Advanced Search (OLGA)

Gene: Retreg1 (reticulophagy regulator 1) Rattus norvegicus

Analyze

Symbol:

Retreg1

Name:

reticulophagy regulator 1

RGD ID:

1565003

Description:

Predicted to enable endoplasmic reticulum-autophagosome adaptor activity. Predicted to be involved in negative regulation of neuron apoptotic process; reticulophagy; and sensory perception of pain. Predicted to act upstream of or within several processes, including collagen catabolic process; mitophagy; and white fat cell differentiation. Predicted to be located in cis-Golgi network; endoplasmic reticulum; and nuclear lumen. Predicted to be active in endoplasmic reticulum membrane. Human ortholog(s) of this gene implicated in hereditary sensory and autonomic neuropathy type 2B. Orthologous to human RETREG1 (reticulophagy regulator 1); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 3,3',4,4',5-pentachlorobiphenyl.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Fam134b; family with sequence similarity 134, member B; hypothetical protein LOC619558; LOC103689968; LOC619558; protein FAM134B; reticulophagy receptor 1; reticulophagy receptor FAM134B

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RETREG1 (reticulophagy regulator 1)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, Panther
Mus musculus (house mouse):	Retreg1 (reticulophagy regulator 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Retreg1 (reticulophagy regulator 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RETREG1 (reticulophagy regulator 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RETREG1 (reticulophagy regulator 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Retreg1 (reticulophagy regulator 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RETREG1 (reticulophagy regulator 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RETREG1 (reticulophagy regulator 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Retreg1 (reticulophagy regulator 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	ZNF622 (zinc finger protein 622)	HGNC	Ensembl, OrthoDB
Alliance orthologs ³
Homo sapiens (human):	RETREG1 (reticulophagy regulator 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Retreg1 (reticulophagy regulator 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	retreg1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	retreg1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	78,045,435 - 78,205,316 (+)	NCBI		GRCr8
mRatBN7.2	2	76,335,609 - 76,474,817 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	76,335,609 - 76,493,898 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	83,455,839 - 83,595,059 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	81,577,567 - 81,716,777 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	76,582,768 - 76,722,071 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	78,391,921 - 78,401,569 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	78,103,387 - 78,276,927 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_6.0 Ensembl	2	78,391,921 - 78,399,987 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	97,821,407 - 97,972,821 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	77,470,558 - 77,566,123 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	2	72,093,456 - 72,182,485 (+)	NCBI		Celera
Cytogenetic Map	2	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Imported Disease Annotations - ClinVar

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Retreg1	Rat	Charcot-Marie-Tooth disease		ISO	RGD:1601869	8554872	ClinVar Annotator: match by term: Charcot-Marie-Tooth disease	ClinVar	PMID:19838196\|PMID:24327336\|PMID:25741868\|PMID:28492532\|PMID:31737055\|PMID:33199694\|PMID:35332675
Retreg1	Rat	genetic disease		ISO	RGD:1601869	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar	PMID:19838196\|PMID:25741868\|PMID:28492532\|PMID:31737055\|PMID:33199694\|PMID:35332675
Retreg1	Rat	hereditary sensory and autonomic neuropathy type 2		ISO	RGD:1601869	8554872	ClinVar Annotator: match by term: Hereditary sensory and autonomic neuropathy type 2	ClinVar	PMID:19838196\|PMID:24327336\|PMID:25741868\|PMID:28492532\|PMID:31737055\|PMID:33199694\|PMID:35332675
Retreg1	Rat	hereditary sensory and autonomic neuropathy type 2A		ISO	RGD:1601869	8554872	ClinVar Annotator: match by term: Neuropathy, hereditary sensory and autonomic, type 2A	ClinVar	PMID:25741868\|PMID:28492532
Retreg1	Rat	hereditary sensory and autonomic neuropathy type 2B		ISO	RGD:1601869	8554872	ClinVar Annotator: match by term: Neuropathy, hereditary sensory and autonomic, type 2B \| ClinVar Annotator: more ...	ClinVar	PMID:17576681\|PMID:19838196\|PMID:24327336\|PMID:25741868\|PMID:28492532\|PMID:31737055\|PMID:33199694\|PMID:35332675\|PMID:9536098
Retreg1	Rat	hereditary spastic paraplegia		ISO	RGD:1601869	8554872	ClinVar Annotator: match by term: Hereditary spastic paraplegia	ClinVar	PMID:25741868
Retreg1	Rat	Neurodevelopmental Disorders		ISO	RGD:1601869	8554872	ClinVar Annotator: match by term: Neurodevelopmental disorder	ClinVar	PMID:25741868

Imported Disease Annotations - CTD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Retreg1	Rat	hereditary sensory and autonomic neuropathy type 2		ISO	RGD:1601869	11554173	CTD Direct Evidence: marker/mechanism	CTD
Retreg1	Rat	hereditary sensory neuropathy		ISO	RGD:1601869	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:19838196

Imported Disease Annotations - OMIA

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Retreg1	Rat	Vesicoureteral Reflux 5		ISO	RGD:12057336	9068941	Neuropathy, sensory, RETREG1-related	OMIA	PMID:15971901\|PMID:16266014\|PMID:23123885\|PMID:27527794\|PMID:30307654\|PMID:30955094\|PMID:34387380\|PMID:38003185\|PMID:39377488\|PMID:6295050

Imported Disease Annotations - OMIM

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Retreg1	Rat	hereditary sensory and autonomic neuropathy type 2B		ISO	RGD:1601869	7240710		OMIM

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Retreg1	Rat	(1->4)-beta-D-glucan	multiple interactions	ISO	RGD:1614369	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of RETREG1 mRNA	CTD	PMID:36331819
Retreg1	Rat	(2,4,5-trichlorophenoxy)acetic acid	decreases expression	ISO	RGD:1614369	6480464	2,4,5-Trichlorophenoxyacetic Acid results in decreased expression of RETREG1 mRNA	CTD	PMID:18579281
Retreg1	Rat	1,2-dimethylhydrazine	decreases expression	ISO	RGD:1614369	6480464	1,2-Dimethylhydrazine results in decreased expression of FAM134B mRNA	CTD	PMID:22206623
Retreg1	Rat	17alpha-ethynylestradiol	affects expression	ISO	RGD:1614369	6480464	Ethinyl Estradiol affects the expression of RETREG1 mRNA	CTD	PMID:17555576
Retreg1	Rat	17beta-estradiol	increases expression	ISO	RGD:1601869	6480464	Estradiol results in increased expression of RETREG1 mRNA	CTD	PMID:23019147\|PMID:24758408
Retreg1	Rat	17beta-estradiol	decreases expression	ISO	RGD:1614369	6480464	Estradiol results in decreased expression of RETREG1 mRNA	CTD	PMID:39298647
Retreg1	Rat	17beta-estradiol	affects expression	EXP		6480464	Estradiol affects the expression of FAM134B mRNA	CTD	PMID:32145629
Retreg1	Rat	17beta-estradiol	multiple interactions	EXP		6480464	[bisphenol A co-treated with Estradiol] results in increased expression of RETREG1 mRNA	CTD	PMID:26496021
Retreg1	Rat	17beta-estradiol	multiple interactions	ISO	RGD:1601869	6480464	[Estradiol co-treated with Progesterone] results in decreased expression of RETREG1 mRNA; [Estradiol co-treated with TGFB1 more ...	CTD	PMID:17404688\|PMID:20660070\|PMID:24758408\|PMID:30165855
Retreg1	Rat	2,2',4,4'-Tetrabromodiphenyl ether	multiple interactions	ISO	RGD:1614369	6480464	[Flame Retardants results in increased abundance of 2,2',4,4'-tetrabromodiphenyl ether] which results in increased expression of more ...	CTD	PMID:38995820
Retreg1	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of RETREG1 mRNA	CTD	PMID:18796159\|PMID:21215274
Retreg1	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	RGD:1614369	6480464	Tetrachlorodibenzodioxin results in increased expression of RETREG1 mRNA	CTD	PMID:20819909
Retreg1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	RGD:1614369	6480464	Tetrachlorodibenzodioxin affects the expression of RETREG1 mRNA	CTD	PMID:21570461
Retreg1	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	RGD:1614369	6480464	Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to RETREG1 gene]	CTD	PMID:20819909
Retreg1	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	RGD:1614369	6480464	Tetrachlorodibenzodioxin results in decreased expression of RETREG1 mRNA	CTD	PMID:19770486
Retreg1	Rat	2,4-dibromophenyl 2,4,5-tribromophenyl ether	increases expression	ISO	RGD:1601869	6480464	2,2',4,4',5-brominated diphenyl ether results in increased expression of FAM134B mRNA	CTD	PMID:26705709
Retreg1	Rat	3,3',4,4',5-pentachlorobiphenyl	decreases expression	EXP		6480464	3,4,5,3',4'-pentachlorobiphenyl results in decreased expression of RETREG1 mRNA	CTD	PMID:23196670
Retreg1	Rat	3-isobutyl-1-methyl-7H-xanthine	multiple interactions	ISO	RGD:1601869	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in increased expression more ...	CTD	PMID:28628672
Retreg1	Rat	4,4'-sulfonyldiphenol	decreases methylation	ISO	RGD:1614369	6480464	bisphenol S results in decreased methylation of RETREG1 exon	CTD	PMID:33297965
Retreg1	Rat	4,4'-sulfonyldiphenol	increases methylation	ISO	RGD:1601869	6480464	bisphenol S results in increased methylation of RETREG1 gene	CTD	PMID:31601247
Retreg1	Rat	4,4'-sulfonyldiphenol	decreases expression	ISO	RGD:1614369	6480464	bisphenol S results in decreased expression of RETREG1 mRNA	CTD	PMID:39298647
Retreg1	Rat	4-hydroxyphenyl retinamide	increases expression	ISO	RGD:1614369	6480464	Fenretinide results in increased expression of RETREG1 mRNA	CTD	PMID:28973697
Retreg1	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of FAM134B mRNA	CTD	PMID:30047161
Retreg1	Rat	actinomycin D	multiple interactions	ISO	RGD:1601869	6480464	[Dactinomycin co-treated with nutlin 3] results in increased expression of FAM134B mRNA	CTD	PMID:38460933
Retreg1	Rat	aflatoxin B1	increases methylation	ISO	RGD:1601869	6480464	Aflatoxin B1 results in increased methylation of FAM134B intron; Aflatoxin B1 results in increased methylation more ...	CTD	PMID:27153756\|PMID:30157460
Retreg1	Rat	aldehydo-D-glucose	multiple interactions	EXP		6480464	Chlorogenic Acid inhibits the reaction [Glucose results in decreased expression of RETREG1 protein]	CTD	PMID:34801538
Retreg1	Rat	aldehydo-D-glucose	decreases expression	EXP		6480464	Glucose results in decreased expression of RETREG1 protein	CTD	PMID:34801538
Retreg1	Rat	aldrin	decreases expression	ISO	RGD:1614369	6480464	Aldrin results in decreased expression of RETREG1 mRNA	CTD	PMID:18579281
Retreg1	Rat	antirheumatic drug	decreases expression	ISO	RGD:1601869	6480464	Antirheumatic Agents results in decreased expression of RETREG1 mRNA	CTD	PMID:24449571
Retreg1	Rat	aristolochic acid A	increases expression	ISO	RGD:1601869	6480464	aristolochic acid I results in increased expression of RETREG1 mRNA	CTD	PMID:33212167
Retreg1	Rat	benzo[a]pyrene	decreases expression	ISO	RGD:1614369	6480464	Benzo(a)pyrene results in decreased expression of RETREG1 mRNA	CTD	PMID:19770486\|PMID:22228805
Retreg1	Rat	benzo[a]pyrene	decreases expression	ISO	RGD:1601869	6480464	Benzo(a)pyrene results in decreased expression of RETREG1 mRNA	CTD	PMID:32234424
Retreg1	Rat	benzo[a]pyrene	affects methylation	ISO	RGD:1601869	6480464	Benzo(a)pyrene affects the methylation of FAM134B promoter	CTD	PMID:27901495
Retreg1	Rat	bisphenol A	multiple interactions	EXP		6480464	[bisphenol A co-treated with Estradiol] results in increased expression of RETREG1 mRNA	CTD	PMID:26496021
Retreg1	Rat	bisphenol A	increases expression	ISO	RGD:1614369	6480464	bisphenol A results in increased expression of RETREG1 mRNA	CTD	PMID:32156529\|PMID:34585602
Retreg1	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of RETREG1 mRNA	CTD	PMID:34947998
Retreg1	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of RETREG1 mRNA	CTD	PMID:33296240
Retreg1	Rat	bisphenol A	affects expression	EXP		6480464	bisphenol A affects the expression of FAM134B mRNA; bisphenol A affects the expression of RETREG1 more ...	CTD	PMID:25181051\|PMID:32145629
Retreg1	Rat	buspirone	increases expression	EXP		6480464	Buspirone results in increased expression of RETREG1 mRNA	CTD	PMID:24136188
Retreg1	Rat	cadmium atom	multiple interactions	ISO	RGD:1614369	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of RETREG1 more ...	CTD	PMID:37325564
Retreg1	Rat	cadmium dichloride	decreases expression	ISO	RGD:1601869	6480464	Cadmium Chloride results in decreased expression of RETREG1 mRNA	CTD	PMID:38568856
Retreg1	Rat	cadmium dichloride	multiple interactions	ISO	RGD:1614369	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of RETREG1 more ...	CTD	PMID:37325564
Retreg1	Rat	carbamazepine	affects expression	ISO	RGD:1601869	6480464	Carbamazepine affects the expression of RETREG1 mRNA	CTD	PMID:25979313
Retreg1	Rat	carbon nanotube	increases expression	ISO	RGD:1614369	6480464	Nanotubes, Carbon results in increased expression of RETREG1 mRNA	CTD	PMID:25554681
Retreg1	Rat	carbon nanotube	decreases expression	ISO	RGD:1614369	6480464	Nanotubes, Carbon results in decreased expression of RETREG1 mRNA	CTD	PMID:25620056
Retreg1	Rat	chloroethene	decreases expression	ISO	RGD:1614369	6480464	Vinyl Chloride results in decreased expression of RETREG1 mRNA	CTD	PMID:18579281
Retreg1	Rat	chlorogenic acid	multiple interactions	EXP		6480464	Chlorogenic Acid inhibits the reaction [Glucose results in decreased expression of RETREG1 protein]	CTD	PMID:34801538
Retreg1	Rat	cisplatin	increases expression	ISO	RGD:1601869	6480464	Cisplatin results in increased expression of RETREG1 mRNA	CTD	PMID:27392435\|PMID:27594783
Retreg1	Rat	cisplatin	multiple interactions	ISO	RGD:1601869	6480464	[Cisplatin co-treated with jinfukang] results in increased expression of RETREG1 mRNA	CTD	PMID:27392435
Retreg1	Rat	cobalt dichloride	increases expression	ISO	RGD:1601869	6480464	cobaltous chloride results in increased expression of RETREG1 mRNA	CTD	PMID:19376846
Retreg1	Rat	copper atom	multiple interactions	ISO	RGD:1614369	6480464	[ATP7A gene mutant form results in increased abundance of Copper] which results in increased expression more ...	CTD	PMID:15467011
Retreg1	Rat	copper(0)	multiple interactions	ISO	RGD:1614369	6480464	[ATP7A gene mutant form results in increased abundance of Copper] which results in increased expression more ...	CTD	PMID:15467011
Retreg1	Rat	copper(II) sulfate	decreases expression	ISO	RGD:1614369	6480464	Copper Sulfate results in decreased expression of RETREG1 mRNA	CTD	PMID:18579281
Retreg1	Rat	cyclosporin A	increases expression	ISO	RGD:1601869	6480464	Cyclosporine results in increased expression of RETREG1 mRNA	CTD	PMID:27989131
Retreg1	Rat	cyclosporin A	decreases expression	ISO	RGD:1614369	6480464	Cyclosporine results in decreased expression of RETREG1 mRNA	CTD	PMID:19770486
Retreg1	Rat	D-glucose	multiple interactions	EXP		6480464	Chlorogenic Acid inhibits the reaction [Glucose results in decreased expression of RETREG1 protein]	CTD	PMID:34801538
Retreg1	Rat	D-glucose	decreases expression	EXP		6480464	Glucose results in decreased expression of RETREG1 protein	CTD	PMID:34801538
Retreg1	Rat	decabromodiphenyl ether	increases expression	EXP		6480464	decabromobiphenyl ether results in increased expression of RETREG1 mRNA	CTD	PMID:32679240
Retreg1	Rat	dexamethasone	increases expression	ISO	RGD:1601869	6480464	Dexamethasone results in increased expression of RETREG1 mRNA	CTD	PMID:25047013
Retreg1	Rat	dexamethasone	multiple interactions	ISO	RGD:1601869	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in increased expression more ...	CTD	PMID:28628672
Retreg1	Rat	diethyl phthalate	decreases expression	EXP		6480464	diethyl phthalate results in decreased expression of FAM134B mRNA	CTD	PMID:32341500
Retreg1	Rat	diquat	decreases expression	ISO	RGD:1614369	6480464	Diquat results in decreased expression of RETREG1 protein	CTD	PMID:36851058
Retreg1	Rat	diuron	decreases expression	EXP		6480464	Diuron results in decreased expression of RETREG1 mRNA	CTD	PMID:21551480
Retreg1	Rat	dorsomorphin	multiple interactions	ISO	RGD:1601869	6480464	[NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ...	CTD	PMID:27188386
Retreg1	Rat	doxorubicin	decreases expression	ISO	RGD:1601869	6480464	Doxorubicin results in decreased expression of RETREG1 mRNA	CTD	PMID:29803840
Retreg1	Rat	fenthion	increases expression	ISO	RGD:1614369	6480464	Fenthion results in increased expression of RETREG1 mRNA	CTD	PMID:34813904
Retreg1	Rat	furan	increases expression	EXP		6480464	furan results in increased expression of RETREG1 mRNA	CTD	PMID:26194646
Retreg1	Rat	gentamycin	decreases expression	EXP		6480464	Gentamicins results in decreased expression of RETREG1 mRNA	CTD	PMID:22061828
Retreg1	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of RETREG1 mRNA	CTD	PMID:33387578
Retreg1	Rat	glafenine	increases expression	EXP		6480464	Glafenine results in increased expression of RETREG1 mRNA	CTD	PMID:24136188
Retreg1	Rat	glucose	decreases expression	EXP		6480464	Glucose results in decreased expression of RETREG1 protein	CTD	PMID:34801538
Retreg1	Rat	glucose	multiple interactions	EXP		6480464	Chlorogenic Acid inhibits the reaction [Glucose results in decreased expression of RETREG1 protein]	CTD	PMID:34801538
Retreg1	Rat	glutathione	increases expression	EXP		6480464	Glutathione deficiency results in increased expression of RETREG1 mRNA	CTD	PMID:20621112
Retreg1	Rat	indometacin	multiple interactions	ISO	RGD:1601869	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in increased expression more ...	CTD	PMID:28628672
Retreg1	Rat	inulin	multiple interactions	ISO	RGD:1614369	6480464	[perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of RETREG1 mRNA	CTD	PMID:36331819
Retreg1	Rat	iron dichloride	decreases expression	ISO	RGD:1601869	6480464	ferrous chloride results in decreased expression of RETREG1 mRNA	CTD	PMID:35984750
Retreg1	Rat	isotretinoin	decreases expression	ISO	RGD:1601869	6480464	Isotretinoin results in decreased expression of RETREG1 mRNA	CTD	PMID:20436886
Retreg1	Rat	lead diacetate	increases expression	EXP		6480464	lead acetate results in increased expression of RETREG1 mRNA	CTD	PMID:22641619
Retreg1	Rat	lead(0)	affects expression	ISO	RGD:1601869	6480464	Lead affects the expression of RETREG1 mRNA	CTD	PMID:28903495
Retreg1	Rat	levofloxacin	increases expression	EXP		6480464	Levofloxacin results in increased expression of RETREG1 mRNA	CTD	PMID:24136188
Retreg1	Rat	lipopolysaccharide	multiple interactions	ISO	RGD:1601869	6480464	[S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of RETREG1 mRNA	CTD	PMID:35811015
Retreg1	Rat	menadione	affects expression	ISO	RGD:1601869	6480464	Vitamin K 3 affects the expression of RETREG1 mRNA	CTD	PMID:20044591
Retreg1	Rat	mercury dibromide	increases expression	ISO	RGD:1601869	6480464	mercuric bromide results in increased expression of RETREG1 mRNA	CTD	PMID:26272509
Retreg1	Rat	mercury dibromide	multiple interactions	ISO	RGD:1601869	6480464	[NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ...	CTD	PMID:27188386
Retreg1	Rat	methapyrilene	decreases expression	EXP		6480464	Methapyrilene results in decreased expression of FAM134B mRNA	CTD	PMID:30467583
Retreg1	Rat	methimazole	increases expression	EXP		6480464	Methimazole results in increased expression of FAM134B mRNA	CTD	PMID:30047161
Retreg1	Rat	methylmercury chloride	decreases expression	ISO	RGD:1601869	6480464	methylmercuric chloride results in decreased expression of RETREG1 mRNA	CTD	PMID:28001369
Retreg1	Rat	N-nitrosodiethylamine	multiple interactions	EXP		6480464	[Diethylnitrosamine co-treated with Phenobarbital co-treated with Dietary Fats] results in increased expression of FAM134B protein	CTD	PMID:36657701
Retreg1	Rat	nefazodone	increases expression	EXP		6480464	nefazodone results in increased expression of RETREG1 mRNA	CTD	PMID:24136188
Retreg1	Rat	nevirapine	increases expression	EXP		6480464	Nevirapine metabolite results in increased expression of RETREG1 mRNA; Nevirapine results in increased expression of more ...	CTD	PMID:23947594
Retreg1	Rat	nickel sulfate	increases expression	ISO	RGD:1601869	6480464	nickel sulfate results in increased expression of RETREG1 mRNA	CTD	PMID:22714537
Retreg1	Rat	Nutlin-3	multiple interactions	ISO	RGD:1601869	6480464	[Dactinomycin co-treated with nutlin 3] results in increased expression of FAM134B mRNA	CTD	PMID:38460933
Retreg1	Rat	O-methyleugenol	decreases expression	ISO	RGD:1601869	6480464	methyleugenol results in decreased expression of RETREG1 mRNA	CTD	PMID:32234424
Retreg1	Rat	okadaic acid	decreases expression	ISO	RGD:1601869	6480464	Okadaic Acid results in decreased expression of RETREG1 mRNA	CTD	PMID:38832940
Retreg1	Rat	oxaliplatin	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in increased expression of RETREG1 mRNA	CTD	PMID:25729387
Retreg1	Rat	paracetamol	affects expression	ISO	RGD:1614369	6480464	Acetaminophen affects the expression of RETREG1 mRNA	CTD	PMID:17562736
Retreg1	Rat	paracetamol	decreases expression	ISO	RGD:1601869	6480464	Acetaminophen results in decreased expression of RETREG1 mRNA	CTD	PMID:29067470
Retreg1	Rat	paraquat	increases expression	EXP		6480464	Paraquat results in increased expression of RETREG1 mRNA	CTD	PMID:32680482
Retreg1	Rat	parathion	increases expression	ISO	RGD:1614369	6480464	Parathion results in increased expression of RETREG1 mRNA	CTD	PMID:34813904
Retreg1	Rat	perfluorohexanesulfonic acid	increases expression	ISO	RGD:1614369	6480464	perfluorohexanesulfonic acid results in increased expression of RETREG1 mRNA	CTD	PMID:37995155
Retreg1	Rat	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	RGD:1614369	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of RETREG1 mRNA; [perfluorooctane sulfonic more ...	CTD	PMID:36331819
Retreg1	Rat	phenobarbital	multiple interactions	EXP		6480464	[Diethylnitrosamine co-treated with Phenobarbital co-treated with Dietary Fats] results in increased expression of FAM134B protein	CTD	PMID:36657701
Retreg1	Rat	phenylmercury acetate	increases expression	ISO	RGD:1601869	6480464	Phenylmercuric Acetate results in increased expression of RETREG1 mRNA	CTD	PMID:26272509
Retreg1	Rat	phenylmercury acetate	multiple interactions	ISO	RGD:1601869	6480464	[NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ...	CTD	PMID:27188386
Retreg1	Rat	pirinixic acid	multiple interactions	ISO	RGD:1601869	6480464	[pirinixic acid binds to and results in increased activity of PPARA protein] which results in more ...	CTD	PMID:19710929
Retreg1	Rat	pirinixic acid	increases expression	ISO	RGD:1614369	6480464	pirinixic acid results in increased expression of RETREG1 mRNA	CTD	PMID:17426115
Retreg1	Rat	potassium chromate	increases expression	ISO	RGD:1601869	6480464	potassium chromate(VI) results in increased expression of RETREG1 mRNA	CTD	PMID:22714537
Retreg1	Rat	pregnenolone 16alpha-carbonitrile	increases expression	ISO	RGD:1614369	6480464	Pregnenolone Carbonitrile results in increased expression of RETREG1 mRNA	CTD	PMID:28903501
Retreg1	Rat	progesterone	multiple interactions	ISO	RGD:1601869	6480464	[Estradiol co-treated with Progesterone] results in decreased expression of RETREG1 mRNA; [Progesterone co-treated with Estradiol] more ...	CTD	PMID:17404688\|PMID:20660070
Retreg1	Rat	propanal	increases expression	ISO	RGD:1601869	6480464	propionaldehyde results in increased expression of RETREG1 mRNA	CTD	PMID:26079696
Retreg1	Rat	propiconazole	decreases expression	ISO	RGD:1614369	6480464	propiconazole results in decreased expression of RETREG1 mRNA	CTD	PMID:21278054
Retreg1	Rat	raloxifene	multiple interactions	ISO	RGD:1601869	6480464	[Raloxifene Hydrochloride co-treated with ESR2 protein] results in decreased expression of RETREG1 mRNA	CTD	PMID:19059307
Retreg1	Rat	S-(1,2-dichlorovinyl)-L-cysteine	multiple interactions	ISO	RGD:1601869	6480464	[S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of RETREG1 mRNA	CTD	PMID:35811015
Retreg1	Rat	SB 431542	multiple interactions	ISO	RGD:1601869	6480464	[NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ...	CTD	PMID:27188386
Retreg1	Rat	silicon dioxide	decreases expression	ISO	RGD:1601869	6480464	Silicon Dioxide analog results in decreased expression of RETREG1 mRNA	CTD	PMID:25895662
Retreg1	Rat	sodium arsenite	decreases expression	ISO	RGD:1614369	6480464	sodium arsenite results in decreased expression of RETREG1 mRNA	CTD	PMID:37682722
Retreg1	Rat	sodium dichromate	increases expression	EXP		6480464	sodium bichromate results in increased expression of RETREG1 mRNA	CTD	PMID:25993096
Retreg1	Rat	tamoxifen	multiple interactions	ISO	RGD:1601869	6480464	[Tamoxifen co-treated with ESR2 protein] results in decreased expression of RETREG1 mRNA	CTD	PMID:19059307
Retreg1	Rat	tamoxifen	affects expression	ISO	RGD:1614369	6480464	Tamoxifen affects the expression of RETREG1 mRNA	CTD	PMID:17555576\|PMID:20937368
Retreg1	Rat	temozolomide	decreases expression	ISO	RGD:1601869	6480464	Temozolomide results in decreased expression of RETREG1 mRNA	CTD	PMID:31758290
Retreg1	Rat	tetrachloroethene	increases expression	ISO	RGD:1614369	6480464	Tetrachloroethylene results in increased expression of RETREG1 mRNA	CTD	PMID:28973375
Retreg1	Rat	tetrachloromethane	increases expression	ISO	RGD:1614369	6480464	Carbon Tetrachloride results in increased expression of RETREG1 mRNA	CTD	PMID:27339419\|PMID:31919559
Retreg1	Rat	tetrachloromethane	increases expression	EXP		6480464	Carbon Tetrachloride results in increased expression of RETREG1 mRNA	CTD	PMID:31150632
Retreg1	Rat	tetrachloromethane	affects expression	ISO	RGD:1614369	6480464	Carbon Tetrachloride affects the expression of RETREG1 mRNA	CTD	PMID:17484886
Retreg1	Rat	titanium dioxide	decreases methylation	ISO	RGD:1614369	6480464	titanium dioxide results in decreased methylation of FAM134B promoter	CTD	PMID:35295148
Retreg1	Rat	topotecan	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in increased expression of RETREG1 mRNA	CTD	PMID:25729387
Retreg1	Rat	trichostatin A	increases expression	ISO	RGD:1601869	6480464	trichostatin A results in increased expression of RETREG1 mRNA	CTD	PMID:24935251
Retreg1	Rat	triphenyl phosphate	affects expression	ISO	RGD:1601869	6480464	triphenyl phosphate affects the expression of RETREG1 mRNA	CTD	PMID:37042841
Retreg1	Rat	valproic acid	affects expression	ISO	RGD:1601869	6480464	Valproic Acid affects the expression of RETREG1 mRNA	CTD	PMID:25979313
Retreg1	Rat	valproic acid	increases expression	ISO	RGD:1601869	6480464	Valproic Acid results in increased expression of RETREG1 mRNA	CTD	PMID:19101580\|PMID:23179753\|PMID:24383497\|PMID:24935251\|PMID:26272509\|PMID:28001369\|PMID:29154799
Retreg1	Rat	valproic acid	multiple interactions	ISO	RGD:1601869	6480464	[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ...	CTD	PMID:27188386
Retreg1	Rat	vinclozolin	increases expression	EXP		6480464	vinclozolin results in increased expression of RETREG1 mRNA	CTD	PMID:23034163
Retreg1	Rat	vitamin E	decreases expression	ISO	RGD:1601869	6480464	Vitamin E results in decreased expression of RETREG1 mRNA	CTD	PMID:19244175
Retreg1	Rat	zoledronic acid	increases expression	ISO	RGD:1601869	6480464	zoledronic acid results in increased expression of RETREG1 mRNA	CTD	PMID:24714768

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Retreg1	Rat	autophagy	involved_in	IEA	UniProtKB-KW:KW-0072	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Retreg1	Rat	autophagy	acts_upstream_of_or_within	ISO	RGD:1614369	1624291	PMID:31446166	RGD	PMID:31446166
Retreg1	Rat	collagen catabolic process	acts_upstream_of_or_within	ISO	RGD:1614369	1624291	PMID:34338405	RGD	PMID:34338405
Retreg1	Rat	endoplasmic reticulum organization	acts_upstream_of_or_within	ISO	RGD:1614369	1624291	PMID:34338405	RGD	PMID:34338405
Retreg1	Rat	mitophagy	acts_upstream_of_or_within	ISO	RGD:1614369	1624291	PMID:31446166	RGD	PMID:31446166
Retreg1	Rat	negative regulation of neuron apoptotic process	involved_in	ISO	RGD:1614369	1624291	PMID:26040720	RGD	PMID:26040720
Retreg1	Rat	negative regulation of neuron apoptotic process	involved_in	IBA	MGI:1913520\|PANTHER:PTN002823632\|UniProtKB:Q9H6L5	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Retreg1	Rat	negative regulation of neuron apoptotic process	involved_in	ISO	RGD:1601869	1624291	PMID:26040720	RGD	PMID:26040720
Retreg1	Rat	negative regulation of neuron apoptotic process	involved_in	ISS	UniProtKB:Q9H6L5	1600115	GO_REF:0000024	GO_Central	GO_REF:0000024
Retreg1	Rat	reticulophagy	involved_in	ISS	UniProtKB:Q9H6L5	1600115	GO_REF:0000024	GO_Central	GO_REF:0000024
Retreg1	Rat	reticulophagy	acts_upstream_of_or_within	ISO	RGD:1614369	1624291	PMID:34338405	RGD	PMID:34338405
Retreg1	Rat	reticulophagy	involved_in	IBA	MGI:1913520\|PANTHER:PTN002823632\|UniProtKB:Q9H6L5	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Retreg1	Rat	reticulophagy	involved_in	ISO	RGD:1614369	1624291	PMID:26040720	RGD	PMID:26040720
Retreg1	Rat	reticulophagy	involved_in	IEA	InterPro:IPR043384	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Retreg1	Rat	reticulophagy	involved_in	ISO	RGD:1601869	1624291	PMID:26040720, PMID:31930741	RGD	PMID:26040720\|PMID:31930741
Retreg1	Rat	ribosomal large subunit biogenesis	involved_in	IEA	ARBA:ARBA00044859	1600115	GO_REF:0000117	UniProt	GO_REF:0000117
Retreg1	Rat	ribosome biogenesis	involved_in	IEA	UniProtKB-KW:KW-0690	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Retreg1	Rat	sensory perception of pain	involved_in	ISS	UniProtKB:Q9H6L5	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Retreg1	Rat	sensory perception of pain	involved_in	ISO	RGD:1601869	1624291	PMID:19838196	RGD	PMID:19838196
Retreg1	Rat	substrate localization to autophagosome	involved_in	IEA	GO:0140506	1600115	GO_REF:0000108	GOC	GO_REF:0000108
Retreg1	Rat	white fat cell differentiation	acts_upstream_of_or_within	ISO	RGD:1614369	1624291	PMID:31446166	RGD	PMID:31446166

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Retreg1	Rat	cis-Golgi network	located_in	ISS	UniProtKB:Q8VE91	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Retreg1	Rat	cis-Golgi network	located_in	ISO	RGD:1614369	1624291	PMID:19838196	RGD	PMID:19838196
Retreg1	Rat	cytoplasm	located_in	IEA	UniProtKB-SubCell:SL-0086	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Retreg1	Rat	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Retreg1	Rat	endoplasmic reticulum	located_in	ISO	RGD:1601869	1624291	PMID:35239449	RGD	PMID:35239449
Retreg1	Rat	endoplasmic reticulum	located_in	ISO	RGD:1614369	1624291	PMID:34338405	RGD	PMID:34338405
Retreg1	Rat	endoplasmic reticulum	located_in	IEA	UniProtKB-KW:KW-0256	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Retreg1	Rat	endoplasmic reticulum	located_in	ISO	RGD:1601869\|UniProtKB:Q9H6L5-1\|UniProtKB:Q9H6L5-2	1624291		RGD	GO_REF:0000052
Retreg1	Rat	endoplasmic reticulum membrane	is_active_in	IBA	PANTHER:PTN002823632\|UniProtKB:Q9H6L5	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Retreg1	Rat	endoplasmic reticulum membrane	located_in	IEA	UniProtKB-SubCell:SL-0097	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Retreg1	Rat	endoplasmic reticulum membrane	located_in	ISS	UniProtKB:Q9H6L5	1600115	GO_REF:0000024	GO_Central	GO_REF:0000024
Retreg1	Rat	endoplasmic reticulum membrane	located_in	ISO	RGD:1601869	1624291	PMID:26040720	RGD	PMID:26040720
Retreg1	Rat	Golgi apparatus	located_in	IEA	UniProtKB-SubCell:SL-0132	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Retreg1	Rat	Golgi apparatus	located_in	IEA	UniProtKB-KW:KW-0333	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Retreg1	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Retreg1	Rat	nuclear body	located_in	ISO	RGD:1601869\|UniProtKB:Q9H6L5-1\|UniProtKB:Q9H6L5-2	1624291		RGD	GO_REF:0000052
Retreg1	Rat	nucleolus	located_in	ISO	RGD:1601869\|UniProtKB:Q9H6L5-1\|UniProtKB:Q9H6L5-2	1624291		RGD	GO_REF:0000052
Retreg1	Rat	nucleus	located_in	IEA	UniProtKB-SubCell:SL-0191	1600115	GO_REF:0000044	UniProt	GO_REF:0000044

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Retreg1	Rat	endoplasmic reticulum-autophagosome adaptor activity	enables	ISO	RGD:1614369	1624291	PMID:34338405	RGD	PMID:34338405
Retreg1	Rat	metal ion binding	enables	IEA	UniProtKB-KW:KW-0479	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Retreg1	Rat	nucleic acid binding	enables	IEA	InterPro:IPR003604	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Retreg1	Rat	protein binding	enables	ISO	RGD:1601869,UniProtKB:Q9H6L5-1	1624291	UniProtKB:P60520\|UniProtKB:Q9H492-1 PMID:26040720, PMID:34524948	RGD	PMID:26040720\|PMID:34524948
Retreg1	Rat	protein binding	enables	ISO	RGD:1614369	1624291	PR:P35564\|PR:Q9DCD6 PMID:34338405	RGD	PMID:34338405
Retreg1	Rat	protein binding	enables	ISO	RGD:1601869\|UniProtKB:Q9H6L5-1	1624291	UniProtKB:P60520 PMID:26040720	RGD	PMID:26040720
Retreg1	Rat	protein binding	enables	ISO	RGD:1601869	1624291	UniProtKB:O95166\|UniProtKB:Q9GZQ8\|UniProtKB:Q9H0R8\|UniProtKB:Q9H492 PMID:26040720	RGD	PMID:26040720
Retreg1	Rat	protein binding	enables	ISO	RGD:1601869,UniProtKB:Q9H6L5-2	1624291	UniProtKB:O95817\|UniProtKB:P60520 PMID:32296183, PMID:32814053	RGD	PMID:32296183\|PMID:32814053
Retreg1	Rat	zinc ion binding	enables	IEA	InterPro:IPR003604	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Retreg1	Rat	zinc ion binding	enables	IEA	UniProtKB-KW:KW-0863	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Disease Annotations Click to see Annotation Detail View

Charcot-Marie-Tooth disease (ISO)

genetic disease (ISO)

hereditary sensory and autonomic neuropathy type 2 (ISO)

hereditary sensory and autonomic neuropathy type 2A (ISO)

hereditary sensory and autonomic neuropathy type 2B (ISO)

hereditary sensory neuropathy (ISO)

hereditary spastic paraplegia (ISO)

Neurodevelopmental Disorders (ISO)

Vesicoureteral Reflux 5 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

(2,4,5-trichlorophenoxy)acetic acid (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP,ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

3,3',4,4',5-pentachlorobiphenyl (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

actinomycin D (ISO)

aflatoxin B1 (ISO)

aldehydo-D-glucose (EXP)

aldrin (ISO)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

buspirone (EXP)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbamazepine (ISO)

carbon nanotube (ISO)

chloroethene (ISO)

chlorogenic acid (EXP)

cisplatin (ISO)

cobalt dichloride (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

D-glucose (EXP)

decabromodiphenyl ether (EXP)

dexamethasone (ISO)

diethyl phthalate (EXP)

diquat (ISO)

diuron (EXP)

dorsomorphin (ISO)

doxorubicin (ISO)

fenthion (ISO)

furan (EXP)

gentamycin (EXP)

glafenine (EXP)

glucose (EXP)

glutathione (EXP)

indometacin (ISO)

inulin (ISO)

iron dichloride (ISO)

isotretinoin (ISO)

lead diacetate (EXP)

lead(0) (ISO)

levofloxacin (EXP)

lipopolysaccharide (ISO)

menadione (ISO)

mercury dibromide (ISO)

methapyrilene (EXP)

methimazole (EXP)

methylmercury chloride (ISO)

N-nitrosodiethylamine (EXP)

nefazodone (EXP)

nevirapine (EXP)

nickel sulfate (ISO)

Nutlin-3 (ISO)

O-methyleugenol (ISO)

okadaic acid (ISO)

oxaliplatin (EXP)

paracetamol (ISO)

paraquat (EXP)

parathion (ISO)

perfluorohexanesulfonic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (EXP)

phenylmercury acetate (ISO)

pirinixic acid (ISO)

potassium chromate (ISO)

pregnenolone 16alpha-carbonitrile (ISO)

progesterone (ISO)

propanal (ISO)

propiconazole (ISO)

raloxifene (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

sodium dichromate (EXP)

tamoxifen (ISO)

temozolomide (ISO)

tetrachloroethene (ISO)

tetrachloromethane (EXP,ISO)

titanium dioxide (ISO)

topotecan (EXP)

trichostatin A (ISO)

triphenyl phosphate (ISO)

valproic acid (ISO)

vinclozolin (EXP)

vitamin E (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

autophagy (IEA,ISO)

collagen catabolic process (ISO)

endoplasmic reticulum organization (ISO)

mitophagy (ISO)

negative regulation of neuron apoptotic process (IBA,ISO,ISS)

reticulophagy (IBA,IEA,ISO,ISS)

ribosomal large subunit biogenesis (IEA)

ribosome biogenesis (IEA)

sensory perception of pain (ISO,ISS)

substrate localization to autophagosome (IEA)

white fat cell differentiation (ISO)

Cellular Component

cis-Golgi network (ISO,ISS)

cytoplasm (IEA)

endoplasmic reticulum (IEA,ISO)

endoplasmic reticulum membrane (IBA,IEA,ISO,ISS)

Golgi apparatus (IEA)

membrane (IEA)

nuclear body (ISO)

nucleolus (ISO)

nucleus (IEA)

Molecular Function

endoplasmic reticulum-autophagosome adaptor activity (ISO)

metal ion binding (IEA)

nucleic acid binding (IEA)

protein binding (ISO)

zinc ion binding (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
3.	GOA pipeline	RGD automated data pipeline
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:19838196	PMID:26040720	PMID:32086669	PMID:32716134	PMID:34212292	PMID:36056188

Genomics

Comparative Map Data

Retreg1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	78,045,435 - 78,205,316 (+)	NCBI		GRCr8
mRatBN7.2	2	76,335,609 - 76,474,817 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	76,335,609 - 76,493,898 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	83,455,839 - 83,595,059 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	81,577,567 - 81,716,777 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	76,582,768 - 76,722,071 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	78,391,921 - 78,401,569 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	78,103,387 - 78,276,927 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_6.0 Ensembl	2	78,391,921 - 78,399,987 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	97,821,407 - 97,972,821 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	77,470,558 - 77,566,123 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	2	72,093,456 - 72,182,485 (+)	NCBI		Celera
Cytogenetic Map	2	q22	NCBI

RETREG1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	16,473,053 - 16,616,997 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	16,473,038 - 16,617,101 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	5	16,473,162 - 16,617,106 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	16,526,147 - 16,670,118 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	5	16,496,766 - 16,640,783 (-)	NCBI		Celera
Cytogenetic Map	5	p15.1	NCBI
HuRef	5	16,445,059 - 16,589,261 (-)	NCBI		HuRef
CHM1_1	5	16,473,095 - 16,617,108 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	5	16,412,398 - 16,556,330 (-)	NCBI		T2T-CHM13v2.0

Retreg1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	15	25,840,795 - 25,973,782 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	15	25,843,266 - 25,973,773 (+)	Ensembl		GRCm39 Ensembl
GRCm38	15	25,843,298 - 25,973,696 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	15	25,843,180 - 25,973,687 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	15	25,773,019 - 25,903,442 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	15	25,787,989 - 25,918,412 (+)	NCBI		MGSCv36	mm8
Celera	15	26,616,789 - 26,745,263 (+)	NCBI		Celera
Cytogenetic Map	15	B1	NCBI
cM Map	15	9.59	NCBI

Retreg1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955426	5,574,216 - 5,688,236 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955426	5,574,207 - 5,688,236 (-)	NCBI	ChiLan1.0	ChiLan1.0

RETREG1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	4	16,704,829 - 16,851,099 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	5	14,858,454 - 15,004,650 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	16,774,596 - 16,920,948 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	16,612,583 - 16,756,808 (-)	NCBI	panpan1.1	PanPan1.1	panPan2

RETREG1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	4	86,817,391 - 86,921,119 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	4	86,323,200 - 86,438,561 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	4	87,442,470 - 87,564,197 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	4	87,442,238 - 87,587,920 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	4	86,965,905 - 87,080,546 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	4	87,202,448 - 87,317,283 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	4	88,059,445 - 88,174,500 (+)	NCBI		UU_Cfam_GSD_1.0

Retreg1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	210,176,692 - 210,316,851 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936480	19,114,768 - 19,253,352 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936480	19,114,753 - 19,253,346 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RETREG1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	16	5,726,494 - 5,879,714 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	16	5,726,493 - 5,879,461 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	16	6,170,402 - 6,324,535 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RETREG1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	4	16,153,003 - 16,297,252 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	4	16,154,694 - 16,297,161 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666064	12,181,901 - 12,326,336 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Retreg1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624751	13,376,502 - 13,501,918 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624751	13,377,583 - 13,502,144 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Retreg1
636 total Variants

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578777	Stresp15	Stress response QTL 15	2	0.05	blood aldosterone amount (VT:0005346)	plasma aldosterone level (CMO:0000551)	2	59846005	104846005	Rat
2293671	Bss44	Bone structure and strength QTL 44	10.97	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	2	43162366	148478373	Rat
631500	Bp99	Blood pressure QTL 99	2.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	59324719	102755241	Rat
10755436	Coatc8	Coat color QTL 8		0.02431	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	2	35023117	80023117	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118463	226797303	Rat
2293676	Bmd19	Bone mineral density QTL 19	10.7	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	2	43162366	111362592	Rat
10755499	Bp389	Blood pressure QTL 389	2.61		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	18960362	228801039	Rat
2293682	Bmd24	Bone mineral density QTL 24	8.9	0.0001	femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	2	43162366	111362592	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
5684996	Bmd85	Bone mineral density QTL 85	4.7	0.024	tibia mineral mass (VT:1000283)	bone mineral density (CMO:0001226)	2	59324377	103795077	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
152025242	Bw191	Body weight QTL 191	3.62		body mass (VT:0001259)		2	38573329	122609194	Rat
1302794	Stl27	Serum triglyceride level QTL 27	4.4	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	2	25413423	143657569	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	43154682	202446871	Rat
70174	BpQTLCluster2	Blood pressure QTL cluster 2	4.24		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	2	40067944	102785628	Rat
1358901	Cm38	Cardiac mass QTL 38	2		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	157142209	Rat
631208	Bw1	Body weight QTL1	5.09		mesenteric fat pad mass (VT:0010427)	mesenteric fat pad weight to body weight ratio (CMO:0000654)	2	43171017	83575226	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	56043031	202447032	Rat
1358899	Kidm23	Kidney mass QTL 23	3.88		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358908	Bw49	Body weight QTL 49	3.36		body mass (VT:0001259)	body weight (CMO:0000012)	2	25413652	157142078	Rat
2293835	Kiddil5	Kidney dilation QTL 5	3.8		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	42804607	157142209	Rat
5684990	Bmd82	Bone mineral density QTL 82	2.8		tibia mineral mass (VT:1000283)	bone mineral content (CMO:0001554)	2	59324377	103795077	Rat
1358910	Kidm27	Kidney mass QTL 27	5.77		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1558653	Prcr1	Prostate cancer resistance QTL 1	5		prostate integrity trait (VT:0010571)	area of ventral prostate occupied by tumorous lesions to total ventral prostate area ratio (CMO:0000899)	2	72532993	157142209	Rat
61355	Bp36	Blood pressure QTL 36	2.9		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	2	5873687	102844969	Rat
1358911	Kidm28	Kidney mass QTL 28	5.42		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	46123260	202447032	Rat
1358904	Cm39	Cardiac mass QTL 39	2.26		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	157142209	Rat
1354617	Bp240	Blood pressure QTL 240	4		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	26917817	81754745	Rat
7411551	Bw131	Body weight QTL 131	29.6	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	2	67942638	112942638	Rat
1359034	Bp274	Blood pressure QTL 274			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	74786664	94359546	Rat
1558648	Smcn1	Smooth muscle cell number QTL 1		0.039	blood vessel smooth muscle cell quantity (VT:0010525)	aorta smooth muscle cell count per unit vessel length (CMO:0001646)	2	59134147	127460910	Rat
2293843	Kiddil6	Kidney dilation QTL 6	3.1		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	42804607	182042367	Rat
1358887	Bw50	Body weight QTL 50	2.39		body mass (VT:0001259)	body weight (CMO:0000012)	2	25413652	157142078	Rat
1298080	Bp163	Blood pressure QTL 163		0.02	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118275	202447032	Rat
2306903	Bp336	Blood pressure QTL 336		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	64366971	109366971	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
2290453	Scl55	Serum cholesterol level QTL 55	2.83		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	2	26917817	136917119	Rat
152025206	Hrtrt23	Heart rate QTL 23	5.98		heart pumping trait (VT:2000009)		2	28484589	169504100	Rat
1354605	Rf48	Renal function QTL 48	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	2	74786664	206665859	Rat
1358894	Kidm24	Kidney mass QTL 24	4.03		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
152025204	Hrtrt22	Heart rate QTL 22	5.6		heart pumping trait (VT:2000009)		2	28484589	169504100	Rat
61371	Edpm1	Estrogen-dependent pituitary mass QTL 1	4	0.05	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	35134841	88029593	Rat
1354601	Slep1	Serum leptin concentration QTL 1	5.39		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	2	43171017	184114403	Rat
1582246	Cm60	Cardiac mass QTL 60	5.8		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	57605612	76539510	Rat
61438	Cia7	Collagen induced arthritis QTL 7	4.6	0.0001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	2	59324377	141596857	Rat
1354603	Bp243	Blood pressure QTL 243	3.9		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	26917817	127469484	Rat

Markers in Region

RH132335

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	76,336,677 - 76,336,866 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	78,104,525 - 78,104,713	NCBI	Rnor6.0
Rnor_5.0	2	97,822,444 - 97,822,632	UniSTS	Rnor5.0
RGSC_v3.4	2	77,420,241 - 77,420,429	UniSTS	RGSC3.4
Celera	2	72,045,887 - 72,046,075	UniSTS
RH 3.4 Map	2	498.9	UniSTS
Cytogenetic Map	2	q22	UniSTS

RH143838

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	76,473,375 - 76,473,490 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	78,400,141 - 78,400,255	NCBI	Rnor6.0
Rnor_6.0	2	78,255,668 - 78,255,782	NCBI	Rnor6.0
Rnor_5.0	2	97,971,380 - 97,971,494	UniSTS	Rnor5.0
RGSC_v3.4	2	77,564,695 - 77,564,809	UniSTS	RGSC3.4
Celera	2	72,181,057 - 72,181,171	UniSTS
RH 3.4 Map	2	503.0	UniSTS
Cytogenetic Map	2	q22	UniSTS

BE120148

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	16	45,153,049 - 45,153,261 (+)	MAPPER	mRatBN7.2
Rnor_6.0	16	48,299,786 - 48,299,997	NCBI	Rnor6.0
Rnor_5.0	16	48,011,849 - 48,012,060	UniSTS	Rnor5.0
RGSC_v3.4	16	48,376,260 - 48,376,471	UniSTS	RGSC3.4
RGSC_v3.4	2	77,468,539 - 77,468,750	UniSTS	RGSC3.4
Celera	16	43,159,457 - 43,159,668	UniSTS
RH 3.4 Map	16	451.5	UniSTS
Cytogenetic Map	2	q22	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
12	12	59	59	51	27	12	27	12	102	48	35	15	36	24

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001034912	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006232084	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039103026	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039103027	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282446	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC113901	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY310142	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY321329	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC089887	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473992	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ231825	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000063951 ⟹ ENSRNOP00000062258

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	76,335,609 - 76,474,796 (+)	Ensembl
Rnor_6.0 Ensembl	2	78,103,387 - 78,257,134 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000066879 ⟹ ENSRNOP00000060898

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	2	78,262,839 - 78,276,927 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000079455 ⟹ ENSRNOP00000069183

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	76,441,501 - 76,474,802 (+)	Ensembl
Rnor_6.0 Ensembl	2	78,391,921 - 78,399,987 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000084541 ⟹ ENSRNOP00000075424

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	76,463,167 - 76,493,898 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000089551 ⟹ ENSRNOP00000073087

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	76,468,405 - 76,488,847 (+)	Ensembl
Rnor_6.0 Ensembl	2	78,245,459 - 78,271,382 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000089805 ⟹ ENSRNOP00000075409

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	76,443,711 - 76,474,802 (+)	Ensembl
Rnor_6.0 Ensembl	2	78,247,448 - 78,255,514 (+)	Ensembl

RefSeq Acc Id:

NM_001034912 ⟹ NP_001030084

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	78,066,124 - 78,205,303 (+)	NCBI
mRatBN7.2	2	76,335,609 - 76,474,804 (+)	NCBI
Rnor_6.0	2	78,391,921 - 78,401,569 (+)	NCBI
Rnor_5.0	2	97,821,407 - 97,972,821 (+)	NCBI
RGSC_v3.4	2	77,470,558 - 77,566,123 (+)	RGD
Celera	2	72,093,456 - 72,182,485 (+)	RGD

Sequence:

show sequence

CGCCAGGCGCGCGCGCGCGCGTGCCCGCCCGCCTCCCTCCCTGTCCCCGTCCCCATCCCCGTCC
CCGCCAGCAAAACACCGCTGAAGATGGCGAGCCCGGCGCCGGAGGAGCACGCCACGCAGGGATG
CCCAGCTACGGAGGAGCAGGAACCGCGACCCGGGGTTCCCGGGGAGGAGGCAGGGCCGGAGGGC
GCCGGGCCGCAGGTGGAGGAGGCCGCGGGCAGAGTGGCCGCCGCCCTGACCTGGCTACTCGGGG
AGCCCGTGCTGTGGCTGGGCTGGCGCGCCGACGAGCTCCTGAGCTGGAAGAGGCCGCTGCGCAG
CCTGCTCGCCTTCCTGGGTGCCAACCTGCTGTTCTGGTTCCTTGCCTTGACTCCGTGGAGAGTG
TATCATCTCATTTCTGTCATGATACTTGGTCGTGTTATCATGCAAATCATCAAGGACATGGTTT
TGTCCAGGGCAAGAGGTGCACAGTTGTGGAGGAGCCTCAGTGAAAGCTGGGAAGTTATCAATTC
CAAGCCAGATGAAAGACCCAGACTGAGCCACTGCATTGCAGAATCATGGATGAATTTCAGCATA
TTTCTTCAAGAAATGTCTCTTTTCAAACAGCAGAGCCCTGGCAAGTTTTGCCTCCTGGTCTGCA
GTGTGTGCACATTTTTTACAATCTTGGGAAGTTACATTCCTGGGGTCATTCTCAGCTACCTACT
GTTACTGTTTGCTTTTTTGTGTCCACTGTTTAAATGTAATGATATTGGACAAAAAATATACAGC
AAAGTCAAGTCCATTCTATTAAAACTAGATTTTGGAATTGGAGAATATATTAACCAGAAGAAAC
GTGAGAGATCTGAAGCAGATAAAGAAAAAAGCCACAAGGATGACAGTGAAATAGACTTTTCGGC
TCTTTGTCCTAAGATTAGCCTCACAGTTGCTGCCAAAGAGTTATCCGTGTCAGACACAGATGTG
TCAGAAGTCTCTTGGACTGATAATGGGACCTTCAACCTTTCAGAGGGGTACACTCCACAGACAG
ACACTTCTGATGATCTTGACCGGCCCAGTGAGGAAGTGTTCTCTCGAGATCTTTCAGATTTTCC
ATCTCTGGAAAATGGCGCGGGAACAAATGATGAAGATGAGTTAAGCCTTGGCTTACCCACAGAG
CTCAAGACAAAGAAGCAACAGTTGAACAGTGCTCACAGACCAAGCAAAGACAGGCAGTCAGCAG
CTGGCCTCTCACTTCCTCTCAAGAGCGACCAAGCCCTTCACTTGATGAGCAACCTGGCTGGGGA
TGTCATCACAGCTGCCATGACAGCTGCCATCAAAGACCAGCTAGAAGGGGCCCGGCAGGCCCTC
GCTCAGGCGGCGCCCACTCCAGGGGACGACACAGACACTGAGGAGGGGGATGATTTTGAACTAC
TTGACCAGGCAGAGCTAGATCAAATTGAGAGTGAGCTGGGACTAACACAAGACCAAGGGGCAGA
AGCCCAGCAAAGTAAGAAGTCCTCAGGCTTCCTTTCAAACCTGCTTGGAGGCCATTAGCCGGGA
ATCAGCTTGCCGCAAAGCACAGATAAACCACCCAAACATTTCAAACAAGCAGGGGGAAAAATGG
AAAAAAAATTGAATTGTAAGCTTTAATTACTTTAGATTTTTTGTTTTCTTTTCCCTTCTATAGT
GAGTTGGATATGTATCAGCTGATAATGATAGACTGACATTTCTGGTAGTTATTTTTATGTAATA
AGCATGGAAATGAACTTTATAGTTACATATATACATACTGTGGTGTCATAAGTGCTTAGGGGCT
GTTTGTAAAGAGAAACAAAAAAACCACATCAAACCCCATCAAACTGAGGTCTTTCTATAAGTAA
TCTTTTTCTTTATAATTTTCAAGCATGCAGAGATCGACAGCTGTGAACACACATGGCATCGGCC
CCCTAATTACTCCTCTTGGAAGTGGTTTATCAAATTCTGATAGATTTCAATGTAAAAAAGGAGA
AATATCAAAATGTTTGTAGTTGAAGGGCTATGGAAATGCTATCAAAATTAATTTTCTAGGAAAA
ACTTTAAAAATAAGTACTATCTATAGGCTGAAATATTTCCATGTTATTTCTACAGTTGTAGACA
GAGGCTTACTTGTCAGGTGGCATGCTCCACTGACTGCCACATCTAGTCTTGAAAAGAGGTGGTA
CTGACCCACAGAAAGCAGCCAGTTCTGTGTCTCTTCATGATGCTCTTGTAATGTTTGCAATGGT
AAGTGCACACTATTTTGCACACTCAGATGTAAGCAAAACCTGACGTTTCTGTAATGTGTTCCAG
TCTCCTAGGATTGTGAATCTAGTTATAGGTATGTCCATGAGTGATGTGCTCATTGGTGATCATC
AACACCCCCCCTTTTTTTTTCAGTTTACAAATGCAGAACAGAGGAACTTGCTTGAACTTTAAAG
TTTATTTCTCTGCCGCTGCACTCTCAATATGCAATCCGTTTCTTACTGGGAAGCTAGTGTATGC
TTTTTCCTTTAAACTGTTTTTTTTTGATCACTTTTACATAATCAAATTTGACTTACAGTGGAAA
CCAAGATAGTTGTTTTTGTGAAACAATCTTTTAGAAGGACTGAGGGACCATGTCAGCAAATATC
TTAGATCTTCAGTTATAGCTGGCATTTCTACACAGACACACAAGATCCTTACAAAGGAAGGGTA
ATCTAAGACTGTAGAAGTCTGTGTTTCAGTTTCATCTCTTTTATTTCTAAAGACTAATTACAGG
TAACTTGACCTTTTAATGCACCATCTCCTATTTATTTATTTTTTTCTCTCTGAGGTATTAAAAA
TATCAAGACTGAATTTTGCCAAATGTAAGAGGGAGGAAAGTCCCTGAAGACTCTGACTACTTGC
TTATTTTTGATTGACCTTCTATGCTTATGTCATTAGTGCCTCACAACTGTGTTTGACGTCCTTT
ATTGATACAGAGTGAGCCTGTGCCTTCATTTTCTTGCCCATTTTGGTACTGATGTAAATTTGTG
TTAGAAAATCTTGGAACTCTGTGAGTCTGGGAAGAATATATCTGAATCCTATTCAATACATTTG
CTGGATGTGAAGAAAAATACAGCCACATATTTATAAAACAAAAAAAAAAAAAAAAAAAAAAAAA
AAAA

hide sequence

RefSeq Acc Id:

XM_006232084 ⟹ XP_006232146

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	78,172,519 - 78,205,316 (+)	NCBI
mRatBN7.2	2	76,441,262 - 76,474,817 (+)	NCBI

Sequence:

show sequence

TGTGACTCAAAGGAGATTGGATAGCTGGAGTGAGGTTTCAACCTGCCTGTGGCTACTCCACCTT
TTGGTAGGCGCCTAGATCTTGCCAGGAAAAAAAAAAAAAAGGAAAGAGGGCAGCAGGCGGCTGG
GTGAAGTCATCCCTGGTGACACCTTCTCACAGGACTTCAGGGAAAATGCTGGGCGACTGGGCAG
TGCCTCTGCCCAGCTGCCTGTCACGGTGCTGGGAGTGAGAGGTGACCTCTTTATTTTTAGCAGG
GGGCTGTCAGGAGAGTTCACTCCTCTGCTTCATCCAAGACAGGAGGCAGTCACTTTGGAAGTTT
GTAAACACCGACTTTCTCAGTAGAGGTGGGACACTTTTCTCCAGAAAGGGAAGAATTTCCCTGC
CGGGGTTTCCCTCTTCTTAGAGTCGCACTGTGGACAAGACAGCGATCTTTGGCTGTCTGAGTTG
TGGCAAGCAGGCGCCGCTCAAGTTCTAATTATTACAGGGCAGTCATGCCTGCCGGCGACGGCTG
TGGACCAGGCAGAAGCTGGGAAGTTATCAATTCCAAGCCAGATGAAAGACCCAGACTGAGCCAC
TGCATTGCAGAATCATGGATGAATTTCAGCATATTTCTTCAAGAAATGTCTCTTTTCAAACAGC
AGAGCCCTGGCAAGTTTTGCCTCCTGGTCTGCAGTGTGTGCACATTTTTTACAATCTTGGGAAG
TTACATTCCTGGGGTCATTCTCAGCTACCTACTGTTACTGTTTGCTTTTTTGTGTCCACTGTTT
AAATGTAATGATATTGGACAAAAAATATACAGCAAAGTCAAGTCCATTCTATTAAAACTAGATT
TTGGAATTGGAGAATATATTAACCAGAAGAAACGTGAGAGATCTGAAGCAGATAAAGAAAAAAG
CCACAAGGATGACAGTGAAATAGACTTTTCGGCTCTTTGTCCTAAGATTAGCCTCACAGTTGCT
GCCAAAGAGTTATCCGTGTCAGACACAGATGTGTCAGAAGTCTCTTGGACTGATAATGGGACCT
TCAACCTTTCAGAGGGGTACACTCCACAGACAGACACTTCTGATGATCTTGACCGGCCCAGTGA
GGAAGTGTTCTCTCGAGATCTTTCAGATTTTCCATCTCTGGAAAATGGCGCGGGAACAAATGAT
GAAGATGAGTTAAGCCTTGGCTTACCCACAGAGCTCAAGACAAAGAAGCAACAGTTGAACAGTG
CTCACAGACCAAGCAAAGACAGGCAGTCAGCAGCTGGCCTCTCACTTCCTCTCAAGAGCGACCA
AGCCCTTCACTTGATGAGCAACCTGGCTGGGGATGTCATCACAGCTGCCATGACAGCTGCCATC
AAAGACCAGCTAGAAGGGGCCCGGCAGGCCCTCGCTCAGGCGGCGCCCACTCCAGGGGACGACA
CAGACACTGAGGAGGGGGATGATTTTGAACTACTTGACCAGGCAGAGCTAGATCAAATTGAGAG
TGAGCTGGGACTAACACAAGACCAAGGGGCAGAAGCCCAGCAAAGTAAGAAGTCCTCAGGCTTC
CTTTCAAACCTGCTTGGAGGCCATTAGCCGGGAATCAGCTTGCCGCAAAGCACAGATAAACCAC
CCAAACATTTCAAACAAGCAGGGGGAAAAATGGAAAAAAAATTGAATTGTAAGCTTTAATTACT
TTAGATTTTTTGTTTTCTTTTCCCTTCTATAGTGAGTTGGATATGTATCAGCTGATAATGATAG
ACTGACATTTCTGGTAGTTATTTTTATGTAATAAGCATGGAAATGAACTTTATAGTTACATATA
TACATACTGTGGTGTCATAAGTGCTTAGGGGCTGTTTGTAAAGAGAAACAAAAAAACCACATCA
AACCCCATCAAACTGAGGTCTTTCTATAAGTAATCTTTTTCTTTATAATTTTCAAGCATGCAGA
GATCGACAGCTGTGAACACACATGGCATCGGCCCCCTAATTACTCCTCTTGGAAGTGGTTTATC
AAATTCTGATAGATTTCAATGTAAAAAAGGAGAAATATCAAAATGTTTGTAGTTGAAGGGCTAT
GGAAATGCTATCAAAATTAATTTTCTAGGAAAAACTTTAAAAATAAGTACTATCTATAGGCTGA
AATATTTCCATGTTATTTCTACAGTTGTAGACAGAGGCTTACTTGTCAGGTGGCATGCTCCACT
GACTGCCACATCTAGTCTTGAAAAGAGGTGGTACTGACCCACAGAAAGCAGCCAGTTCTGTGTC
TCTTCATGATGCTCTTGTAATGTTTGCAATGGTAAGTGCACACTATTTTGCACACTCAGATGTA
AGCAAAACCTGACGTTTCTGTAATGTGTTCCAGTCTCCTAGGATTGTGAATCTAGTTATAGGTA
TGTCCATGAGTGATGTGCTCATTGGTGATCATCAACACCCCCCCTTTTTTTTTCAGTTTACAAA
TGCAGAACAGAGGAACTTGCTTGAACTTTAAAGTTTATTTCTCTGCCGCTGCACTCTCAATATG
CAATCCGTTTCTTACTGGGAAGCTAGTGTATGCTTTTTCCTTTAAACTGTTTTTTTTTGATCAC
TTTTACATAATCAAATTTGACTTACAGTGGAAACCAAGATAGTTGTTTTTGTGAAACAATCTTT
TAGAAGGACTGAGGGACCATGTCAGCAAATATCTTAGATCTTCAGTTATAGCTGGCATTTCTAC
ACAGACACACAAGATCCTTACAAAGGAAGGGTAATCTAAGACTGTAGAAGTCTGTGTTTCAGTT
TCATCTCTTTTATTTCTAAAGACTAATTACAGGTAACTTGACCTTTTAATGCACCATCTCCTAT
TTATTTATTTTTTTCTCTCTGAGGTATTAAAAATATCAAGACTGAATTTTGCCAAATGTAAGAG
GGAGGAAAGTCCCTGAAGACTCTGACTACTTGCTTATTTTTGATTGACCTTCTATGCTTATGTC
ATTAGTGCCTCACAACTGTGTTTGACGTCCTTTATTGATACAGAGTGAGCCTGTGCCTTCATTT
TCTTGCCCATTTTGGTACTGATGTAAATTTGTGTTAGAAAATCTTGGAACTCTGTGAGTCTGGG
AAGAATATATCTGAATCCTATTCAATACATTTGCTGGATGTGAAGAAAAATACAGCCACATATT
TATAAAACAGTTGTTACCAGTA

hide sequence

RefSeq Acc Id:

XM_039103026 ⟹ XP_038958954

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	78,130,450 - 78,205,316 (+)	NCBI
mRatBN7.2	2	76,400,342 - 76,474,817 (+)	NCBI

RefSeq Acc Id:

XM_039103027 ⟹ XP_038958955

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	78,131,082 - 78,205,316 (+)	NCBI
mRatBN7.2	2	76,400,583 - 76,474,817 (+)	NCBI

RefSeq Acc Id:

XM_063282446 ⟹ XP_063138516

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	78,045,435 - 78,205,316 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001030084	(Get FASTA)	NCBI Sequence Viewer
	XP_006232146	(Get FASTA)	NCBI Sequence Viewer
	XP_038958954	(Get FASTA)	NCBI Sequence Viewer
	XP_038958955	(Get FASTA)	NCBI Sequence Viewer
	XP_063138516	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH89887	(Get FASTA)	NCBI Sequence Viewer
	AAP78750	(Get FASTA)	NCBI Sequence Viewer
	AAP86261	(Get FASTA)	NCBI Sequence Viewer
	EDL82614	(Get FASTA)	NCBI Sequence Viewer
	EDL82615	(Get FASTA)	NCBI Sequence Viewer
	EDL82616	(Get FASTA)	NCBI Sequence Viewer
	EDL82617	(Get FASTA)	NCBI Sequence Viewer
	EDL82618	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000062258.2
	ENSRNOP00000098260
	ENSRNOP00000100789
	ENSRNOP00000112169
GenBank Protein	Q5FVM3	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001030084 ⟸ NM_001034912

- UniProtKB:

Q5FVM3 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MASPAPEEHATQGCPATEEQEPRPGVPGEEAGPEGAGPQVEEAAGRVAAALTWLLGEPVLWLGW
RADELLSWKRPLRSLLAFLGANLLFWFLALTPWRVYHLISVMILGRVIMQIIKDMVLSRARGAQ
LWRSLSESWEVINSKPDERPRLSHCIAESWMNFSIFLQEMSLFKQQSPGKFCLLVCSVCTFFTI
LGSYIPGVILSYLLLLFAFLCPLFKCNDIGQKIYSKVKSILLKLDFGIGEYINQKKRERSEADK
EKSHKDDSEIDFSALCPKISLTVAAKELSVSDTDVSEVSWTDNGTFNLSEGYTPQTDTSDDLDR
PSEEVFSRDLSDFPSLENGAGTNDEDELSLGLPTELKTKKQQLNSAHRPSKDRQSAAGLSLPLK
SDQALHLMSNLAGDVITAAMTAAIKDQLEGARQALAQAAPTPGDDTDTEEGDDFELLDQAELDQ
IESELGLTQDQGAEAQQSKKSSGFLSNLLGGH

hide sequence

Ensembl Acc Id:

ENSRNOP00000069183 ⟸ ENSRNOT00000079455

RefSeq Acc Id:	XP_038958954 ⟸ XM_039103026
- Peptide Label:	isoform X3
- UniProtKB:	A0A0G2KAI5 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038958955 ⟸ XM_039103027
- Peptide Label:	isoform X4
- UniProtKB:	A6JMW7 (UniProtKB/TrEMBL), A0A0G2KAI5 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_006232146 ⟸ XM_006232084
- Peptide Label:	isoform X2
- UniProtKB:	A0A0G2JUQ3 (UniProtKB/TrEMBL), A0A0G2KAI5 (UniProtKB/TrEMBL)
- Sequence:	show sequence MPAGDGCGPGRSWEVINSKPDERPRLSHCIAESWMNFSIFLQEMSLFKQQSPGKFCLLVCSVCT FFTILGSYIPGVILSYLLLLFAFLCPLFKCNDIGQKIYSKVKSILLKLDFGIGEYINQKKRERS EADKEKSHKDDSEIDFSALCPKISLTVAAKELSVSDTDVSEVSWTDNGTFNLSEGYTPQTDTSD DLDRPSEEVFSRDLSDFPSLENGAGTNDEDELSLGLPTELKTKKQQLNSAHRPSKDRQSAAGLS LPLKSDQALHLMSNLAGDVITAAMTAAIKDQLEGARQALAQAAPTPGDDTDTEEGDDFELLDQA ELDQIESELGLTQDQGAEAQQSKKSSGFLSNLLGGH hide sequence

Ensembl Acc Id:

ENSRNOP00000062258 ⟸ ENSRNOT00000063951

Ensembl Acc Id:

ENSRNOP00000075409 ⟸ ENSRNOT00000089805

Ensembl Acc Id:

ENSRNOP00000073087 ⟸ ENSRNOT00000089551

Ensembl Acc Id:

ENSRNOP00000060898 ⟸ ENSRNOT00000066879

Ensembl Acc Id:

ENSRNOP00000075424 ⟸ ENSRNOT00000084541

RefSeq Acc Id:	XP_063138516 ⟸ XM_063282446
- Peptide Label:	isoform X1

Protein Domains

C2H2-type

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5FVM3-F1-model_v2	AlphaFold	Q5FVM3	1-480	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1565003	AgrOrtholog
BioCyc Gene	G2FUF-53940	BioCyc
Ensembl Genes	ENSRNOG00000010589	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOG00000057522	Ensembl
Ensembl Transcript	ENSRNOT00000063951.4	UniProtKB/Swiss-Prot
	ENSRNOT00000120625	ENTREZGENE
	ENSRNOT00000139704	ENTREZGENE
	ENSRNOT00000164321	ENTREZGENE
IMAGE_CLONE	IMAGE:7371502	IMAGE-MGC_LOAD
InterPro	RETR1_RHD	UniProtKB/Swiss-Prot
	RETREG1/3	UniProtKB/Swiss-Prot
KEGG Report	rno:619558	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:109057	IMAGE-MGC_LOAD
NCBI Gene	619558	ENTREZGENE
PANTHER	PTHR28659	UniProtKB/Swiss-Prot
	PTHR28659:SF3	UniProtKB/Swiss-Prot
PhenoGen	Retreg1	PhenoGen
RatGTEx	ENSRNOG00000010589	RatGTEx
	ENSRNOG00000057522	RatGTEx
UniProt	A0A0G2JUQ3	ENTREZGENE, UniProtKB/TrEMBL
	A0A0G2K4L3_RAT	UniProtKB/TrEMBL
	A0A0G2KAI5	ENTREZGENE, UniProtKB/TrEMBL
	A6JMW7	ENTREZGENE, UniProtKB/TrEMBL
	Q5FVM3	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-03-09	Retreg1	reticulophagy regulator 1	LOC103689968	protein FAM134B	Data merged from RGD:9390936	737654	PROVISIONAL
2017-03-27	Retreg1	reticulophagy regulator 1	Fam134b	family with sequence similarity 134, member B	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2014-08-25	LOC103689968	protein FAM134B			Symbol and Name status set to provisional	70820	PROVISIONAL
2008-03-05	Fam134b	family with sequence similarity 134, member B	LOC619558	hypothetical protein LOC619558	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-02-09	LOC619558	hypothetical protein LOC619558			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIA

Imported Disease Annotations - OMIM