPKAMDESVAR
KLWDISEVMVGILK

hide sequence

Ensembl Acc Id:

ENSRNOP00000006020 ⟸ ENSRNOT00000006020

Ensembl Acc Id:

ENSRNOP00000076047 ⟸ ENSRNOT00000093003

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZUY0-F1-model_v2	AlphaFold	D3ZUY0	1-334	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13694501

Promoter ID:

EPDNEW_R5017

Type:

single initiation site

Name:

Rdh14_1

Description:

retinol dehydrogenase 14

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	6	36,107,605 - 36,107,665	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1565196	AgrOrtholog
BioCyc Gene	G2FUF-38156	BioCyc
BioCyc Pathway	PWY-6857 [retinol biosynthesis]	BioCyc
	PWY-6861 [the visual cycle I (vertebrates)]	BioCyc
BioCyc Pathway Image	PWY-6857	BioCyc
	PWY-6861	BioCyc
Ensembl Genes	ENSRNOG00000039551	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000006020.7	UniProtKB/TrEMBL
Gene3D-CATH	NAD(P)-binding Rossmann-like Domain	UniProtKB/TrEMBL
InterPro	Glc/ribitol_DH	UniProtKB/TrEMBL
	NAD(P)-bd_dom_sf	UniProtKB/TrEMBL
KEGG Report	rno:500629	UniProtKB/TrEMBL
NCBI Gene	500629	ENTREZGENE
PANTHER	DEHYDROGENASES, SHORT CHAIN	UniProtKB/TrEMBL
	PHOSPHATIDYLINOSITOL-GLYCAN BIOSYNTHESIS CLASS F PROTEIN-RELATED	UniProtKB/TrEMBL
Pfam	adh_short	UniProtKB/TrEMBL
PhenoGen	Rdh14	PhenoGen
PRINTS	GDHRDH	UniProtKB/TrEMBL
	SDRFAMILY	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000039551	RatGTEx
Superfamily-SCOP	SSF51735	UniProtKB/TrEMBL
UniProt	A6HAN7	ENTREZGENE, UniProtKB/TrEMBL
	D3ZUY0	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-12-22	Rdh14	retinol dehydrogenase 14	Rdh14	retinol dehydrogenase 14 (all-trans/9-cis/11-cis)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-24	Rdh14	retinol dehydrogenase 14 (all-trans/9-cis/11-cis)	Rdh14	retinol dehydrogenase 14 (all-trans and 9-cis)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-07	Rdh14	retinol dehydrogenase 14 (all-trans and 9-cis)	RGD1565196_predicted	similar to alcohol dehydrogenase PAN2 (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-07	RGD1565196_predicted	similar to alcohol dehydrogenase PAN2 (predicted)	LOC500629	similar to alcohol dehydrogenase PAN2	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC500629	similar to alcohol dehydrogenase PAN2			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

BioCyc Pathways

Send us a Message

Imported Disease Annotations - ClinVar

BioCyc Pathways