Advanced Search (OLGA)

Gene: Gins1 (GINS complex subunit 1) Rattus norvegicus

Analyze

Symbol:

Gins1

Name:

GINS complex subunit 1

RGD ID:

1562246

Description:

Predicted to be involved in DNA strand elongation involved in mitotic DNA replication. Predicted to act upstream of or within DNA replication and inner cell mass cell proliferation. Predicted to be located in cytoplasm and nucleus. Predicted to be part of CMG complex and GINS complex. Human ortholog(s) of this gene implicated in immunodeficiency 55. Orthologous to human GINS1 (GINS complex subunit 1); INTERACTS WITH 1-naphthyl isothiocyanate; 17beta-estradiol; 2,2',4,4'-Tetrabromodiphenyl ether.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

DNA replication complex GINS protein PSF1; GINS complex subunit 1 (Psf1 homolog); LOC499914; RGD1562246; similar to Hypothetical UPF0080 protein KIAA0186

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GINS1 (GINS complex subunit 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Gins1 (GINS complex subunit 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Gins1 (GINS complex subunit 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GINS1 (GINS complex subunit 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GINS1 (GINS complex subunit 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Gins1 (GINS complex subunit 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GINS1 (GINS complex subunit 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GINS1 (GINS complex subunit 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Gins1 (GINS complex subunit 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	SPINK6 (serine peptidase inhibitor Kazal type 6)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Gins1 (GINS complex subunit 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	GINS1 (GINS complex subunit 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	gins1 (GINS complex subunit 1 (Psf1 homolog))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	PSF1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):	PSF1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Psf1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	psf-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	gins1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	gins1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	160,184,920 - 160,206,334 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	3	160,180,151 - 160,206,332 (+)	Ensembl				GRCr8
mRatBN7.2	3	139,724,513 - 139,745,930 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	139,724,490 - 139,745,936 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	3	143,620,798 - 143,642,222 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	152,204,539 - 152,225,969 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	149,953,061 - 149,974,539 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	146,695,366 - 146,716,787 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	146,695,344 - 146,716,816 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	3	153,056,224 - 153,077,645 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	3	141,535,210 - 141,557,391 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	3	138,486,128 - 138,506,715 (+)	NCBI		Celera
Cytogenetic Map	3	q41	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

hepatocellular carcinoma (ISO)

immunodeficiency 55 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

1,1-dichloroethene (ISO)

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

1,2-dimethylhydrazine (ISO)

1-naphthyl isothiocyanate (EXP)

17beta-estradiol (EXP,ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,2'-Methylenebis(4-methyl-6-tert-butylphenol) (ISO)

2,4,4'-trichlorobiphenyl (ISO)

5-fluorouracil (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

aflatoxin B1 (EXP,ISO)

all-trans-retinoic acid (ISO)

amiodarone (ISO)

aristolochic acid A (ISO)

azathioprine (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

butanal (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

calcitriol (ISO)

cannabidiol (ISO)

carbon nanotube (ISO)

chromium(6+) (ISO)

cisplatin (EXP,ISO)

cobalt dichloride (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

cordycepin (ISO)

coumestrol (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

DDE (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (ISO)

dioxygen (ISO)

Enterolactone (ISO)

epoxiconazole (ISO)

fenthion (ISO)

flutamide (EXP)

furan (EXP)

genistein (ISO)

GSK-J4 (ISO)

isotretinoin (ISO)

leflunomide (ISO)

lidocaine (EXP)

methidathion (ISO)

methylparaben (ISO)

N-Nitrosopyrrolidine (ISO)

nickel sulfate (ISO)

niclosamide (ISO)

okadaic acid (ISO)

oxaliplatin (EXP)

ozone (ISO)

paracetamol (ISO)

PCB138 (ISO)

perfluorononanoic acid (ISO)

phenobarbital (ISO)

pirinixic acid (ISO)

piroxicam (ISO)

potassium chromate (ISO)

propanal (ISO)

resveratrol (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

sodium dichromate (EXP)

sunitinib (ISO)

testosterone (ISO)

tetrachloromethane (ISO)

thioacetamide (EXP)

thiram (ISO)

titanium dioxide (EXP,ISO)

topotecan (EXP)

trimellitic anhydride (ISO)

triptonide (ISO)

tungsten (ISO)

urethane (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

DNA replication (IEA,ISO)

inner cell mass cell proliferation (ISO)

Cellular Component

chromosome (IEA)

CMG complex (ISO)

cytoplasm (ISO)

GINS complex (IEA,ISO)

nucleus (IEA,ISO)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:10942595	PMID:12477932	PMID:16287864	PMID:16338220

Genomics

Comparative Map Data

Gins1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	160,184,920 - 160,206,334 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	3	160,180,151 - 160,206,332 (+)	Ensembl				GRCr8
mRatBN7.2	3	139,724,513 - 139,745,930 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	139,724,490 - 139,745,936 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	3	143,620,798 - 143,642,222 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	152,204,539 - 152,225,969 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	149,953,061 - 149,974,539 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	146,695,366 - 146,716,787 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	146,695,344 - 146,716,816 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	3	153,056,224 - 153,077,645 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	3	141,535,210 - 141,557,391 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	3	138,486,128 - 138,506,715 (+)	NCBI		Celera
Cytogenetic Map	3	q41	NCBI

GINS1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	20	25,407,673 - 25,448,563 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	20	25,391,008 - 25,452,700 (+)	Ensembl			hg38	GRCh38
GRCh37	20	25,388,309 - 25,429,199 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	20	25,336,323 - 25,377,191 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	20	25,462,070 - 25,502,910 (+)	NCBI		Celera
Cytogenetic Map	20	p11.21	NCBI
HuRef	20	25,345,645 - 25,386,888 (+)	NCBI		HuRef
CHM1_1	20	25,388,730 - 25,429,596 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	20	25,472,775 - 25,513,638 (+)	NCBI		T2T-CHM13v2.0

Gins1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	150,751,482 - 150,773,200 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	150,747,320 - 150,773,200 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	2	150,909,556 - 150,931,280 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	150,905,400 - 150,931,280 (+)	Ensembl			mm10	GRCm38
MGSCv37	2	150,735,330 - 150,757,016 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	2	150,596,841 - 150,622,721 (+)	NCBI		MGSCv36	mm8
Celera	2	152,142,764 - 152,164,396 (+)	NCBI		Celera
Cytogenetic Map	2	G3	NCBI
cM Map	2	74.75	NCBI

Gins1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955415	31,341,021 - 31,367,135 (+)	Ensembl
ChiLan1.0	NW_004955415	31,341,021 - 31,363,069 (+)	NCBI	ChiLan1.0	ChiLan1.0

GINS1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	21	26,283,597 - 26,324,796 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	20	26,280,428 - 26,321,636 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	20	25,352,711 - 25,393,926 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	20	25,757,555 - 25,797,829 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	20	25,757,555 - 25,797,829 (+)	Ensembl			panPan2	panpan1.1

GINS1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	23	1,567,723 - 1,598,910 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	23	1,567,825 - 1,590,464 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	23	1,597,240 - 1,636,505 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	23	1,808,093 - 1,847,392 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	23	1,808,143 - 1,831,086 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	23	1,648,965 - 1,688,237 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	23	1,773,410 - 1,812,684 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	23	1,740,946 - 1,780,245 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Gins1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	147,000,985 - 147,030,621 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936620	422,230 - 446,753 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936620	421,845 - 446,853 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GINS1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	17	31,060,650 - 31,080,314 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	17	31,060,540 - 31,076,807 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	17	35,279,497 - 35,296,360 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GINS1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	2	56,448,443 - 56,467,908 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	2	56,448,392 - 56,467,712 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666087	2,784,289 - 2,789,694 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gins1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624939	176,929 - 205,642 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624939	177,496 - 212,804 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Variants

Variants in Gins1
116 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	148
Count of miRNA genes:	112
Interacting mature miRNAs:	123
Transcripts:	ENSRNOT00000010955
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2312673	Scl63	Serum cholesterol level QTL 63		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	98535255	168026850	Rat
1598877	Bp285	Blood pressure QTL 285	1.5	0.03	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	120538241	165538241	Rat
1578653	Vnigr3	Vascular neointimal growth QTL 3	3.1		artery morphology trait (VT:0002191)	artery neointimal hyperplastic lesion area (CMO:0001414)	3	130656562	169034231	Rat
2302373	Gluco39	Glucose level QTL 39	5.01		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	3	98535386	161695835	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	47233211	147415807	Rat
2298477	Eau4	Experimental allergic uveoretinitis QTL 4		0.0011	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	3	137398739	169034231	Rat
1581568	Rf53	Renal function QTL 53			urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	3	56395968	161299569	Rat
1578754	Stresp16	Stress response QTL 16	4	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	3	112681431	157681431	Rat
1300173	Rf11	Renal function QTL 11	3.38		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	121056165	145956249	Rat
9589106	Insul23	Insulin level QTL 23	13.86	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	3	131635904	169034231	Rat
10755461	Coatc16	Coat color QTL 16			coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	3	122438700	167438700	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	59242096	157323038	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
1354611	Despr2	Despair related QTL 2	3.03	0.0028	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	3	97084464	142084464	Rat
2303620	Vencon4	Ventilatory control QTL 4	3.9		respiration trait (VT:0001943)	tidal volume (CMO:0000222)	3	127162703	168026850	Rat
631841	Niddm39	Non-insulin dependent diabetes mellitus QTL 39	3.36		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	94856903	159898684	Rat
1576306	Schws3	Schwannoma susceptibility QTL 3		0.001	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	3	118839124	163839124	Rat
619618	Rf3	Renal disease susceptibility QTL 3	6.5	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate to body weight ratio (CMO:0001270)	3	107693393	152693393	Rat
1300159	Kidm4	Kidney mass QTL 4	3.83		kidney mass (VT:0002707)	right kidney wet weight to body weight ratio (CMO:0001953)	3	121056165	157309487	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	41874578	155617519	Rat
2312659	Slep7	Serum leptin concentration QTL 7		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	3	98535255	168026850	Rat
631673	Iddm13	Insulin dependent diabetes mellitus QTL 13	1.3	0.663	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	3	130193298	161695983	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	41874578	155617519	Rat
1581546	Pur13	Proteinuria QTL 13	2.93	0.0335	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	3	78196190	146592722	Rat
1578656	Vnigr2	Vascular neointimal growth QTL 2	4.2		artery morphology trait (VT:0002191)	lesioned artery residual lumen area (CMO:0001417)	3	130656562	169034231	Rat
8552952	Pigfal13	Plasma insulin-like growth factor 1 level QTL 13			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	3	138799500	169034231	Rat
631541	Bp81	Blood pressure QTL 81	4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	124122556	169034231	Rat
2293087	Iddm27	Insulin dependent diabetes mellitus QTL 27	2.68		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	97551417	147415807	Rat
2312670	Bw94	Body weight QTL 94		0.01	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	3	98535255	168026850	Rat
724532	Cm17	Cardiac mass QTL 17	2		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	3	95735366	140735366	Rat

Markers in Region

RH127530

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	139,734,285 - 139,734,481 (+)	MAPPER	mRatBN7.2
mRatBN7.2	17	41,700,904 - 41,701,100 (+)	MAPPER	mRatBN7.2
Rnor_6.0	17	43,947,876 - 43,948,071	NCBI	Rnor6.0
Rnor_6.0	3	146,705,138 - 146,705,333	NCBI	Rnor6.0
Rnor_5.0	17	45,802,548 - 45,802,743	UniSTS	Rnor5.0
Rnor_5.0	3	153,065,996 - 153,066,191	UniSTS	Rnor5.0
RGSC_v3.4	3	141,544,981 - 141,545,176	UniSTS	RGSC3.4
RGSC_v3.4	17	48,903,505 - 48,903,700	UniSTS	RGSC3.4
Celera	17	41,331,663 - 41,331,858	UniSTS
Celera	3	138,495,902 - 138,496,097	UniSTS
Cytogenetic Map	3	q41	UniSTS
Cytogenetic Map	17	q11	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	88	59	6	349	188	11	144	78	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001109207	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC166989	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474050	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ222087	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000010955 ⟹ ENSRNOP00000010955

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	160,184,870 - 160,206,332 (+)	Ensembl
mRatBN7.2 Ensembl	3	139,724,490 - 139,745,936 (+)	Ensembl
Rnor_6.0 Ensembl	3	146,695,344 - 146,716,816 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000138721 ⟹ ENSRNOP00000112728

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	160,180,151 - 160,206,332 (+)	Ensembl

RefSeq Acc Id:

NM_001109207 ⟹ NP_001102677

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	160,184,920 - 160,206,334 (+)	NCBI
mRatBN7.2	3	139,724,513 - 139,745,930 (+)	NCBI
Rnor_6.0	3	146,695,366 - 146,716,787 (+)	NCBI
Rnor_5.0	3	153,056,224 - 153,077,645 (+)	NCBI
RGSC_v3.4	3	141,535,210 - 141,557,391 (+)	RGD
Celera	3	138,486,128 - 138,506,715 (+)	RGD

Sequence:

show sequence

TGCTGGTGTTGTGTGACTCTGAACAATAGCAGTGCCGCGACCTAGGAGCCCAGCGAACGTTTGA
GGGTGACTTGGCAGTTGACGGGACCACAGGACCCAGGCGCATCCGTCATGTTCTGTGAAAAAGC
TATGGAGCTTGTCCGCGAGTTACACCGCGCGCCGGAAGGACAGCTGCCGGCATTCAATGAGGAC
GGACTCAGACAAGTTCTGGAGGAGATGAAAGCTTTGTATGAACAAAACCAGTCAGATGTGAATG
AAGCAAAGTCAGCTGGACGAGGTGATTTGATACCAACCATCAAATTTCGGCATTGTTCTTTGTT
AAGAAACAGGCGCTGCACGATAGCATACCTGTATGACCGGTTGCTTCGGATTAGAGCACTCAGG
TGGGAATATGGGAGTGTCTTGCCAAATCCTTTACGATTCCACATGTCTGCTGAAGAAGTGGAGT
GGTTCAACCATTATAAAAAGTCTCTTGCTACTTACATGAGGTCACTTGGAGGAGATGAAGGCTT
GGACATCACACAGGATGTGAAACCCCCCAAAAGCCTATATATTGAAGTGCGGTGTTTGAAAGAC
TATGGGGAATTTGAAGTTGATGATGGCACTTCAGTCCTGCTTAAAAAGAACAGTCAGCACTTTT
TGCCTCGGTGGAAGTGTGAGCAGTTAATCAGACAAGGAGTTCTGGAGCACGTGCTGTCCTGACT
GTGTCCCATGAGGACAAGAGCAGGGCACTCCTGGCCTTGCCAGGTGTGAAACTAAGCCAGCGCA
TAAGCGTCCCCACCGGACCTCCCCCTCCTTGGTCTTAAACTTACAGACATGCATTAACATAACC
AAGAGGGCCTGGGTCCAGCTCACTGTAGAGCGACTGCTTAGCATTTGAGAAACCCAAGAAGACT
ACCAAGAACTCTTGGCTCGGAGCATAATCTGCCAGCTCTTAAGCCTGTTACAGGCTGTGTCTCT
AGTTATTCCATTCCCACAGTACATATTGTACTCTTATAATTGAAAATAAACAGTCTTCGGTTTG
AAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001102677	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI66989	(Get FASTA)	NCBI Sequence Viewer
	EDL86131	(Get FASTA)	NCBI Sequence Viewer
	EDL86132	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000010955
	ENSRNOP00000010955.3

RefSeq Acc Id:	NP_001102677 ⟸ NM_001109207
- UniProtKB:	B2RZ16 (UniProtKB/TrEMBL), A6KHH3 (UniProtKB/TrEMBL), F7EXT9 (UniProtKB/TrEMBL)
- Sequence:	show sequence MFCEKAMELVRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEAKSAGRGDLIPTIKF RHCSLLRNRRCTIAYLYDRLLRIRALRWEYGSVLPNPLRFHMSAEEVEWFNHYKKSLATYMRSL GGDEGLDITQDVKPPKSLYIEVRCLKDYGEFEVDDGTSVLLKKNSQHFLPRWKCEQLIRQGVLE HVLS hide sequence

Ensembl Acc Id:

ENSRNOP00000010955 ⟸ ENSRNOT00000010955

Ensembl Acc Id:

ENSRNOP00000112728 ⟸ ENSRNOT00000138721

Protein Domains

DNA replication complex GINS protein PSF1 C- GINS subunit

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B2RZ16-F1-model_v2	AlphaFold	B2RZ16	1-196	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692520

Promoter ID:

EPDNEW_R3045

Type:

multiple initiation site

Name:

Gins1_1

Description:

GINS complex subunit 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	146,695,338 - 146,695,398	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1562246	AgrOrtholog
BioCyc Gene	G2FUF-47333	BioCyc
Ensembl Genes	ENSRNOG00000008091	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000010955	ENTREZGENE
	ENSRNOT00000010955.6	UniProtKB/TrEMBL
Gene3D-CATH	1.20.58.1030	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:9098732	IMAGE-MGC_LOAD
InterPro	GINS_A	UniProtKB/TrEMBL
	GINS_bundle-like_dom	UniProtKB/TrEMBL
	GINS_Psf1	UniProtKB/TrEMBL
	PSF1_C	UniProtKB/TrEMBL
KEGG Report	rno:499914	UniProtKB/TrEMBL
MGC_CLONE	MGC:189121	IMAGE-MGC_LOAD
NCBI Gene	499914	ENTREZGENE
PANTHER	DNA REPLICATION COMPLEX GINS PROTEIN PSF1	UniProtKB/TrEMBL
	GINS_Psf1	UniProtKB/TrEMBL
Pfam	PSF1_C	UniProtKB/TrEMBL
	Sld5	UniProtKB/TrEMBL
PhenoGen	Gins1	PhenoGen
RatGTEx	ENSRNOG00000008091	RatGTEx
Superfamily-SCOP	SSF158573	UniProtKB/TrEMBL
UniProt	A6KHH3	ENTREZGENE, UniProtKB/TrEMBL
	B2RZ16	ENTREZGENE
	F7EXT9	ENTREZGENE, UniProtKB/TrEMBL
UniProt Secondary	B2RZ16	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-03-29	Gins1	GINS complex subunit 1	Gins1	GINS complex subunit 1 (Psf1 homolog)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-02-29	Gins1	GINS complex subunit 1 (Psf1 homolog)	RGD1562246_predicted	similar to Hypothetical UPF0080 protein KIAA0186 (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-07	RGD1562246_predicted	similar to Hypothetical UPF0080 protein KIAA0186 (predicted)	LOC499914	similar to Hypothetical UPF0080 protein KIAA0186	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC499914	similar to Hypothetical UPF0080 protein KIAA0186			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM