Asb16 (ankyrin repeat and SOCS box-containing 16)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Asb16 (ankyrin repeat and SOCS box-containing 16) Rattus norvegicus

Analyze

Symbol:

Asb16

Name:

ankyrin repeat and SOCS box-containing 16

RGD ID:

1563878

Description:

Predicted to be involved in intracellular signal transduction and protein ubiquitination. Orthologous to human ASB16 (ankyrin repeat and SOCS box containing 16); INTERACTS WITH 3,3',4,4',5-pentachlorobiphenyl; 4,4'-sulfonyldiphenol; acrylamide.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

ankyrin repeat and SOCS box protein 16; LOC498005; RGD1563878; similar to ankyrin repeat domain-containing SOCS box protein Asb-16

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	10	87,225,976 - 87,233,078 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	87,225,912 - 87,233,078 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	92,255,568 - 92,262,797 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	10	91,727,554 - 91,734,668 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	10	87,120,873 - 87,127,987 (+)	NCBI	Rnor_WKY
Rnor_6.0	10	90,217,979 - 90,224,984 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	90,217,924 - 90,226,537 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	90,004,557 - 90,011,501 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	91,351,087 - 91,359,176 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	10	85,941,754 - 85,948,522 (+)	NCBI		Celera
Cytogenetic Map	10	q32.1	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

3,3',4,4',5-pentachlorobiphenyl (EXP)

4,4'-sulfonyldiphenol (EXP)

acrylamide (EXP)

atrazine (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (EXP)

cadmium dichloride (EXP)

cisplatin (ISO)

copper(II) sulfate (ISO)

fulvestrant (ISO)

furan (EXP)

PCB138 (ISO)

quercetin (EXP)

sodium arsenite (ISO)

sunitinib (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

triptonide (ISO)

valproic acid (ISO)

XL147 (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

intracellular signal transduction (IEA)

protein ubiquitination (IEA)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Genomics

Comparative Map Data

Asb16
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	10	87,225,976 - 87,233,078 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	87,225,912 - 87,233,078 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	92,255,568 - 92,262,797 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	10	91,727,554 - 91,734,668 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	10	87,120,873 - 87,127,987 (+)	NCBI	Rnor_WKY
Rnor_6.0	10	90,217,979 - 90,224,984 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	90,217,924 - 90,226,537 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	90,004,557 - 90,011,501 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	91,351,087 - 91,359,176 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	10	85,941,754 - 85,948,522 (+)	NCBI		Celera
Cytogenetic Map	10	q32.1	NCBI

ASB16
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	44,170,704 - 44,179,084 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	17	44,170,447 - 44,179,084 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	17	42,248,072 - 42,256,452 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	39,603,600 - 39,611,977 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	17	39,603,599 - 39,611,977	NCBI
Celera	17	38,956,789 - 38,965,185 (+)	NCBI		Celera
Cytogenetic Map	17	q21.31	NCBI
HuRef	17	38,012,104 - 38,020,552 (+)	NCBI		HuRef
CHM1_1	17	42,483,490 - 42,491,861 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	17	45,023,804 - 45,032,183 (+)	NCBI		T2T-CHM13v2.0

Asb16
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	102,159,577 - 102,170,280 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	102,159,569 - 102,170,288 (+)	Ensembl		GRCm39 Ensembl
GRCm38	11	102,268,751 - 102,279,454 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	102,268,743 - 102,279,462 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	102,130,137 - 102,139,375 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	102,084,913 - 102,094,151 (+)	NCBI		MGSCv36	mm8
Celera	11	113,975,680 - 113,984,928 (+)	NCBI		Celera
Cytogenetic Map	11	D	NCBI

Asb16
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955451	17,265,904 - 17,273,289 (+)	NCBI	ChiLan1.0	ChiLan1.0

ASB16
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	17	13,380,166 - 13,388,638 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	17	13,380,166 - 13,388,638 (-)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	17	13,216,586 - 13,226,101 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

ASB16
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	19,217,508 - 19,229,451 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	9	19,217,721 - 19,226,242 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	18,608,825 - 18,617,401 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	19,913,771 - 19,922,351 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	19,913,050 - 19,921,984 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	18,767,286 - 18,775,726 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	18,949,706 - 18,958,789 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	19,095,163 - 19,103,740 (-)	NCBI		UU_Cfam_GSD_1.0

Asb16
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	18,548,419 - 18,556,201 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936541	638,319 - 646,167 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936541	638,266 - 646,463 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ASB16
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	12	19,033,482 - 19,040,221 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	12	19,033,471 - 19,040,481 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	12	19,321,709 - 19,324,766 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ASB16
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	62,203,904 - 62,222,561 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	16	62,210,463 - 62,221,650 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666077	32,979,608 - 32,991,907 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants

Variants in Asb16
35 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	77
Count of miRNA genes:	66
Interacting mature miRNAs:	74
Transcripts:	ENSRNOT00000028388
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6357896	96121100	Rat
2303118	Mamtr7	Mammary tumor resistance QTL 7		0.003	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	9658275	104670812	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14487011	89062041	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14487011	104060283	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14487011	107057807	Rat
1554317	Bmd4	Bone mineral density QTL 4	9.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	19816042	99406971	Rat
724556	Pur2	Proteinuria QTL 2	5.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	22427500	90627625	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
1298069	Bp168	Blood pressure QTL 168	5.5		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	10	26521957	98003205	Rat
631542	Bp82	Blood pressure QTL 82	6.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	26521957	98952741	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29299504	107211142	Rat
1576308	Schws1	Schwannoma susceptibility QTL 1		0.0041	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	40035094	102359817	Rat
631269	Cia22	Collagen induced arthritis QTL 22	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
631270	Cia23	Collagen induced arthritis QTL 23	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
1298078	Stresp5	Stress response QTL 5	2.99	0.00025	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	42045676	104670812	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	42323132	87323132	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	42323132	87323132	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	42323132	87323132	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	42323132	87323132	Rat
70198	BpQTLcluster9	Blood pressure QTL cluster 9	2.94		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	42323132	87323132	Rat
9589030	Epfw9	Epididymal fat weight QTL 9	19.24	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	10	44441699	89441699	Rat
7411614	Foco18	Food consumption QTL 18		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	10	44441699	89441699	Rat
8694173	Bw149	Body weight QTL 149	4.38	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	10	44441699	89441699	Rat
2300218	Hpcl2	Hepatic cholesterol level QTL 2			liver cholesterol amount (VT:0010498)	liver cholesterol level (CMO:0001597)	10	45029650	95600334	Rat
631547	Bp87	Blood pressure QTL 87	4.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	47369470	92369470	Rat
1549846	Scl47	Serum cholesterol level QTL 47	3.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	10	50574707	95574707	Rat
70364	Bp72	Blood pressure QTL 72			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	51121100	96121100	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	51770177	107211142	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	51770177	107211142	Rat
1359017	Hrtrt21	Heart rate QTL 21	2.4		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	10	51772940	96772940	Rat
631530	Tls3	T-lymphoma susceptibility QTL 3	0	0.0001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	10	51774612	95600334	Rat
631535	Cm51	Cardiac mass QTL 51	3		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	10	51786282	91669536	Rat
70171	Cari1	Carrageenan-induced inflammation QTL 1	4.9	0.0005	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	10	53797385	107211142	Rat
70164	Bw21	Body weight QTL 21	4.36	0.00005	body mass (VT:0001259)	body weight (CMO:0000012)	10	53797494	98952626	Rat
1354608	Cm33	Cardiac mass QTL 33	2.8		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	10	54809292	99809292	Rat
2312662	Slep8	Serum leptin concentration QTL 8		0.05	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	10	57134272	102134272	Rat
2312668	Scl65	Serum cholesterol level QTL 65		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	10	57134272	102134272	Rat
2312672	Insul15	Insulin level QTL 15		0.01	blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	10	57134272	102134272	Rat
1549831	Bss6	Bone structure and strength QTL 6	4		lumbar vertebra strength trait (VT:0010574)	vertebra ultimate force (CMO:0001678)	10	57576521	102576521	Rat
2293698	Bss43	Bone structure and strength QTL 43	5.33	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra cross-sectional area (CMO:0001689)	10	59209888	104209888	Rat
2306970	Anxrr22	Anxiety related response QTL 22	5.95		fear/anxiety-related behavior trait (VT:1000241)	number of periods of voluntary immobility (CMO:0001045)	10	61345276	98211570	Rat
6893336	Cm75	Cardiac mass QTL 75	0.1	0.87	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	10	61345276	99703528	Rat
1558643	Cm44	Cardiac mass QTL 44	4.8	0.0000368	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	61345276	99703528	Rat
2313103	Bss80	Bone structure and strength QTL 80	2	0.0001	tibia strength trait (VT:1000284)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	10	62057807	107057807	Rat
2313105	Bss79	Bone structure and strength QTL 79	1.8	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	62057807	107057807	Rat
61449	Ciaa2	CIA Autoantibody QTL 2	7.1		blood autoantibody amount (VT:0003725)	calculated serum anti-type 2 collagen antibody titer (CMO:0001279)	10	63221094	107211142	Rat
1357344	Bp249	Blood pressure QTL 249		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	66743655	98003205	Rat
2317029	Aia19	Adjuvant induced arthritis QTL 19	2.98		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	10	66978955	107211142	Rat
2317039	Aia6	Adjuvant induced arthritis QTL 6	4.31		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	10	66978955	107211142	Rat
10450498	Bp384	Blood pressure QTL 384		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	67750049	107211142	Rat
1642980	Bp300	Blood pressure QTL 300			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	68383129	107211142	Rat
61396	Bp9	Blood pressure QTL 9	4.8	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	68420376	107211142	Rat
2300172	Bmd57	Bone mineral density QTL 57	9.8	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	10	69738412	107211142	Rat
2293646	Bss25	Bone structure and strength QTL 25	10.96	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	10	69738412	107211142	Rat
2293663	Bss33	Bone structure and strength QTL 33	9.34	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	10	69738412	107211142	Rat
6893366	Bw106	Body weight QTL 106	0.3	0.47	body mass (VT:0001259)	body weight (CMO:0000012)	10	70199100	107211142	Rat
70193	Mcs7	Mammary carcinoma susceptibility QTL 7	2.38		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	10	72224939	107211142	Rat
2298548	Neuinf7	Neuroinflammation QTL 7	3.4		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	10	72224939	107211142	Rat
2306793	Ean5	Experimental allergic neuritis QTL 5	4.7		nervous system integrity trait (VT:0010566)	IFNG-secreting splenocyte count (CMO:0002122)	10	72552416	93995749	Rat
1358188	Ept9	Estrogen-induced pituitary tumorigenesis QTL 9	3.9		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	10	73453136	96120911	Rat
2292617	Ept18	Estrogen-induced pituitary tumorigenesis QTL 18	3.9		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	10	73453136	96120911	Rat
1579919	Bp281	Blood pressure QTL 281		0.01	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	74372084	94965338	Rat
10450495	Bp383	Blood pressure QTL 383		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	76246085	94965338	Rat
2292438	Bp311	Blood pressure QTL 311			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	76246085	107211142	Rat
1302404	Cia27	Collagen induced arthritis QTL 27	2.6	0.0045	joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	10	76452683	107211142	Rat
4889492	Pancm2	Pancreatic morphology QTL 2	3.2		pancreatic beta cell morphology trait (VT:0005217)	ratio of insulin-positive cell area to total area of splenic region of pancreas (CMO:0001814)	10	76748906	107211142	Rat
1300107	Rf18	Renal function QTL 18	3.41		urine output (VT:0003620)	timed urine volume (CMO:0000260)	10	78775516	98279596	Rat
1358915	Stresp7	Stress response QTL 7	3.52		blood norepinephrine amount (VT:0005663)	plasma norepinephrine level (CMO:0001010)	10	78899655	87307728	Rat
631555	Bp134	Blood pressure QTL 134		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	80515287	91230079	Rat
6893357	Bw102	Body weight QTL 102	0.5	0.36	body mass (VT:0001259)	body weight (CMO:0000012)	10	80515287	101325465	Rat
2303589	Bw87	Body weight QTL 87	2		body mass (VT:0001259)	body weight (CMO:0000012)	10	81285008	107211142	Rat
4889948	Bss91	Bone structure and strength QTL 91	4		tibia area (VT:1000281)	tibia midshaft total cross-sectional area (CMO:0001715)	10	82564856	92369470	Rat
2317754	Glom25	Glomerulus QTL 25	3.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	82685200	107211142	Rat
12880055	Am11	Aortic mass QTL 11		0.004	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	84007272	95933025	Rat
2301398	Kidm38	Kidney mass QTL 38		0.002	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	10	84007272	95933025	Rat
2306792	Ean4	Experimental allergic neuritis QTL 4	4		nervous system integrity trait (VT:0010566)	IFNG-secreting splenocyte count (CMO:0002122)	10	84022321	93995963	Rat
1600367	Mcs15	Mammary carcinoma susceptibility QTL 15	4.5		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	10	85565469	103884409	Rat
631538	Oia5	Oil induced arthritis QTL 5			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	87055121	107211142	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium							8	11					8
Low	3	13	26	10	18	10			15	10	12	11
Below cutoff		30	25	25	1	25			33	13	17

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001109048	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC134158	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000220	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000028388 ⟹ ENSRNOP00000028388

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	87,225,912 - 87,233,078 (+)	Ensembl
Rnor_6.0 Ensembl	10	90,217,924 - 90,226,537 (+)	Ensembl

RefSeq Acc Id:

NM_001109048 ⟹ NP_001102518

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	10	87,225,976 - 87,233,078 (+)	NCBI
Rnor_6.0	10	90,217,979 - 90,224,984 (+)	NCBI
Rnor_5.0	10	90,004,557 - 90,011,501 (+)	NCBI
RGSC_v3.4	10	91,351,087 - 91,359,176 (+)	RGD
Celera	10	85,941,754 - 85,948,522 (+)	RGD

Sequence:

show sequence

ATGGCAGGGGAGAGCTTCCCTTTCACATCCTCCACGCGGCGTGCCCTCCGCCTACAGAGAGAGT
GGCTGGAGTGGGAGGACCGGAGGAGGGCTGCTGCCCATCAGTGCCGAAGCCACAGGTACCTCCC
TAGTCCCCAAGCCCGGCTCATTAGGCCTCGCCGCTCCTGCAGAGACCCAGCTGTCCACAATGCC
CTGTTCTCTGGGGACCTACAGCAAGTCCAAATCCTGTTCCAAGACGAAGAAGCTGCCAACATGA
TTGTGGAGACTGTGAACAACCAGCTGGCCTGGTCAGCGGAACAGGGATTCTGGGTATTGACTCC
AAAGACCAAACAAACAGCACCTCTCACCATCACTGTGGCCAGAGGCTACACAGACTGCGCCCGA
CACCTTATCCTGAAGGGAGCTGAGCTTGATGCCCGAATTGGAGGACGTGCTGCCTTGCACGAGG
CCTGTGCCCAAGCCCATCCTGACTGTGTGCGGCTGCTGCTCACCTTTGGTGCCAAGGCTAATGT
ATTGTCTGATGAGGGCATGACCCCCTTGCACCTCTGCACAGCTCCCGAGTCTTTGCAGTGCGCC
AAGTTGCTGCTGGAGGCTGGAGCGTCTGTGAATGTGGCATCGCAAGAGAGTGAAGTCACGCCCC
TGCATGTGGCTGCAGCTCGTGGCCTGGAACAACATGTGGCCCTCTACCTGCAGAACGGTGCAGA
CGTGGCCCTGCGCACCAGCCAGGGAGAGACTGCGCTGAACGCAGCGTGCGCTGGAGCAGAGGGG
CCAGGCAGCAGCCGGCAGCACGAGGCTGCCGCGCGACAGCTCCTGGAAGCTGGGGCTGATCCCC
AGGCTGCGGGTCGCAAGCGCCACACACCACTGCACAACGCCTGTGCTAATGGCTGCGGAGGTCT
GGCCGAGCTGCTGCTGCGCCACGGGGCAAGCCCTGGAGTCACCAATGGGGCAGGCCACACGCCA
ATGGACTGCGCGCTGCAAGCGGTACAGGACGCCCCCAACTGGGAGCCTGAGGTCCTCTTTGCAG
CGCTGCTGGACTACGGGGCTGAGCCCGTTCACCCTGAGATGCTGAAATACTGTGCCAACTTTCC
ACGGGCCATGGAAGTCCTCCTTAACGCCTATCCATGTGTCCCATCCTGTGACACCTGGGTGGAG
GCTGTGCTCCCGGAGCTGTGGCAGGAACATGAAGCCTTCTACAGCTCAGCCCTAAGCATGGAAA
ACCAGCCAAGACGGCTGCAGCACCTAGCCCGCCTGGCTGTTCGTGCTCAGTTGGGCAGCAACTG
TCGGCAGGCCGCCACCCAGCTCCCCCTGCCTCCACTGCTCAGAGACTACCTGCTGCTGTGTGTG
GAGGGACGAATCCAGTGAGCCCTGAACTTCCACCTACTCCTTCTCCCAGCAGCTGAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001102518	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM06181	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_001102518 ⟸ NM_001109048

- UniProtKB:

D4A8E5 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAGESFPFTSSTRRALRLQREWLEWEDRRRAAAHQCRSHRYLPSPQARLIRPRRSCRDPAVHNA
LFSGDLQQVQILFQDEEAANMIVETVNNQLAWSAEQGFWVLTPKTKQTAPLTITVARGYTDCAR
HLILKGAELDARIGGRAALHEACAQAHPDCVRLLLTFGAKANVLSDEGMTPLHLCTAPESLQCA
KLLLEAGASVNVASQESEVTPLHVAAARGLEQHVALYLQNGADVALRTSQGETALNAACAGAEG
PGSSRQHEAAARQLLEAGADPQAAGRKRHTPLHNACANGCGGLAELLLRHGASPGVTNGAGHTP
MDCALQAVQDAPNWEPEVLFAALLDYGAEPVHPEMLKYCANFPRAMEVLLNAYPCVPSCDTWVE
AVLPELWQEHEAFYSSALSMENQPRRLQHLARLAVRAQLGSNCRQAATQLPLPPLLRDYLLLCV
EGRIQ

hide sequence

RefSeq Acc Id:

ENSRNOP00000028388 ⟸ ENSRNOT00000028388

Protein Domains

SOCS box

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4A8E5-F1-model_v2	AlphaFold	D4A8E5	1-453	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13697779

Promoter ID:

EPDNEW_R8304

Type:

single initiation site

Name:

Asb16_1

Description:

ankyrin repeat and SOCS box-containing 16

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	10	90,217,907 - 90,217,967	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1563878	AgrOrtholog
BioCyc Gene	G2FUF-23115	BioCyc
Ensembl Genes	ENSRNOG00000036794	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000028388	ENTREZGENE
	ENSRNOP00000028388.4	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000028388	ENTREZGENE
	ENSRNOT00000028388.8	UniProtKB/TrEMBL
Gene3D-CATH	1.25.40.20	UniProtKB/TrEMBL
	SOCS box	UniProtKB/TrEMBL
InterPro	Ankyrin_rpt	UniProtKB/TrEMBL
	Ankyrin_rpt-contain_sf	UniProtKB/TrEMBL
	SOCS_box_dom_like	UniProtKB/TrEMBL
	SOCS_C	UniProtKB/TrEMBL
KEGG Report	rno:498005	UniProtKB/TrEMBL
NCBI Gene	498005	ENTREZGENE
PANTHER	ANKYRIN REPEAT AND PROTEIN KINASE DOMAIN-CONTAINING PROTEIN	UniProtKB/TrEMBL
	ANKYRIN REPEAT AND SOCS BOX-CONTAINING 10-RELATED	UniProtKB/TrEMBL
Pfam	Ank	UniProtKB/TrEMBL
	Ank_2	UniProtKB/TrEMBL
	Ank_5	UniProtKB/TrEMBL
	SOCS_box	UniProtKB/TrEMBL
PhenoGen	Asb16	PhenoGen
PROSITE	ANK_REP_REGION	UniProtKB/TrEMBL
	ANK_REPEAT	UniProtKB/TrEMBL
	SOCS	UniProtKB/TrEMBL
SMART	ANK	UniProtKB/TrEMBL
	SOCS_box	UniProtKB/TrEMBL
Superfamily-SCOP	ANK	UniProtKB/TrEMBL
	SSF158235	UniProtKB/TrEMBL
UniProt	D4A8E5	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-04-30	Asb16	ankyrin repeat and SOCS box-containing 16	Asb16_predicted	ankyrin repeat and SOCS box-containing 16 (predicted)	'predicted' is removed	2292626	APPROVED
2007-09-21	Asb16_predicted	ankyrin repeat and SOCS box-containing 16 (predicted)	RGD1563878_predicted	similar to ankyrin repeat domain-containing SOCS box protein Asb-16 (predicted)	Symbol and Name updated to reflect Human and Mouse nomenclature	1299863	APPROVED
2006-03-07	RGD1563878_predicted	similar to ankyrin repeat domain-containing SOCS box protein Asb-16 (predicted)	LOC498005	similar to ankyrin repeat domain-containing SOCS box protein Asb-16	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC498005	similar to ankyrin repeat domain-containing SOCS box protein Asb-16			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar