Rnf130 (ring finger protein 130) - Rat Genome Database

Name: Rnf130
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes Projects (beta) QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Rnf130 (ring finger protein 130) Rattus norvegicus

Analyze

Symbol:

Rnf130

Name:

ring finger protein 130

RGD ID:

1562041

Description:

Predicted to enable ubiquitin protein ligase activity. Predicted to be involved in programmed cell death and ubiquitin-dependent protein catabolic process. Predicted to be located in membrane. Predicted to be active in cytoplasm. Orthologous to human RNF130 (ring finger protein 130); INTERACTS WITH 3-chloropropane-1,2-diol; 4,4'-sulfonyldiphenol; acetamide.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

E3 ubiquitin-protein ligase RNF130; goliath; goliath homolog; LOC652955; R-goliath

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RNF130 (ring finger protein 130)	HGNC	HomoloGene, NCBI, Panther
Mus musculus (house mouse):	Rnf130 (ring finger protein 130)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Rnf130 (ring finger protein 130)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RNF130 (ring finger protein 130)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RNF130 (ring finger protein 130)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rnf130 (ring finger protein 130)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	TBC1D9B (TBC1 domain family member 9B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RNF130 (ring finger protein 130)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rnf130 (ring finger protein 130)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	RNF130 (ring finger protein 130)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Rnf130 (ring finger protein 130)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	rnf130 (ring finger protein 130)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	H10E21.5	Alliance	DIOPT (OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	gol	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	10	34,342,835 - 34,456,048 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	34,342,830 - 34,456,062 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	39,018,868 - 39,109,075 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	7,557,284 - 7,648,324 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	34,012,539 - 34,102,754 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	35,537,976 - 35,610,711 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_5.0	10	35,306,181 - 35,372,319 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	10	33,725,463 - 33,782,965 (+)	NCBI		Celera
Cytogenetic Map	10	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

Prostatic Neoplasms (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

3,4-methylenedioxymethamphetamine (ISO)

3-chloropropane-1,2-diol (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (EXP,ISO)

acetamide (EXP)

all-trans-retinoic acid (ISO)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (EXP,ISO)

copper(II) sulfate (ISO)

dexamethasone (ISO)

dorsomorphin (ISO)

folic acid (ISO)

hydrogen peroxide (ISO)

indometacin (ISO)

inulin (ISO)

menadione (ISO)

mercury dibromide (ISO)

methylmercury chloride (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenylmercury acetate (ISO)

protein kinase inhibitor (ISO)

raloxifene (EXP)

resveratrol (ISO)

SB 431542 (ISO)

temozolomide (ISO)

tetrachloromethane (EXP)

thimerosal (ISO)

trichostatin A (ISO)

valproic acid (ISO)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

apoptotic process (IEA)

programmed cell death (ISO,ISS)

protein ubiquitination (IEA)

ubiquitin-dependent protein catabolic process (IBA)

Cellular Component

cytoplasm (IBA,IEA,ISO,ISS)

membrane (IEA)

Molecular Function

metal ion binding (IEA)

molecular_function (ND)

ubiquitin protein ligase activity (IBA)

ubiquitin-protein transferase activity (IEA,ISO,ISS)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Goliath, a ring-H2 mitochondrial protein, regulated by luteinizing hormone/human chorionic gonadotropin in rat leydig cells.	Guais A, etal., Biol Reprod. 2004 Jan;70(1):204-13. Epub 2003 Sep 17.
3.	GOA pipeline	RGD automated data pipeline
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:10806348	PMID:12477932	PMID:16549277

Genomics

Comparative Map Data

Rnf130
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	10	34,342,835 - 34,456,048 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	34,342,830 - 34,456,062 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	39,018,868 - 39,109,075 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	7,557,284 - 7,648,324 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	34,012,539 - 34,102,754 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	35,537,976 - 35,610,711 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_5.0	10	35,306,181 - 35,372,319 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	10	33,725,463 - 33,782,965 (+)	NCBI		Celera
Cytogenetic Map	10	q22	NCBI

RNF130
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	179,911,651 - 180,071,759 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	179,911,651 - 180,072,113 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	5	179,382,067 - 179,498,759 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	179,315,080 - 179,431,715 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	5	179,315,079 - 179,431,715	NCBI
Celera	5	175,007,667 - 175,124,334 (-)	NCBI		Celera
Cytogenetic Map	5	q35.3	NCBI
HuRef	5	174,106,824 - 174,223,323 (-)	NCBI		HuRef
CHM1_1	5	178,814,509 - 178,931,564 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	5	180,466,633 - 180,626,844 (-)	NCBI		T2T-CHM13v2.0

Rnf130
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	49,916,158 - 50,016,546 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	49,916,173 - 50,016,546 (+)	Ensembl		GRCm39 Ensembl
GRCm38	11	50,025,331 - 50,125,719 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	50,025,346 - 50,125,719 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	49,838,833 - 49,918,237 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	49,868,754 - 49,948,158 (+)	NCBI		MGSCv36	mm8
MGSCv36	11	50,438,610 - 50,518,097 (+)	NCBI		MGSCv36	mm8
Celera	11	54,587,997 - 54,667,386 (+)	NCBI		Celera
Cytogenetic Map	11	B1.3	NCBI
cM Map	11	30.16	NCBI

Rnf130
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955408	599,478 - 661,903 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955408	561,719 - 660,775 (+)	NCBI	ChiLan1.0	ChiLan1.0

RNF130
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	5	173,000,065 - 173,160,233 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	175,079,080 - 175,233,759 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	182,438,307 - 182,552,609 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	182,402,291 - 182,552,613 (-)	Ensembl	panpan1.1		panPan2

RNF130
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	11	1,662,685 - 1,788,896 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	11	1,645,512 - 1,746,459 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	11	1,767,065 - 1,905,100 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	11	1,617,343 - 1,755,463 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	11	1,616,786 - 1,753,794 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	11	1,589,103 - 1,727,146 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	11	1,668,351 - 1,806,430 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	11	1,908,452 - 2,046,546 (+)	NCBI		UU_Cfam_GSD_1.0

Rnf130
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	119,572,164 - 119,633,287 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936739	748,414 - 843,516 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936739	781,938 - 843,044 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TBC1D9B
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	78,515,733 - 78,670,028 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	78,515,718 - 78,670,035 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	80,138,753 - 80,232,858 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RNF130
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	23	81,647,146 - 81,794,893 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	23	81,682,202 - 81,794,489 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666075	13,027,973 - 13,175,976 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rnf130
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624733	42,788,980 - 42,885,648 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624733	42,760,048 - 42,885,671 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Rnf130
340 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	14
Count of miRNA genes:	13
Interacting mature miRNAs:	14
Transcripts:	ENSRNOT00000071917
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2293680	Bss40	Bone structure and strength QTL 40	5.66	0.0001	femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	10	1	35225947	Rat
634327	Hc4	Hypercalciuria QTL 4	2.4		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	10	1	38328221	Rat
7411611	Foco17	Food consumption QTL 17	18.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	10	1	42315980	Rat
70223	Bp57	Blood pressure QTL 57	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	1	80676123	Rat
10401803	Kidm50	Kidney mass QTL 50			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	10	418344	45418344	Rat
631554	Bp133	Blood pressure QTL 133		0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	743364	63851208	Rat
2313064	Bmd71	Bone mineral density QTL 71	0.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	10	5387014	50387014	Rat
2313066	Bss63	Bone structure and strength QTL 63	1.4	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	10	5387014	50387014	Rat
2313081	Bss64	Bone structure and strength QTL 64	1.3	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	10	5387014	50387014	Rat
2313095	Bss62	Bone structure and strength QTL 62	1.5	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	5387014	50387014	Rat
2313104	Bss61	Bone structure and strength QTL 61	0.9	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	10	5387014	50387014	Rat
2298544	Neuinf9	Neuroinflammation QTL 9	4.6		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	10	5801990	62146030	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6154182	73453136	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6357896	96121100	Rat
1578761	Stresp21	Stress response QTL 21	3.3		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	6375746	51375746	Rat
2303118	Mamtr7	Mammary tumor resistance QTL 7		0.003	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	9658275	104670812	Rat
9590310	Scort19	Serum corticosterone level QTL 19	6.3	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
9590268	Scort13	Serum corticosterone level QTL 13	3.26	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
9589136	Insul27	Insulin level QTL 27	10.46	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	10	11474010	56474010	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14487011	89062041	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14487011	104060283	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14487011	107057807	Rat
1354587	Kidm21	Kidney mass QTL 21	3.3		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	10	15028513	60430477	Rat
631564	Apr3	Acute phase response QTL 3	3.9		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	10	15275955	60275955	Rat
6893350	Bw99	Body weight QTL 99	0.87	0.16	body mass (VT:0001259)	body weight (CMO:0000012)	1	15906665	60906665	Rat
6893352	Bw100	Body weight QTL 100	0.33	0.6	body mass (VT:0001259)	body weight (CMO:0000012)	1	15906665	60906665	Rat
631532	Cm50	Cardiac mass QTL 50	6.6		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	10	17907113	51786432	Rat
1598852	Anxrr19	Anxiety related response QTL 19	5.07		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	10	18167841	63167841	Rat
2313055	Bw96	Body weight QTL 96	3.6	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	10	19606483	64606483	Rat
2313087	Bmd80	Bone mineral density QTL 80	3.2	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	10	19606483	64606483	Rat
1554317	Bmd4	Bone mineral density QTL 4	9.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	19816042	99406971	Rat
1581497	Esta1	Estrogen-induced thymic atrophy QTL 1			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	21329805	61345413	Rat
724556	Pur2	Proteinuria QTL 2	5.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	22427500	90627625	Rat
631531	Iresp2	Immunoglobin response QTL2	6.3		blood immunoglobulin E amount (VT:0002492)	serum total immunoglobulin E level (CMO:0001542)	10	22918268	36400810	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
70224	Eae3	Experimental allergic encephalomyelitis QTL 3	4.1		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	10	26521957	61345413	Rat
1298069	Bp168	Blood pressure QTL 168	5.5		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	10	26521957	98003205	Rat
631542	Bp82	Blood pressure QTL 82	6.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	26521957	98952741	Rat
2300171	Bmd58	Bone mineral density QTL 58	4.9	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	26944628	71944628	Rat
10402859	Bp381	Blood pressure QTL 381		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
2292441	Bp308	Blood pressure QTL 308			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
2298480	Eau7	Experimental allergic uveoretinitis QTL 7		0.0049	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	10	27957626	34490668	Rat
724527	Bp148	Blood pressure QTL 148		0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	28453136	73453136	Rat
1600371	Mcs21	Mammary carcinoma susceptibility QTL 21	3		mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	28875650	52200160	Rat
1331762	Rf40	Renal function QTL 40	3.873		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	10	29299504	64155584	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29299504	107211142	Rat
631557	Bp136	Blood pressure QTL 136		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	30632053	75632053	Rat
1576311	Pia26	Pristane induced arthritis QTL 26			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	31224026	75632053	Rat
1578779	Tcas10	Tongue tumor susceptibility QTL 10	3.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	10	31297439	76297439	Rat
1576319	Cia29	Collagen induced arthritis QTL 29			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	33973921	78973921	Rat

Markers in Region

BF403659

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	34,401,037 - 34,401,136 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	35,566,455 - 35,566,553	NCBI	Rnor6.0
Rnor_5.0	10	35,334,658 - 35,334,756	UniSTS	Rnor5.0
Celera	10	33,754,263 - 33,754,361	UniSTS
RH 3.4 Map	10	361.6	UniSTS

RH134456

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	13	60,808,720 - 60,808,919 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	65,952,423 - 65,952,621	NCBI	Rnor6.0
Rnor_5.0	13	70,925,642 - 70,925,840	UniSTS	Rnor5.0
RGSC_v3.4	13	63,042,736 - 63,042,934	UniSTS	RGSC3.4
Celera	13	60,808,371 - 60,808,569	UniSTS
RH 3.4 Map	13	284.6	UniSTS

Expression

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001037658	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039086812	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039086813	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039086814	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AY190520	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC166595	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ234228	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000219	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000071917 ⟹ ENSRNOP00000066033

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	34,343,200 - 34,433,605 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000095035 ⟹ ENSRNOP00000097851

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	34,342,830 - 34,433,605 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000099601 ⟹ ENSRNOP00000078027

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	34,343,200 - 34,456,062 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000109417 ⟹ ENSRNOP00000096952

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	34,342,830 - 34,428,704 (+)	Ensembl

RefSeq Acc Id:

NM_001037658 ⟹ NP_001032747

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	10	34,343,200 - 34,433,587 (+)	NCBI
Rnor_6.0	10	35,537,976 - 35,610,711 (+)	NCBI
Rnor_5.0	10	35,306,181 - 35,372,319 (+)	NCBI
Celera	10	33,725,463 - 33,782,965 (+)	RGD

Sequence:

show sequence

TTCGCGGCCGCGTCGACCGGCGGCGGCCGGAGGGACGATGAGCGGCGCGGCGCGGGCGGGCCCG
GCCCGGCTCGCGGCGCTGGCCCTGCTGACCTGCAGCCTGTGGCCGACGCGAGCGGACAACGCGA
GCCAGGAGTACTACACGGCGCTCATCAACGTGACGGTGCAGGAGCCCGGCCGCGGCACCCCTCT
CACGTTCCGCATCGACCGCGGGCGCTACGGGCTCGACTCACCCAAGGCCGAGGTCCGCGGCCAG
GTGCTGGCACCGCTGCCCATCCACGGAGTTGCTGATCATCTGGGCTGTGATCCTCAAACACGGT
TCTTTGTCCCTCCTAATATCAAACAGTGGATCGCCTTGCTCCAAAGAGGAAATTGCACCTTTAA
AGAAAAAATATCACGGGCTGCTTTTCACAATGCGGTTGCTGTAGTCATCTACAATAATAAATCC
AAAGAGGAGCCAGTCACCATGACTCATCCAGGCACGGGAGATATTATTGCTGTCATGATAACAG
AATTGAGGGGTAAGGATATTTTGAGTTATCTGGAGAAAAACATCTCTGTACAAATGACAATAGC
TGTTGGAACTCGAATGCCGCCAAAGAACTTCAGCCGTGGCTCTCTAGTCTTCGTGTCAATATCC
TTTATTGTTTTGATGATTATTTCTTCAGCGTGGCTCATATTCTACTTCATTCAGAAGATCAGGT
ATACAAATGCTCGCGACAGGAACCAGCGTCGTCTTGGAGACGCAGCCAAGAAAGCCATCAGTAA
ATTGACAACTAGAACGGTGAAAAAGGGCGATAAGGAAACAGACCCAGACTTCGATCACTGTGCA
GTCTGCATAGAGAGCTATAAGCAGAATGATGTTGTTCGGGTTCTCCCCTGCAAGCATGTTTTCC
ACAAATCCTGTGTGGATCCCTGGCTCAGTGAACACTGTACCTGTCCTATGTGTAAACTTAATAT
TTTGAAAGCCCTAGGAATTGTGCCAAATCTGCCATGTACTGATAATGTAGCGTTTGATATGGAA
AGGCTCACCAGAACCCAGGCAGTTAACCGAAGATCAGCCCTTGGTGACCTTGCCAATGACAGTT
CCCTTGGCCTTGAGCCACTGAGAACTTCTGGGATATCGCCTCTTCCTCAAGATGGGGAGCTCAC
TCCTCGAACGGGTGAAATCAACATTGCAGTAACAAAAGAATGGTTTATTATTGCCAGTTTTGGC
CTCCTCAGTGCTCTCACACTCTGCTACATGATCATCAGAGCCACAGCTAGCTTGAATGCTAATG
AGGTAGAATGGTTTTGAAGAAGGAAAACACTGCTTTCTGACTGATTGCCTTGAAGGAAAAAAGA
ACCTATTTTTGTGCATCATTTACCAATCATGCCACACAAGCGTTTATTTTTAGTACATTTTATT
TTTTCATAAAATTGCTAATGCCAAAGCTTTGTATTAAAATAAATAAATAATAAAA

hide sequence

RefSeq Acc Id:

XM_039086812 ⟹ XP_038942740

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	10	34,342,835 - 34,429,896 (+)	NCBI

RefSeq Acc Id:

XM_039086813 ⟹ XP_038942741

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	10	34,342,835 - 34,456,048 (+)	NCBI

RefSeq Acc Id:

XM_039086814 ⟹ XP_038942742

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	10	34,342,835 - 34,433,610 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001032747	(Get FASTA)	NCBI Sequence Viewer
	XP_038942740	(Get FASTA)	NCBI Sequence Viewer
	XP_038942741	(Get FASTA)	NCBI Sequence Viewer
	XP_038942742	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI66595	(Get FASTA)	NCBI Sequence Viewer
	AAO31973	(Get FASTA)	NCBI Sequence Viewer
	EDM04244	(Get FASTA)	NCBI Sequence Viewer
	EDM04245	(Get FASTA)	NCBI Sequence Viewer
	EDM04246	(Get FASTA)	NCBI Sequence Viewer
	EDM04247	(Get FASTA)	NCBI Sequence Viewer
	EDM04248	(Get FASTA)	NCBI Sequence Viewer
	EDM04249	(Get FASTA)	NCBI Sequence Viewer
	EDM04250	(Get FASTA)	NCBI Sequence Viewer
	Q6Y290	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001032747 ⟸ NM_001037658
- Peptide Label:	precursor
- UniProtKB:	Q6Y290 (UniProtKB/Swiss-Prot), B2GVA8 (UniProtKB/TrEMBL)
- Sequence:	show sequence MSGAARAGPARLAALALLTCSLWPTRADNASQEYYTALINVTVQEPGRGTPLTFRIDRGRYGLD SPKAEVRGQVLAPLPIHGVADHLGCDPQTRFFVPPNIKQWIALLQRGNCTFKEKISRAAFHNAV AVVIYNNKSKEEPVTMTHPGTGDIIAVMITELRGKDILSYLEKNISVQMTIAVGTRMPPKNFSR GSLVFVSISFIVLMIISSAWLIFYFIQKIRYTNARDRNQRRLGDAAKKAISKLTTRTVKKGDKE TDPDFDHCAVCIESYKQNDVVRVLPCKHVFHKSCVDPWLSEHCTCPMCKLNILKALGIVPNLPC TDNVAFDMERLTRTQAVNRRSALGDLANDSSLGLEPLRTSGISPLPQDGELTPRTGEINIAVTK EWFIIASFGLLSALTLCYMIIRATASLNANEVEWF hide sequence

RefSeq Acc Id:	XP_038942741 ⟸ XM_039086813
- Peptide Label:	isoform X2
- UniProtKB:	A0A8I5XWR0 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038942742 ⟸ XM_039086814
- Peptide Label:	isoform X3
- UniProtKB:	M0R971 (UniProtKB/TrEMBL), A0A8I6ATJ8 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038942740 ⟸ XM_039086812
- Peptide Label:	isoform X1

RefSeq Acc Id:

ENSRNOP00000096952 ⟸ ENSRNOT00000109417

RefSeq Acc Id:

ENSRNOP00000078027 ⟸ ENSRNOT00000099601

RefSeq Acc Id:

ENSRNOP00000097851 ⟸ ENSRNOT00000095035

RefSeq Acc Id:

ENSRNOP00000066033 ⟸ ENSRNOT00000071917

Protein Domains

PA RING-type

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-M0R971-F1-model_v2	AlphaFold	M0R971	1-335	view protein structure
AF-Q6Y290-F1-model_v2	AlphaFold	Q6Y290	1-419	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1562041	AgrOrtholog
BioCyc Gene	G2FUF-25258	BioCyc
Ensembl Genes	ENSRNOG00000046330	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000066033	ENTREZGENE
	ENSRNOP00000066033.3	UniProtKB/TrEMBL
	ENSRNOP00000078027	ENTREZGENE
	ENSRNOP00000078027.1	UniProtKB/TrEMBL
	ENSRNOP00000096952.1	UniProtKB/TrEMBL
	ENSRNOP00000097851	ENTREZGENE
	ENSRNOP00000097851.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000071917	ENTREZGENE
	ENSRNOT00000071917.3	UniProtKB/TrEMBL
	ENSRNOT00000095035	ENTREZGENE
	ENSRNOT00000095035.1	UniProtKB/TrEMBL
	ENSRNOT00000099601	ENTREZGENE
	ENSRNOT00000099601.1	UniProtKB/TrEMBL
	ENSRNOT00000109417.1	UniProtKB/TrEMBL
Gene3D-CATH	3.30.40.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	3.50.30.30	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:5599048	IMAGE-MGC_LOAD
InterPro	PA_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PA_domain	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Znf_RING	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Znf_RING/FYVE/PHD	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:652955	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:188362	IMAGE-MGC_LOAD
NCBI Gene	652955	ENTREZGENE
PANTHER	E3 UBIQUITIN-PROTEIN LIGASE ATL42	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RING-H2 FINGER PROTEIN ATL43	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	PF02225	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	zf-RING_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Rnf130	PhenoGen
PROSITE	ZF_RING_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	RING	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	PA domain	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RING/U-box	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I5XWR0	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6ATJ8	ENTREZGENE, UniProtKB/TrEMBL
	B2GVA8	ENTREZGENE, UniProtKB/TrEMBL
	GOLI_RAT	UniProtKB/Swiss-Prot
	M0R971	ENTREZGENE, UniProtKB/TrEMBL
	Q6Y290	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2014-11-07	Rnf130	ring finger protein 130	LOC652955	goliath	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-02-09	LOC652955	goliath			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD