Advanced Search (OLGA)

Gene: Cbln1 (cerebellin 1 precursor) Rattus norvegicus

Analyze

Symbol:

Cbln1

Name:

cerebellin 1 precursor

RGD ID:

1562813

Description:

Predicted to enable identical protein binding activity. Predicted to be involved in several processes, including cerebellar granule cell differentiation; modulation of chemical synaptic transmission; and regulation of synapse assembly. Predicted to act upstream of or within establishment of localization in cell; positive regulation of synapse assembly; and protein secretion. Predicted to be located in extracellular region and postsynaptic membrane. Predicted to be part of trans-synaptic protein complex. Predicted to be active in glutamatergic synapse; parallel fiber to Purkinje cell synapse; and synaptic cleft. Orthologous to human CBLN1 (cerebellin 1 precursor); INTERACTS WITH 6-propyl-2-thiouracil; acrylamide; all-trans-retinoic acid.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

cerebellin 1; cerebellin 1 precursor protein; cerebellin-1; LOC498922; precerebellin; similar to cerebellin 1 precursor protein

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CBLN1 (cerebellin 1 precursor)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Cbln1 (cerebellin 1 precursor protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Cbln1 (cerebellin 1 precursor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CBLN1 (cerebellin 1 precursor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CBLN1 (cerebellin 1 precursor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Cbln1 (cerebellin 1 precursor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CBLN1 (cerebellin 1 precursor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CBLN1 (cerebellin 1 precursor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Cbln1 (cerebellin 1 precursor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	CBLN2 (cerebellin 2 precursor)	HGNC	OrthoDB
Alliance orthologs ³
Homo sapiens (human):	CBLN1 (cerebellin 1 precursor)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Cbln1 (cerebellin 1 precursor protein)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cbln1 (cerebellin 1 precursor)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	cbln1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	cbln1	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	35,782,151 - 35,785,960 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	19	35,781,952 - 35,785,960 (+)	Ensembl				GRCr8
mRatBN7.2	19	19,608,763 - 19,612,572 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	19,608,716 - 19,612,572 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	19	21,288,213 - 21,292,022 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	26,482,719 - 26,486,528 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	29,446,719 - 29,450,528 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	20,607,507 - 20,611,316 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	20,607,507 - 20,611,316 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	19	31,617,915 - 31,621,724 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	19	20,941,254 - 20,945,063 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	19	19,489,280 - 19,493,089 (+)	NCBI		Celera
Cytogenetic Map	19	p11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(S)-nicotine (ISO)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

acrylamide (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (EXP,ISO)

alpha-Zearalanol (EXP)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

carbamazepine (ISO)

CGP 52608 (ISO)

cocaine (ISO)

copper atom (EXP)

copper(0) (EXP)

Cuprizon (EXP)

DDT (EXP)

decabromodiphenyl ether (ISO)

dibutyl phthalate (ISO)

dicyclanil (ISO)

dimethylarsinic acid (EXP)

dorsomorphin (ISO)

entinostat (ISO)

ethanol (ISO)

fenvalerate (EXP)

flusilazole (EXP)

folic acid (ISO)

fulvestrant (ISO)

leflunomide (ISO)

mono(2-ethylhexyl) phthalate (ISO)

morphine (ISO)

nicotine (ISO)

paracetamol (ISO)

perfluorooctanoic acid (EXP)

SB 431542 (ISO)

sodium arsenite (ISO)

Soman (EXP)

sunitinib (ISO)

Tetrachlorobisphenol A (ISO)

titanium dioxide (ISO)

tributylstannane (EXP)

trichostatin A (ISO)

triclosan (ISO)

valproic acid (ISO)

vinclozolin (EXP)

zearalenone (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cerebellar granule cell differentiation (IEA,ISO,ISS)

establishment of localization in cell (IEA)

heterophilic cell-cell adhesion (IEA,ISO,ISS)

maintenance of synapse structure (IBA,IEA,ISO,ISS)

negative regulation of excitatory postsynaptic potential (IEA,ISO)

negative regulation of inhibitory synapse assembly (IEA,ISO,ISS)

positive regulation of long-term synaptic depression (IEA,ISO)

positive regulation of synapse assembly (IEA,ISO)

protein secretion (IEA,ISO)

regulation of postsynaptic density assembly (IEA,ISO)

regulation of presynapse assembly (IEA,ISO)

synapse assembly (IEA)

synapse organization (IEA,ISO,ISS)

trans-synaptic signaling, modulating synaptic transmission (IEA,ISO)

Cellular Component

extracellular region (IEA,ISO,ISS)

glutamatergic synapse (IBA,IEA,ISO)

parallel fiber to Purkinje cell synapse (IEA,ISO)

postsynaptic membrane (IEA,ISO,ISS)

synapse (IEA,ISO)

synaptic cleft (IBA,IEA,ISO)

trans-synaptic protein complex (IEA,ISO)

Molecular Function

identical protein binding (IEA,ISO)

protein binding (ISO)

signaling receptor regulator activity (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
4.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:3399060	PMID:3420533	PMID:10688962	PMID:10964938	PMID:15057822	PMID:15702230	PMID:16593526	PMID:17030622	PMID:17331201	PMID:19082514	PMID:19200061	PMID:19212655
PMID:19250438	PMID:20395510	PMID:20537373	PMID:21356198	PMID:21410790	PMID:24467251	PMID:25931508	PMID:27033232	PMID:27418511	PMID:27926833	PMID:29691328	PMID:29782851

Genomics

Comparative Map Data

Cbln1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	35,782,151 - 35,785,960 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	19	35,781,952 - 35,785,960 (+)	Ensembl				GRCr8
mRatBN7.2	19	19,608,763 - 19,612,572 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	19,608,716 - 19,612,572 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	19	21,288,213 - 21,292,022 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	26,482,719 - 26,486,528 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	29,446,719 - 29,450,528 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	20,607,507 - 20,611,316 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	20,607,507 - 20,611,316 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	19	31,617,915 - 31,621,724 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	19	20,941,254 - 20,945,063 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	19	19,489,280 - 19,493,089 (+)	NCBI		Celera
Cytogenetic Map	19	p11	NCBI

CBLN1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	49,277,917 - 49,281,838 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	16	49,277,917 - 49,281,838 (-)	Ensembl			hg38	GRCh38
GRCh37	16	49,311,828 - 49,315,749 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	47,870,196 - 47,873,193 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	16	47,870,201 - 47,873,184	NCBI
Celera	16	33,823,798 - 33,827,712 (-)	NCBI		Celera
Cytogenetic Map	16	q12.1	NCBI
HuRef	16	35,201,971 - 35,205,448 (-)	NCBI		HuRef
CHM1_1	16	50,718,736 - 50,722,650 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	16	55,075,687 - 55,079,608 (-)	NCBI		T2T-CHM13v2.0

Cbln1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	88,195,481 - 88,199,220 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	88,195,033 - 88,199,237 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	8	87,468,853 - 87,472,592 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	87,468,405 - 87,472,609 (-)	Ensembl			mm10	GRCm38
MGSCv37	8	89,992,752 - 89,996,491 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	8	90,358,972 - 90,362,401 (-)	NCBI		MGSCv36	mm8
Celera	8	91,733,788 - 91,737,188 (-)	NCBI		Celera
Cytogenetic Map	8	C3	NCBI
cM Map	8	42.16	NCBI

Cbln1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955433	7,516,487 - 7,519,929 (-)	Ensembl
ChiLan1.0	NW_004955433	7,516,487 - 7,519,929 (-)	NCBI	ChiLan1.0	ChiLan1.0

CBLN1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	18	58,733,418 - 58,736,757 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	16	64,638,723 - 64,642,070 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	16	29,538,723 - 29,542,625 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	16	48,427,645 - 48,430,508 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	16	48,427,645 - 48,430,512 (-)	Ensembl			panPan2	panpan1.1

CBLN1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	65,974,989 - 65,978,464 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	65,974,981 - 65,977,179 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	62,551,600 - 62,555,146 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	66,525,421 - 66,528,966 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	66,525,139 - 66,528,947 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	63,348,394 - 63,352,176 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	64,368,563 - 64,372,103 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	65,256,811 - 65,260,596 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Cbln1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	57,092,332 - 57,095,795 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936475	2,494,156 - 2,496,743 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936475	2,493,280 - 2,496,738 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CBLN1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	35,515,754 - 35,519,517 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	6	35,516,097 - 35,518,080 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

CBLN1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	5	35,068,087 - 35,075,215 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	5	35,071,051 - 35,075,159 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666047	41,428,097 - 41,431,375 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cbln1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624757	7,264,434 - 7,268,105 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624757	7,264,425 - 7,267,979 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Variants

Variants in Cbln1
25 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	566
Count of miRNA genes:	248
Interacting mature miRNAs:	306
Transcripts:	ENSRNOT00000000011
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
8552935	Pigfal10	Plasma insulin-like growth factor 1 level QTL 10	5.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	19	7997750	52997750	Rat
61447	Tcas1	Tongue tumor susceptibility QTL 1	6.08		tongue integrity trait (VT:0010553)	squamous cell carcinoma of the tongue maximum tumor diameter (CMO:0001875)	19	19220689	64220689	Rat
9590298	Uminl5	Urine mineral level QTL 5	3.59	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	19	7997750	52997750	Rat
631840	Niddm38	Non-insulin dependent diabetes mellitus QTL 38	3.86		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	19	10329076	74246245	Rat
1358200	Insglur2	Insulin/glucose ratio QTL 2	4.1		blood glucose amount (VT:0000188)	serum glucose level (CMO:0000543)	19	5748064	50748064	Rat
7411549	Bw130	Body weight QTL 130	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	32365311	74246245	Rat
1331737	Uae29	Urinary albumin excretion QTL 29	5.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	36289	74246245	Rat
724518	Uae19	Urinary albumin excretion QTL 19	5.5		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	24093973	69093973	Rat
61423	Cia14	Collagen induced arthritis QTL 14	3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	19	10833618	74246245	Rat
2303628	Vencon9	Ventilatory control QTL 9		0.005	respiration trait (VT:0001943)	minute ventilation (CMO:0000132)	19	23188586	68188586	Rat
1578764	Stresp19	Stress response QTL 19	3.6	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	19	32539615	74246245	Rat
1558656	Prcs1	Prostate cancer susceptibility QTL 1	5		prostate integrity trait (VT:0010571)	percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943)	19	31287532	51431640	Rat
9590090	Insglur8	Insulin/glucose ratio QTL 8	10.81	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	19	7997750	52997750	Rat
9590250	Scort11	Serum corticosterone level QTL 11	23.45	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	19	7997750	52997750	Rat
1331788	Rf45	Renal function QTL 45	2.818		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	19	31777888	74246245	Rat
1554318	Bmd5	Bone mineral density QTL 5	12.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	19	23188586	68188586	Rat
2317848	Alcrsp21	Alcohol response QTL 21	1.899999976158142	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	19	20109306	65109306	Rat
7247442	Uae39	Urinary albumin excretion QTL 39			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	2194317	74246245	Rat
724566	Uae12	Urinary albumin excretion QTL 12	5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	2194317	74246245	Rat
61407	Scl12	Serum cholesterol level QTL 12		0.001	blood HDL cholesterol amount (VT:0000184)	serum high density lipoprotein cholesterol level (CMO:0000361)	19	30099383	47207961	Rat

Markers in Region

RH142530

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	19,609,887 - 19,610,049 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	20,608,632 - 20,608,793	NCBI	Rnor6.0
Rnor_5.0	19	31,619,040 - 31,619,201	UniSTS	Rnor5.0
RGSC_v3.4	19	20,942,379 - 20,942,540	UniSTS	RGSC3.4
Celera	19	19,490,405 - 19,490,566	UniSTS
Cytogenetic Map	19	p11	UniSTS

UniSTS:464655

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	19,611,381 - 19,611,494 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	20,610,126 - 20,610,238	NCBI	Rnor6.0
Rnor_5.0	19	31,620,534 - 31,620,646	UniSTS	Rnor5.0
RGSC_v3.4	19	20,943,873 - 20,943,985	UniSTS	RGSC3.4
Celera	19	19,491,899 - 19,492,011	UniSTS
Cytogenetic Map	19	p11	UniSTS

Cbln1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	19,609,223 - 19,610,628 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	20,607,968 - 20,609,372	NCBI	Rnor6.0
Rnor_5.0	19	31,618,376 - 31,619,780	UniSTS	Rnor5.0
RGSC_v3.4	19	20,941,715 - 20,943,119	UniSTS	RGSC3.4
Celera	19	19,489,741 - 19,491,145	UniSTS
Cytogenetic Map	19	p11	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
14	8	35	133	43	47	19	29	19	6	156	87	10	115	30	90	28	11	11

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001109127	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC087589	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474037	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000019	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000000011 ⟹ ENSRNOP00000000011

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	19	35,781,952 - 35,785,960 (+)	Ensembl
mRatBN7.2 Ensembl	19	19,608,716 - 19,612,572 (+)	Ensembl
Rnor_6.0 Ensembl	19	20,607,507 - 20,611,316 (+)	Ensembl

RefSeq Acc Id:

NM_001109127 ⟹ NP_001102597

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	35,782,151 - 35,785,960 (+)	NCBI
mRatBN7.2	19	19,608,763 - 19,612,572 (+)	NCBI
Rnor_6.0	19	20,607,507 - 20,611,316 (+)	NCBI
Rnor_5.0	19	31,617,915 - 31,621,724 (+)	NCBI
RGSC_v3.4	19	20,941,254 - 20,945,063 (+)	RGD
Celera	19	19,489,280 - 19,493,089 (+)	RGD

Sequence:

show sequence

ATGCTGGGCGTCGTGGAGCTGCTGTTGTTGGGGGCTGCGTGGCTGGCAGGCCCAGCCCGCGGGC
AGAATGAGACAGAACCCATCGTCCTGGAGGGCAAGTGCCTGGTGGTGTGTGACTCCAACCCCAC
GTCCGACCCTACGGGCACTGCTCTGGGCATCTCTGTGCGCTCGGGCAGCGCCAAGGTGGCTTTC
TCTGCCATCAGGAGCACCAACCATGAGCCGTCCGAGATGAGTAATCGCACCATGATCATCTACT
TCGACCAGGTACTAGTGAACATCGGGAACAACTTTGACTCAGAACGCAGCACTTTCATCGCCCC
GCGCAAAGGCATCTACAGTTTTAACTTCCACGTGGTGAAAGTCTACAACAGACAGACCATCCAG
GTGAGCCTCATGTTGAACGGTTGGCCGGTGATTTCAGCCTTCGCCGGCGACCAAGACGTGACAC
GCGAGGCTGCCAGCAACGGCGTCCTCATCCAGATGGAGAAAGGCGACCGAGCATACCTCAAGCT
GGAGCGGGGGAACTTGATGGGGGGCTGGAAGTACTCAACCTTCTCTGGATTCCTCGTGTTTCCC
CTCTGACTGGCTCGTATCGGGAATGGAGGCAGGAGAGAGGCAGGAGGGGAGTGAGAAAGAGGCC
GAAAATTACCAGGGCGAGGAAGCGGCGACACCGGAAACTTCCTACGTGTTCCTAGCTACACTGG
GTACCAAGGTGCGCGCCGCCCGCGGTCCAACTTCGTCCGCTCCCTTACTAAGAGAAGTAAATTT
CGCTTAGCTCTGCACACTCCCGTTTCCAAAATTAGTCTCGCCTCCCCCAAGCCAGTTGCAGTAA
TCGAGGAAGAGACTTTGCCTTGTCATTATGGTTCCTTACCCACGTCCATGTCCCTAACAATTAA
CGAAGTAATGTGAAATGTTTCTCCCGACCCGATCCCCCTCTGAACCCTGCCACTTACTGAAACT
TAGTATGCCCCCCTGCCCCAGTTCGAAGAGGGGGTCAGTTTGGTTTCTGTTTGTTTTTGAATGG
GGCAGGTAGTTTTAATAAACAGATTTTGCTCTTCAAACACCGCGCCAGTTAAGCTGGAGAGAAT
TCATCCCCCGCTTATTAGCGGACGAAAGACTCACCTTCGTGGTGACTGGTTTAACTATACATAA
ATACGTATCATTTGTACACGAAGAGCTCTTCCAGGTGGACGCTGGCTGTATTCCGTATTTCTGT
CCTGTTCGGAGTGATCGTGAAATCTAAGGCTGCTTGGTGTTTGTTCTCTGATGCTTGTCAATGC
CCCGTGTTCTGTGGCTCCACCAAACGCCAAGGAGGTTCTTCGGGACTCTTCTTCCTCTGTAACA
TACGTGTGAATAGCCAAATTTTAATTTTGCTTTAATCCAATAAAGTCAAAGTGGGACTTTTATT
TTTCTGAAACAGCTTTCTGAACTTCGCCTTTTCCGGGTTGCGAGGTTGAGGTGGGCGGAAAAAC
AAGATACTTGGAAGCTGCGAGGAGAGGCCAGGGCACAAGGCCTTCTTCACAAAGCCATTTCTGC
GCTGTCTCCCGCAGCAGGCTCGCTTTGCCTTCCCTGTGTCCCCTGCTTTGGTGCAATGTGAGAT
ATATGACCCAAATCCTACTAGCCGTGACTGAGAGCCTGGAAGCAATCTGTTGCCCTCCCTCAAT
TCCAAATGCATCAGGAATTATTCCCAATTCTAGTACTCGAACCCGCCTGCCCCGCGTGACAGTG
TCTTCACGCCTACTTTCCTTGGATGTCTCCAGCTCTCTCCGCTCCGCGGCTCCCGAAGCACCTT
ACACTTTGTACCAGCGCCTCTGAACCTGAGGTCCACCCGCCAAACAACCTCGGCGGCGGCCAGA
CTTGCGATTGCGCTCATTCGTAGGATTTTAAAGGGGTTCGTCCAGAAGTTTTGATTGTACCGAA
ACATAATGTGCAAAGCAAAATTGAAATAAACGACTTCGTTTTAAGTCTGGAAAGCTGACCCTGT
GTTGAACGCGGGTGATGCAACGCCAGAAGCGGGCGGAAGCCAAGGGTCCAGGACTGAGATCCGC
GACCCGGTGGGTTCCTGTGGTACTGGGCCCTCCTCCAGGGTTTTTTTGGGTTGAGATTCAGTTT
TGAGTTTCAGTGGTTCTTGAGTGAGGGGTGGGGAAAGCAGGGGTTAACACCACCGCAGGCAAAA
TTTCTGGCATTTCTGTCTCCTGCCCCCAACCCCATCCCCAGCGCTTCACAAGCACAGCAGTCCT
GGGAACCCAGCTCCTCTTTGTCGACCGCACAGCTTAAAGTGCTTCTGGCAGCAGCGCCCTTCAC
AGGGCTAGGGACCGAGGGGGCCGTAGGTGACAAAAGGGGGTTCCGAGGGAATGTAGTGGAACCG
CCGGTCTCTTCCATTCTCACAGTTCTGGTGAGAGGGGCCTTAGGGAATTAAATTTTTAAAAAGG
TGAATTTTTTTT

hide sequence

Protein Sequences


Protein RefSeqs	NP_001102597	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL87512	(Get FASTA)	NCBI Sequence Viewer
	EDL87513	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000000011
	ENSRNOP00000000011.4
GenBank Protein	P63182	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001102597 ⟸ NM_001109127
- Peptide Label:	precursor
- UniProtKB:	P63182 (UniProtKB/Swiss-Prot), A6KDB3 (UniProtKB/TrEMBL)
- Sequence:	show sequence MLGVVELLLLGAAWLAGPARGQNETEPIVLEGKCLVVCDSNPTSDPTGTALGISVRSGSAKVAF SAIRSTNHEPSEMSNRTMIIYFDQVLVNIGNNFDSERSTFIAPRKGIYSFNFHVVKVYNRQTIQ VSLMLNGWPVISAFAGDQDVTREAASNGVLIQMEKGDRAYLKLERGNLMGGWKYSTFSGFLVFP L hide sequence

Ensembl Acc Id:

ENSRNOP00000000011 ⟸ ENSRNOT00000000011

Protein Domains

C1q

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P63182-F1-model_v2	AlphaFold	P63182	1-193	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1562813	AgrOrtholog
BioCyc Gene	G2FUF-6256	BioCyc
Ensembl Genes	ENSRNOG00000000010	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000000011	ENTREZGENE
	ENSRNOT00000000011.6	UniProtKB/Swiss-Prot
Gene3D-CATH	2.60.120.40	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7319817	IMAGE-MGC_LOAD
InterPro	C1q_dom	UniProtKB/Swiss-Prot
	Cerebellin_Synaptic_Org	UniProtKB/Swiss-Prot
	Tumour_necrosis_fac-like_dom	UniProtKB/Swiss-Prot
KEGG Report	rno:498922	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:105776	IMAGE-MGC_LOAD
NCBI Gene	498922	ENTREZGENE
PANTHER	CEREBELLIN-1	UniProtKB/Swiss-Prot
	CEREBELLIN-RELATED	UniProtKB/Swiss-Prot
Pfam	C1q	UniProtKB/Swiss-Prot
PhenoGen	Cbln1	PhenoGen
PRINTS	COMPLEMNTC1Q	UniProtKB/Swiss-Prot
PROSITE	C1Q	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000000010	RatGTEx
SMART	C1Q	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF49842	UniProtKB/Swiss-Prot
UniProt	A6KDB3	ENTREZGENE, UniProtKB/TrEMBL
	CBLN1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
UniProt Secondary	P02682	UniProtKB/Swiss-Prot
	P23436	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-08-29	Cbln1	cerebellin 1 precursor	Cbln1	cerebellin 1 precursor protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-05-15	Cbln1	cerebellin 1 precursor protein	Cbln1	cerebellin 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-05	Cbln1	cerebellin 1	LOC498922	similar to cerebellin 1 precursor protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-02-09	LOC498922	similar to cerebellin 1 precursor protein			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message