Advanced Search (OLGA)

Gene: Ifngr1 (interferon gamma receptor 1) Mus musculus

Analyze

Symbol:

Ifngr1

Name:

interferon gamma receptor 1

RGD ID:

1551263

MGI Page

MGI

Description:

Predicted to enable type II interferon receptor activity. Involved in glial cell activation; negative regulation of amyloid-beta clearance; and positive regulation of macromolecule metabolic process. Acts upstream of or within defense response to virus. Predicted to be located in dendrite and vesicle. Predicted to be active in plasma membrane. Is expressed in several structures, including alimentary system; bone; cerebral cortex; female reproductive system; and liver. Used to study osteoporosis. Human ortholog(s) of this gene implicated in asthma; hepatitis B; immunodeficiency 27A; immunodeficiency 27B; and tuberculosis. Orthologous to human IFNGR1 (interferon gamma receptor 1).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

CD119; If; Ifgr; IFN-g; IFN-gamma receptor 1; IFN-gamma-R-alpha; IFN-gamma-R1; IFN-gammaR; Ifngr; INF-g receptor; interferon gamma receptor alpha-chain; interferon-gamma receptor 1; Nk; Nktar

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	IFNGR1 (interferon gamma receptor 1)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Rattus norvegicus (Norway rat):	Ifngr1 (interferon gamma receptor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ifngr1 (interferon gamma receptor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	IFNGR1 (interferon gamma receptor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	IFNGR1 (interferon gamma receptor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ifngr1 (interferon gamma receptor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	IFNGR1 (interferon gamma receptor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	IFNGR1 (interferon gamma receptor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ifngr1 (interferon gamma receptor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Ifngr1 (interferon gamma receptor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Ifngr1 (interferon gamma receptor 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	IFNGR1 (interferon gamma receptor 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	il10ra (interleukin 10 receptor, alpha)	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Danio rerio (zebrafish):	ifngr1l	Alliance	DIOPT (Ensembl Compara\|ZFIN)
Danio rerio (zebrafish):	ifngr1l	Alliance	DIOPT (ZFIN)

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	19,467,697 - 19,485,977 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	19,467,697 - 19,485,977 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	10	19,591,949 - 19,610,229 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	19,591,949 - 19,610,229 (+)	Ensembl			mm10	GRCm38
MGSCv37	10	19,311,764 - 19,330,031 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	10	19,281,403 - 19,300,326 (+)	NCBI		MGSCv36	mm8
Celera	10	19,489,389 - 19,507,558 (+)	NCBI		Celera
Cytogenetic Map	10	A3	NCBI
cM Map	10	8.49	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

arteriosclerosis (ISO)

asthma (IAGP,ISO)

Eczema (IMP,ISO)

endometriosis (ISO)

Experimental Colitis (IMP)

Experimental Liver Cirrhosis (ISO)

genetic disease (ISO)

Helicobacter Infections (ISO)

hepatitis B (ISO)

immunodeficiency 27A (ISO)

immunodeficiency 27B (ISO)

Interferon Gamma, Receptor 1, Deficiency (ISO)

Klebsiella pneumonia (ISO)

lymphocytic choriomeningitis (IMP)

Mycobacterium Infections (ISO)

Myocardial Ischemia (ISO)

Nontuberculous Mycobacterium Infections (ISO)

osteoporosis (IAGP)

Perennial Allergic Rhinitis (ISO)

periodontitis (ISO)

primary immunodeficiency disease (ISO)

pulmonary hypertension (ISO)

Seasonal Allergic Rhinitis (ISO)

tuberculosis (ISO)

uveitis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,1-dichloroethene (EXP)

1,2,4-trimethylbenzene (ISO)

1,2-dimethylhydrazine (EXP)

1-naphthyl isothiocyanate (ISO)

17alpha-ethynylestradiol (EXP)

17beta-estradiol (EXP)

2,2'-Methylenebis(4-methyl-6-tert-butylphenol) (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-hydroxypropanoic acid (ISO)

3H-1,2-dithiole-3-thione (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (EXP)

4-\{[(5,5,8,8-tetramethyl-5,6,7,8-tetrahydronaphthalen-2-yl)carbonyl]amino\}benzoic acid (ISO)

4-hydroxyphenyl retinamide (EXP)

9-cis-retinoic acid (ISO)

acetamide (ISO)

acrolein (EXP,ISO)

acrylamide (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

alpha-pinene (ISO)

ammonium chloride (ISO)

amphetamine (ISO)

amphotericin B (ISO)

antirheumatic drug (ISO)

aripiprazole (ISO)

arsane (ISO)

arsenic atom (ISO)

belinostat (ISO)

benzene (ISO)

benzo[a]pyrene (EXP)

benzo[a]pyrene diol epoxide I (ISO)

benzoates (ISO)

bexarotene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (ISO)

Butylbenzyl phthalate (EXP)

cadmium dichloride (ISO)

cadmium selenide (ISO)

caffeine (ISO)

cannabidiol (EXP,ISO)

carbon nanotube (EXP)

CGP 52608 (ISO)

chlorpyrifos (EXP)

chromium(6+) (ISO)

clozapine (ISO)

copper(II) chloride (ISO)

copper(II) sulfate (ISO)

cyclophosphamide (EXP)

cyclosporin A (ISO)

delta-tocotrienol (EXP)

deoxynivalenol (EXP,ISO)

dexamethasone (EXP)

Dibutyl phosphate (ISO)

dicrotophos (ISO)

diethylstilbestrol (EXP,ISO)

dimethyl sulfoxide (ISO)

diuron (ISO)

divanadium pentaoxide (ISO)

doxorubicin (ISO)

flutamide (ISO)

formaldehyde (ISO)

gallic acid (ISO)

genistein (ISO)

glyphosate (ISO)

gold atom (ISO)

gold(0) (ISO)

GSK-J4 (ISO)

hydrogen peroxide (ISO)

ketamine (ISO)

lead diacetate (ISO)

leflunomide (ISO)

lipopolysaccharide (EXP,ISO)

mercury atom (EXP)

mercury(0) (EXP)

methotrexate (ISO)

methyl methanesulfonate (ISO)

N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine (ISO)

N-nitrosodiethylamine (EXP,ISO)

N-nitrosodimethylamine (ISO)

naphthalenes (ISO)

nickel dichloride (ISO)

ozone (ISO)

paracetamol (EXP,ISO)

pentamidine (ISO)

phenobarbital (EXP)

phenytoin (ISO)

pirinixic acid (EXP)

progesterone (ISO)

quercetin (EXP)

rac-lactic acid (ISO)

Ro 41-5253 (ISO)

silicon dioxide (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (ISO)

sodium stibogluconate (ISO)

Soman (ISO)

temozolomide (ISO)

tetrachloromethane (EXP,ISO)

thiram (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

triphenyl phosphate (ISO)

valproic acid (ISO)

vancomycin (EXP)

vinclozolin (ISO)

zinc sulfate (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

astrocyte activation (IGI)

cell surface receptor signaling pathway via JAK-STAT (ISO)

cytokine-mediated signaling pathway (IBA)

defense response (IEA)

defense response to virus (IMP)

immune system process (IEA)

microglial cell activation (IGI)

negative regulation of amyloid-beta clearance (IGI)

positive regulation of amyloid-beta formation (IGI)

positive regulation of gene expression (IGI)

positive regulation of tumor necrosis factor production (IGI)

response to virus (IEA)

type II interferon-mediated signaling pathway (IEA,ISO)

type III interferon-mediated signaling pathway (IEA,ISO)

Cellular Component

dendrite (ISO)

membrane (IEA,ISO)

plasma membrane (IBA,IEA,ISO)

vesicle (ISO)

Molecular Function

cytokine binding (IEA)

cytokine receptor activity (IBA,IEA)

protein binding (ISO)

type II interferon receptor activity (IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

Chagas disease pathway (IEA)

influenza A pathway (IEA)

Jak-Stat signaling pathway (IEA)

Leishmaniasis pathway (IEA)

measles pathway (IEA)

toxoplasmosis pathway (IEA)

tuberculosis pathway (IEA)

type II interferon signaling pathway (ISO)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

abnormal apolipoprotein level (IAGP)

abnormal chemokine level (IAGP)

abnormal circulating chemokine level (IAGP)

abnormal cytotoxic T cell physiology (IAGP)

abnormal depression-related behavior (IAGP)

abnormal eye morphology (IEA)

abnormal hematopoietic system physiology (IAGP)

abnormal immunoglobulin level (IAGP)

abnormal lymphopoiesis (IAGP)

abnormal maternal decidual layer morphology (IAGP)

abnormal myelination (IAGP)

abnormal osteoclast differentiation (IAGP)

abnormal osteoclast physiology (IAGP)

abnormal pain threshold (IAGP)

abnormal response to infection (IAGP)

abnormal skin morphology (IEA)

abnormal tumor susceptibility (IAGP)

abnormal tumor vascularization (IAGP)

abnormal uterine NK cell morphology (IAGP)

abnormal uterine NK cell physiology (IAGP)

abnormal uterus morphology (IAGP)

abnormal vascular endothelial cell physiology (IAGP)

abnormal vitreous body morphology (IEA)

aortitis (IAGP)

arteritis (IAGP)

cataract (IEA)

decreased anti-nuclear antigen antibody level (IAGP)

decreased autoantibody level (IAGP)

decreased bone marrow cell number (IAGP)

decreased bone mineral density (IAGP)

decreased bone mineralization (IAGP)

decreased bone ossification (IAGP)

decreased bone resorption (IAGP)

decreased bone trabecula number (IAGP)

decreased bone volume (IAGP)

decreased CD4-positive, alpha-beta T cell number (IAGP)

decreased CD8-positive, alpha-beta T cell number (IAGP)

decreased circulating interferon-gamma level (IAGP)

decreased circulating interleukin-12 level (IAGP)

decreased circulating osteocalcin level (IAGP)

decreased circulating tumor necrosis factor level (IAGP)

decreased compact bone thickness (IAGP)

decreased IgA level (IAGP)

decreased IgG level (IAGP)

decreased IgG2a level (IAGP)

decreased IgG2b level (IAGP)

decreased IgG3 level (IAGP)

decreased IgM level (IAGP)

decreased interferon-gamma secretion (IAGP)

decreased interleukin-12b secretion (IAGP)

decreased lymphocyte cell number (IAGP)

decreased macrophage cell number (IEA)

decreased metastatic potential (IAGP)

decreased osteoblast cell number (IAGP)

decreased osteocyte number (IAGP)

decreased physiological sensitivity to xenobiotic (IAGP)

decreased susceptibility to atherosclerosis (IAGP)

decreased susceptibility to bacterial infection (IAGP)

decreased susceptibility to endotoxin shock (IAGP)

decreased susceptibility to experimental autoimmune myasthenia gravis (IAGP)

decreased susceptibility to systemic lupus erythematosus (IAGP)

decreased trabecular bone thickness (IAGP)

decreased tumor necrosis factor secretion (IEA)

glomerulonephritis (IAGP)

impaired hematopoiesis (IEA)

impaired osteoblast differentiation (IAGP)

increased B cell number (IEA)

increased circulating calcium level (IAGP)

increased circulating cholesterol level (IAGP)

increased circulating interferon-gamma level (IAGP)

increased circulating interleukin-1 beta level (IAGP)

increased circulating interleukin-6 level (IAGP)

increased circulating phospholipid level (IAGP)

increased hepatocyte proliferation (IAGP)

increased IgG level (IAGP)

increased IgG1 level (IAGP)

increased interferon-gamma secretion (IAGP)

increased interleukin-6 secretion (IAGP)

increased metastatic potential (IAGP)

increased osteoclast cell number (IAGP)

increased skeletal tumor incidence (IAGP)

increased splenocyte proliferation (IAGP)

increased susceptibility to bacterial infection (IAGP)

increased susceptibility to bacterial infection induced morbidity/mortality (IAGP)

increased susceptibility to experimental autoimmune encephalomyelitis (IAGP)

increased susceptibility to experimental autoimmune uveoretinitis (IAGP)

increased susceptibility to graft versus host disease (IAGP)

increased susceptibility to Herpesvirales infection (IAGP)

increased susceptibility to Herpesvirales infection induced morbidity/mortality (IAGP)

increased susceptibility to induced arthritis (IAGP)

increased susceptibility to induced morbidity/mortality (IAGP)

increased susceptibility to parasitic infection (IAGP)

increased susceptibility to Poxviridae infection (IAGP)

increased susceptibility to Riboviria infection (IAGP)

increased susceptibility to Riboviria infection induced morbidity/mortality (IAGP)

increased susceptibility to systemic lupus erythematosus (IAGP)

increased susceptibility to Togaviridae infection (IAGP)

increased tumor incidence (IAGP)

increased tumor necrosis factor secretion (IAGP)

increased urine protein level (IAGP)

increased uterine NK cell number (IAGP)

liver abscess (IAGP)

osteoporosis (IAGP)

preweaning lethality, incomplete penetrance (IEA)

salivary gland inflammation (IAGP)

small lymph nodes (IAGP)

spleen hypoplasia (IAGP)

References

References - curated

#	Reference Title	Reference Citation
1.	A novel single-nucleotide substitution, Leu 467 Pro, in the interferon-gamma receptor 1 gene associated with allergic diseases.	Aoki M, etal., Int J Mol Med. 2003 Aug;12(2):185-91.
2.	Cytokine, C-Reactive Protein, and Heat Shock Protein mRNA Expression Levels in Patients with Active Behçet's Uveitis.	Balkan E, etal., Med Sci Monit. 2018 Mar 13;24:1511-1516. doi: 10.12659/msm.907918.
3.	Clinical features of dominant and recessive interferon gamma receptor 1 deficiencies.	Dorman SE, etal., Lancet. 2004 Dec 11-17;364(9451):2113-21.
4.	Mice deficient in STAT1 but not STAT2 or IRF9 develop a lethal CD4+ T-cell-mediated disease following infection with lymphocytic choriomeningitis virus.	Hofer MJ, etal., J Virol. 2012 Jun;86(12):6932-46. doi: 10.1128/JVI.07147-11. Epub 2012 Apr 11.
5.	Human atopic dermatitis complicated by eczema herpeticum is associated with abnormalities in IFN-gamma response.	Leung DY, etal., J Allergy Clin Immunol. 2011 Apr;127(4):965-73.e1-5.
6.	MGDs mouse GO annotations	MGD data from the GO Consortium
7.	MGD IEA	MGD IEA
8.	A mutation in the interferon-gamma-receptor gene and susceptibility to mycobacterial infection.	Newport MJ, etal., N Engl J Med. 1996 Dec 26;335(26):1941-9.
9.	Interferon gamma in the etiology of atherosclerosis and periodontitis.	Niedzielska I and Cierpka S, Thromb Res. 2010 Oct;126(4):324-7. Epub 2010 Jul 22.
10.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
11.	Limited systemic sclerosis patients with pulmonary arterial hypertension show biomarkers of inflammation and vascular injury.	Pendergrass SA, etal., PLoS One. 2010 Aug 17;5(8):e12106.
12.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
13.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
14.	Noncanonical Effects of IRF9 in Intestinal Inflammation: More than Type I and Type III Interferons.	Rauch I, etal., Mol Cell Biol. 2015 Jul;35(13):2332-43. doi: 10.1128/MCB.01498-14. Epub 2015 Apr 27.
15.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
16.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
17.	Partial recessive IFN-gammaR1 deficiency: genetic, immunological and clinical features of 14 patients from 11 kindreds.	Sologuren I, etal., Hum Mol Genet. 2011 Apr 15;20(8):1509-23. Epub 2011 Jan 25.
18.	NOS2A, TLR4, and IFNGR1 interactions influence pulmonary tuberculosis susceptibility in African-Americans.	Velez DR, etal., Hum Genet. 2009 Nov;126(5):643-53. Epub 2009 Jul 3.
19.	Identification of an IFN-gamma/mast cell axis in a mouse model of chronic asthma.	Yu M, etal., J Clin Invest. 2011 Aug;121(8):3133-43.
20.	Dynamic immune status analysis of peripheral blood mononuclear cells in patients with Klebsiella pneumoniae bloodstream infection sepsis using single-cell RNA sequencing.	Zhang S, etal., Front Immunol. 2024 Jun 5;15:1380211. doi: 10.3389/fimmu.2024.1380211. eCollection 2024.

Additional References at PubMed

PMID:1981053	PMID:2137461	PMID:2530216	PMID:2530582	PMID:2531896	PMID:2532365	PMID:2852162	PMID:2952646	PMID:7499845	PMID:7507352	PMID:7537305	PMID:7561088
PMID:7584155	PMID:7609046	PMID:7650382	PMID:7722464	PMID:7759999	PMID:7777519	PMID:7843255	PMID:7869054	PMID:7890167	PMID:7959748	PMID:8009221	PMID:8051408
PMID:8163930	PMID:8182339	PMID:8188645	PMID:8341679	PMID:8376946	PMID:8454850	PMID:8456301	PMID:8609383	PMID:8613694	PMID:8617956	PMID:8752933	PMID:8832969
PMID:8871615	PMID:8875885	PMID:8889548	PMID:8943375	PMID:8985346	PMID:8990382	PMID:9064329	PMID:9143700	PMID:9144077	PMID:9164949	PMID:9164971	PMID:9164973
PMID:9164974	PMID:9169506	PMID:9382883	PMID:9414161	PMID:9485200	PMID:9521083	PMID:9525580	PMID:9558072	PMID:9558103	PMID:9558118	PMID:9686622	PMID:9687534
PMID:9692883	PMID:9733817	PMID:9754555	PMID:9759875	PMID:9820533	PMID:9820538	PMID:10072530	PMID:10190896	PMID:10201893	PMID:10231581	PMID:10233935	PMID:10233988
PMID:10329607	PMID:10349636	PMID:10375558	PMID:10411532	PMID:10456884	PMID:10457211	PMID:10477624	PMID:10528171	PMID:10553050	PMID:10562320	PMID:10575223	PMID:10603416
PMID:10640606	PMID:10640742	PMID:10677524	PMID:10679118	PMID:10714556	PMID:10753500	PMID:10754318	PMID:10756011	PMID:10761931	PMID:10779789	PMID:10820374	PMID:10820397
PMID:10878371	PMID:10894167	PMID:10898501	PMID:10899912	PMID:10982374	PMID:11034357	PMID:11035712	PMID:11042159	PMID:11076861	PMID:11119576	PMID:11136679	PMID:11141495
PMID:11160143	PMID:11160342	PMID:11217851	PMID:11323675	PMID:11349038	PMID:11380074	PMID:11390995	PMID:11395389	PMID:11412382	PMID:11507186	PMID:11544329	PMID:11559791
PMID:11564783	PMID:11705897	PMID:11714812	PMID:11745345	PMID:11756986	PMID:11812737	PMID:11823519	PMID:11870620	PMID:11884466	PMID:11973313	PMID:12045246	PMID:12421924
PMID:12429207	PMID:12447873	PMID:12452826	PMID:12466851	PMID:12477932	PMID:12504878	PMID:12702051	PMID:12707316	PMID:12811839	PMID:12885563	PMID:14558106	PMID:14607913
PMID:14684702	PMID:14688355	PMID:14707072	PMID:14961564	PMID:14976252	PMID:14981113	PMID:14990690	PMID:15016885	PMID:15047800	PMID:15128825	PMID:15153508	PMID:15265950
PMID:15300247	PMID:15343387	PMID:15351783	PMID:15351786	PMID:15386021	PMID:15505791	PMID:15521020	PMID:15522878	PMID:15534227	PMID:15618214	PMID:15654326	PMID:15664785
PMID:15731080	PMID:15765122	PMID:15778340	PMID:15829401	PMID:15902435	PMID:15905519	PMID:15905569	PMID:15908387	PMID:15944263	PMID:15944286	PMID:15951814	PMID:16002714
PMID:16027239	PMID:16047338	PMID:16081822	PMID:16116201	PMID:16123129	PMID:16141072	PMID:16141073	PMID:16148142	PMID:16177303	PMID:16200070	PMID:16237051	PMID:16254350
PMID:16393956	PMID:16428767	PMID:16476058	PMID:16493042	PMID:16517735	PMID:16541469	PMID:16585541	PMID:16651614	PMID:16670325	PMID:16709859	PMID:16709871	PMID:16714568
PMID:16751369	PMID:16769113	PMID:16878177	PMID:16880257	PMID:16886058	PMID:16888002	PMID:16906167	PMID:16920966	PMID:16954498	PMID:16955143	PMID:16966404	PMID:16987553
PMID:16988272	PMID:17005698	PMID:17035338	PMID:17045255	PMID:17052246	PMID:17060376	PMID:17088434	PMID:17173138	PMID:17200147	PMID:17208926	PMID:17255335	PMID:17309822
PMID:17312104	PMID:17312160	PMID:17334371	PMID:17339445	PMID:17372191	PMID:17376910	PMID:17442959	PMID:17449800	PMID:17460760	PMID:17493690	PMID:17510508	PMID:17534845
PMID:17548597	PMID:17575072	PMID:17603494	PMID:17610927	PMID:17617585	PMID:17617612	PMID:17675470	PMID:17675507	PMID:17682046	PMID:17697713	PMID:17709533	PMID:17846149
PMID:17875636	PMID:17902170	PMID:17918178	PMID:17935177	PMID:17938288	PMID:17950290	PMID:17955445	PMID:18059273	PMID:18082272	PMID:18178806	PMID:18178823	PMID:18198214
PMID:18232731	PMID:18250439	PMID:18250481	PMID:18292563	PMID:18322213	PMID:18322226	PMID:18332178	PMID:18339305	PMID:18354038	PMID:18354166	PMID:18383042	PMID:18398511
PMID:18412158	PMID:18436582	PMID:18438414	PMID:18490714	PMID:18495762	PMID:18545704	PMID:18552211	PMID:18562532	PMID:18566384	PMID:18566423	PMID:18621802	PMID:18644971
PMID:18658050	PMID:18684919	PMID:18713999	PMID:18825747	PMID:18852291	PMID:18941226	PMID:19006695	PMID:19059914	PMID:19079171	PMID:19124751	PMID:19136699	PMID:19237526
PMID:19244111	PMID:19258593	PMID:19265151	PMID:19330008	PMID:19339614	PMID:19349465	PMID:19372249	PMID:19380717	PMID:19384870	PMID:19406986	PMID:19409816	PMID:19412181
PMID:19494319	PMID:19502584	PMID:19531651	PMID:19535638	PMID:19540914	PMID:19542364	PMID:19553527	PMID:19561106	PMID:19561320	PMID:19564349	PMID:19637196	PMID:19637226
PMID:19734231	PMID:19768696	PMID:19778991	PMID:19828695	PMID:19846867	PMID:19898495	PMID:19923276	PMID:20049875	PMID:20061409	PMID:20064452	PMID:20079668	PMID:20089923
PMID:20118280	PMID:20130212	PMID:20156971	PMID:20164422	PMID:20348925	PMID:20386712	PMID:20418876	PMID:20431620	PMID:20436484	PMID:20519645	PMID:20534530	PMID:20535209
PMID:20543102	PMID:20547544	PMID:20566741	PMID:20584765	PMID:20592088	PMID:20610645	PMID:20610738	PMID:20637658	PMID:20690180	PMID:20696947	PMID:20926559	PMID:20935648
PMID:20956347	PMID:20980634	PMID:21041723	PMID:21149601	PMID:21160043	PMID:21191075	PMID:21262564	PMID:21267068	PMID:21308779	PMID:21359196	PMID:21379341	PMID:21444117
PMID:21464086	PMID:21467996	PMID:21518784	PMID:21518864	PMID:21536945	PMID:21551232	PMID:21613619	PMID:21622562	PMID:21633090	PMID:21677750	PMID:21709234	PMID:21731484
PMID:21734055	PMID:21829463	PMID:21835954	PMID:21862448	PMID:21873526	PMID:21873527	PMID:21873635	PMID:21905879	PMID:21915277	PMID:21926986	PMID:21931549	PMID:21949815
PMID:21967766	PMID:21984703	PMID:22056381	PMID:22075702	PMID:22116827	PMID:22130542	PMID:22130799	PMID:22131327	PMID:22180630	PMID:22194881	PMID:22195750	PMID:22205032
PMID:22238311	PMID:22266282	PMID:22312128	PMID:22392138	PMID:22396045	PMID:22407920	PMID:22419801	PMID:22461501	PMID:22474394	PMID:22509320	PMID:22522653	PMID:22541070
PMID:22566567	PMID:22673957	PMID:22685317	PMID:22696658	PMID:22706089	PMID:22711893	PMID:22727490	PMID:22740092	PMID:22749354	PMID:22761313	PMID:22778394	PMID:22815273
PMID:22821964	PMID:22836578	PMID:22837486	PMID:22840842	PMID:22865049	PMID:22902947	PMID:22908290	PMID:22930199	PMID:22933295	PMID:22960221	PMID:22972985	PMID:22973027
PMID:22981537	PMID:23041064	PMID:23125412	PMID:23159227	PMID:23160153	PMID:23233724	PMID:23242416	PMID:23248310	PMID:23285134	PMID:23341634	PMID:23470624	PMID:23487025
PMID:23523972	PMID:23526822	PMID:23527208	PMID:23635775	PMID:23656736	PMID:23671208	PMID:23733879	PMID:23737812	PMID:23762028	PMID:23780878	PMID:23785507	PMID:23921569
PMID:23922396	PMID:23935197	PMID:23960239	PMID:23976880	PMID:23979161	PMID:23980098	PMID:23986582	PMID:23999498	PMID:24027334	PMID:24038087	PMID:24048899	PMID:24101690
PMID:24136200	PMID:24204622	PMID:24278312	PMID:24284323	PMID:24307730	PMID:24324806	PMID:24353266	PMID:24391492	PMID:24425713	PMID:24523322	PMID:24523506	PMID:24574394
PMID:24600037	PMID:24608040	PMID:24614103	PMID:24646741	PMID:24741106	PMID:24778443	PMID:24790153	PMID:24842370	PMID:24931122	PMID:25049359	PMID:25079358	PMID:25133679
PMID:25148025	PMID:25242146	PMID:25268627	PMID:25307346	PMID:25392217	PMID:25404360	PMID:25480562	PMID:25501630	PMID:25622543	PMID:25829541	PMID:25908663	PMID:25938762
PMID:25965582	PMID:25968334	PMID:26038559	PMID:26066746	PMID:26070118	PMID:26138432	PMID:26220255	PMID:26292317	PMID:26321127	PMID:26410627	PMID:26491068	PMID:26511769
PMID:26595887	PMID:26595888	PMID:26670386	PMID:26689285	PMID:26720279	PMID:26789923	PMID:26808628	PMID:26831100	PMID:26912623	PMID:27022155	PMID:27069112	PMID:27069113
PMID:27085137	PMID:27139489	PMID:27217537	PMID:27286456	PMID:27294527	PMID:27295349	PMID:27341123	PMID:27373493	PMID:27384869	PMID:27440896	PMID:27470712	PMID:27545711
PMID:27561205	PMID:27569724	PMID:27570112	PMID:27667683	PMID:27667782	PMID:27681121	PMID:27792766	PMID:27808089	PMID:27848952	PMID:27926863	PMID:27927647	PMID:27935860
PMID:27940658	PMID:27974562	PMID:27982126	PMID:28009279	PMID:28012161	PMID:28034913	PMID:28199846	PMID:28207896	PMID:28222903	PMID:28233863	PMID:28273457	PMID:28418194
PMID:28445461	PMID:28542482	PMID:28552348	PMID:28604719	PMID:28607116	PMID:28614370	PMID:28619948	PMID:28666115	PMID:28673995	PMID:28723893	PMID:28742068	PMID:28772166
PMID:28808159	PMID:28827716	PMID:28860338	PMID:28864260	PMID:28887429	PMID:28924035	PMID:28982388	PMID:28986419	PMID:29101363	PMID:29117241	PMID:29196213	PMID:29212904
PMID:29233822	PMID:29277541	PMID:29324904	PMID:29328912	PMID:29378173	PMID:29436413	PMID:29753658	PMID:29753791	PMID:29771971	PMID:29791904	PMID:29805094	PMID:29858012
PMID:29907154	PMID:29925850	PMID:29958802	PMID:29970473	PMID:29972776	PMID:30002446	PMID:30021146	PMID:30021162	PMID:30084830	PMID:30216653	PMID:30300141	PMID:30426505
PMID:30433869	PMID:30442932	PMID:30457201	PMID:30463976	PMID:30552023	PMID:30618602	PMID:30675064	PMID:30737146	PMID:30796216	PMID:30811982	PMID:30827680	PMID:30858342
PMID:30886419	PMID:30923196	PMID:30962403	PMID:31015500	PMID:31042472	PMID:31076359	PMID:31110314	PMID:31130511	PMID:31231046	PMID:31235930	PMID:31243154	PMID:31346084
PMID:31350177	PMID:31358656	PMID:31400073	PMID:31542340	PMID:31585982	PMID:31591168	PMID:31594939	PMID:31719183	PMID:31732166	PMID:31775046	PMID:31825834	PMID:31896593
PMID:31900342	PMID:31937766	PMID:31959973	PMID:31964735	PMID:31980536	PMID:32047224	PMID:32094187	PMID:32123346	PMID:32161194	PMID:32209467	PMID:32269339	PMID:32298657
PMID:32325033	PMID:32441445	PMID:32460031	PMID:32528465	PMID:32553273	PMID:32554809	PMID:32647184	PMID:32673357	PMID:32690660	PMID:32849556	PMID:32929218	PMID:32994273
PMID:32997686	PMID:33040466	PMID:33042133	PMID:33101303	PMID:33125891	PMID:33147451	PMID:33149141	PMID:33158943	PMID:33173007	PMID:33181139	PMID:33193372	PMID:33315931
PMID:33357430	PMID:33408417	PMID:33472827	PMID:33510029	PMID:33526922	PMID:33558374	PMID:33574087	PMID:33593983	PMID:33630019	PMID:33705489	PMID:33743191	PMID:33830176
PMID:33837065	PMID:33912160	PMID:33976173	PMID:34015257	PMID:34183650	PMID:34249474	PMID:34267374	PMID:34321999	PMID:34398180	PMID:34423779	PMID:34428519	PMID:34516896
PMID:34529935	PMID:34671159	PMID:34715017	PMID:34730391	PMID:34798063	PMID:34847356	PMID:34912121	PMID:35075105	PMID:35089323	PMID:35102344	PMID:35133985	PMID:35139352
PMID:35143611	PMID:35148840	PMID:35169077	PMID:35173036	PMID:35181694	PMID:35196366	PMID:35235782	PMID:35476975	PMID:35508110	PMID:35524140	PMID:35617965	PMID:35671274
PMID:35696583	PMID:35702569	PMID:35732121	PMID:35800765	PMID:35877763	PMID:35911733	PMID:35931226	PMID:36038291	PMID:36056542	PMID:36073546	PMID:36121866	PMID:36370710
PMID:36384123	PMID:36417857	PMID:36634189	PMID:36658158	PMID:36715543	PMID:36732332	PMID:36732425	PMID:36736322	PMID:36802427	PMID:36868479	PMID:36881506	PMID:36921064
PMID:37083328	PMID:37100211	PMID:37149862	PMID:37188813	PMID:37269286	PMID:37291336	PMID:37310859	PMID:37347796	PMID:37392737	PMID:37402168	PMID:37406138	PMID:37413990
PMID:37428916	PMID:37480848	PMID:37562754	PMID:37572540	PMID:37675632	PMID:37699392	PMID:37749080	PMID:37771584	PMID:37812390	PMID:37828609	PMID:37872155	PMID:37922340
PMID:38079541	PMID:38086420	PMID:38086794	PMID:38164135	PMID:38166152	PMID:38355793	PMID:38392861	PMID:38430523	PMID:38580748	PMID:38657065	PMID:38701091	PMID:38718306
PMID:38743761	PMID:38833371	PMID:38839984	PMID:38858387	PMID:38862796	PMID:38936516	PMID:38980038	PMID:39058762	PMID:39121848	PMID:39159381	PMID:39168064	PMID:39196893
PMID:39213029	PMID:39395421	PMID:39570374	PMID:39580798	PMID:39604443	PMID:39669426	PMID:39708807	PMID:39813317	PMID:39987156	PMID:40387177	PMID:40543512	PMID:40562879
PMID:40706591	PMID:40885187

Genomics

Comparative Map Data

Ifngr1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	19,467,697 - 19,485,977 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	19,467,697 - 19,485,977 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	10	19,591,949 - 19,610,229 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	19,591,949 - 19,610,229 (+)	Ensembl			mm10	GRCm38
MGSCv37	10	19,311,764 - 19,330,031 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	10	19,281,403 - 19,300,326 (+)	NCBI		MGSCv36	mm8
Celera	10	19,489,389 - 19,507,558 (+)	NCBI		Celera
Cytogenetic Map	10	A3	NCBI
cM Map	10	8.49	NCBI

IFNGR1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	137,197,484 - 137,219,385 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	137,197,483 - 137,219,449 (-)	Ensembl			hg38	GRCh38
GRCh37	6	137,518,621 - 137,540,522 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	137,560,315 - 137,582,200 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	6	137,560,314 - 137,582,200	NCBI
Celera	6	138,258,636 - 138,280,689 (-)	NCBI		Celera
Cytogenetic Map	6	q23.3	NCBI
HuRef	6	135,080,667 - 135,102,743 (-)	NCBI		HuRef
CHM1_1	6	137,780,861 - 137,802,819 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	6	138,385,847 - 138,407,878 (-)	NCBI		T2T-CHM13v2.0

Ifngr1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	16,152,811 - 16,171,439 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	16,152,879 - 16,171,437 (+)	Ensembl				GRCr8
mRatBN7.2	1	14,333,167 - 14,351,799 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	14,333,187 - 14,351,785 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	14,089,865 - 14,108,414 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	20,091,744 - 20,110,287 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	14,313,419 - 14,331,949 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	15,062,380 - 15,080,815 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	15,062,432 - 15,080,907 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	16,607,955 - 16,626,390 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	14,846,369 - 14,864,804 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	12,776,802 - 12,795,237 (+)	NCBI		Celera
RGSC_v3.1	1	14,846,430 - 14,864,866 (+)	NCBI
Cytogenetic Map	1	p12	NCBI

Ifngr1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955436	22,183,311 - 22,198,291 (+)	Ensembl
ChiLan1.0	NW_004955436	22,183,318 - 22,199,013 (+)	NCBI	ChiLan1.0	ChiLan1.0

IFNGR1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	157,164,498 - 157,186,793 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	155,063,323 - 155,086,123 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	134,958,270 - 134,980,560 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	139,045,821 - 139,068,053 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	139,045,821 - 139,068,053 (-)	Ensembl			panPan2	panpan1.1

IFNGR1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	29,646,776 - 29,669,669 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	29,647,552 - 29,669,578 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	30,529,308 - 30,552,201 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	29,808,268 - 29,831,164 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	29,806,103 - 29,831,092 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	29,692,670 - 29,715,561 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	29,577,754 - 29,600,649 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	29,877,088 - 29,899,982 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Ifngr1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	124,740,584 - 124,766,561 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936560	4,519,474 - 4,545,796 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936560	4,519,858 - 4,545,763 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

IFNGR1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	27,037,165 - 27,061,093 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	1	27,037,151 - 27,061,095 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	30,388,355 - 30,409,360 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

IFNGR1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	13	36,203,038 - 36,224,039 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	13	36,203,004 - 36,222,542 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666040	8,393,656 - 8,415,178 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ifngr1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624886	618,289 - 642,928 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624886	618,372 - 640,954 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Ifngr1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	2	216,963,207 - 216,981,834 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Ifngr1
648 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	846
Count of miRNA genes:	529
Interacting mature miRNAs:	613
Transcripts:	ENSMUST00000020188, ENSMUST00000110989, ENSMUST00000164591, ENSMUST00000168074, ENSMUST00000171772, ENSMUST00000172253
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCm39)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
11532718	Sluc44f_m	susceptibility to lung cancer 44f (mouse)					10	1	26289265	Mouse
11532717	Sluc44g_m	susceptibility to lung cancer 44g (mouse)					10	1	26289265	Mouse
1300881	Sluc29_m	susceptibility to lung cancer 29 (mouse)			Not determined		10	1	26289265	Mouse
12879494	Facq1_m	fear acquisition QTL 1 (mouse)					10	1	31279130	Mouse
39128215	Lwq17_m	liver weight QTL 17 (mouse)					10	12704051	84079784	Mouse
1300759	Geot_m	geotaxia (mouse)			Not determined		10	1	26289265	Mouse
1558865	Lith21_m	lithogenic gene 21 (mouse)			Not determined		10	8525003	42525126	Mouse
15039341	Nmrs28_m	NAFLD-associated magnetic resonance shift 28 (mouse)					10	351001	34351001	Mouse
4141943	W6q6_m	weight 6 weeks QTL 6 (mouse)			Not determined			12704051	84079784	Mouse
27226772	Tibl13_m	tibia length 13, 10 week (mouse)					10	18875748	129635869	Mouse
1357656	Hrtq3_m	heart weight QTL 3 (mouse)			Not determined		10	12704051	84079784	Mouse
4142380	W3q11_m	weight 3 weeks QTL 11 (mouse)			Not determined			12704051	84079784	Mouse
1357825	Kidpq2_m	kidney weight percentage QTL 2 (mouse)			Not determined		10	12704051	84079784	Mouse
1300997	Eae15_m	susceptibility to experimental allergic encephalomyelitis 15 (mouse)			Not determined		10	4408154	38408276	Mouse
1301386	Sysbp1_m	systolic blood pressure 1 (mouse)			Not determined		10	10108265	87401095	Mouse
11532725	Sluc44b_m	susceptibility to lung cancer 44b (mouse)					10	1	26289265	Mouse
1301129	Alcp15_m	alcohol preference locus 15 (mouse)			Not determined		10	9890264	43890391	Mouse
10755518	Chol16_m	cholesterol 16 (mouse)					10	18915043	52915043	Mouse
11532724	Sluc44c_m	susceptibility to lung cancer 44c (mouse)					10	1	26289265	Mouse
1301448	Pas11_m	pulmonary adenoma susceptibility 11 (mouse)			Not determined		10	9890264	43890391	Mouse
11532723	Sluc44d_m	susceptibility to lung cancer 44d (mouse)					10	1	26289265	Mouse
11532722	Sluc44e_m	susceptibility to lung cancer 44e (mouse)					10	1	26289265	Mouse
11532721	Sluc44_m	susceptibility to lung cancer 44 (mouse)					10	1	26289265	Mouse
1558857	Igan1_m	IgA nephropathy 1 (mouse)			Not determined		10	17718313	29704155	Mouse
11532720	Sluc44a_m	susceptibility to lung cancer 44a (mouse)					10	1	26289265	Mouse
1302092	Ath11_m	atherosclerosis 11 (mouse)			Not determined		10	6151945	58693521	Mouse
1302067	Scc9_m	colon tumor susceptibility 9 (mouse)			Not determined		10	18259333	125575232	Mouse
1357813	Ath20_m	atherosclerosis 20 (mouse)			Not determined		10	3283185	37283334	Mouse
1300790	Pgia6_m	proteoglycan induced arthritis 6 (mouse)			Not determined		10	3810171	37810295	Mouse
1302133	Alcp16_m	alcohol preference locus 16 (mouse)			Not determined		10	9890264	43890391	Mouse
11533917	Mts2_m	mammary tumor susceptibility 2 (mouse)					10	1	26289265	Mouse
13208570	Bmiq9_m	body mass index QTL 9 (mouse)					10	12875744	24875898	Mouse
1301796	Mop2_m	morphine preference 2 (mouse)			Not determined		10	9289119	29028424	Mouse
13208561	Wght8_m	weight 8 (mouse)					10	4950000	43875996	Mouse
1357740	Obsty3_m	obesity 3 (mouse)			Not determined		10	8235478	116190980	Mouse
4141956	Egq7_m	early growth QTL 7 (mouse)			Not determined			12704051	84079784	Mouse
1357864	Scfpq1_m	subcutaneous fat pad percentage QTL 1 (mouse)			Not determined		10	12704051	84079784	Mouse
4142272	W10q5_m	weight 10 weeks QTL 5 (mouse)			Not determined			12704051	84079784	Mouse

Markers in Region

M26711

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	10	19,609,865 - 19,609,983	UniSTS	GRCm38
MGSCv37	10	19,329,671 - 19,329,789	UniSTS	GRCm37
Celera	10	19,507,197 - 19,507,315	UniSTS
Cytogenetic Map	10	A3	UniSTS
cM Map	10	15.0	UniSTS
Whitehead/MRC_RH	10	208.4	UniSTS

PMC96762P1

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	10	19,606,232 - 19,606,412	UniSTS	GRCm38
MGSCv37	10	19,326,038 - 19,326,218	UniSTS	GRCm37
Celera	10	19,503,564 - 19,503,744	UniSTS
Cytogenetic Map	10	A3	UniSTS
cM Map	10	15.0	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_010511	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC153862	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF128216	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF128217	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK087525	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK150503	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK151079	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK152085	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK152384	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK153084	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK153347	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK159359	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK159660	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK159839	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK169593	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY157836	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY157837	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC132599	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC138617	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BU700524	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BY309097	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BY754033	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466562	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	J05265	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M25764	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M26711	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M28233	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M28995	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U05960	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSMUST00000020188 ⟹ ENSMUSP00000020188

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	10	19,467,697 - 19,485,977 (+)	Ensembl
GRCm38.p6 Ensembl	10	19,591,949 - 19,610,229 (+)	Ensembl

Ensembl Acc Id:

ENSMUST00000110989

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	10	19,467,706 - 19,473,599 (+)	Ensembl
GRCm38.p6 Ensembl	10	19,591,958 - 19,597,851 (+)	Ensembl

Ensembl Acc Id:

ENSMUST00000164591 ⟹ ENSMUSP00000129309

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	10	19,467,821 - 19,485,977 (+)	Ensembl
GRCm38.p6 Ensembl	10	19,592,073 - 19,610,229 (+)	Ensembl

Ensembl Acc Id:

ENSMUST00000168074

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	10	19,481,667 - 19,485,004 (+)	Ensembl
GRCm38.p6 Ensembl	10	19,605,919 - 19,609,256 (+)	Ensembl

Ensembl Acc Id:

ENSMUST00000171772

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	10	19,467,801 - 19,477,151 (+)	Ensembl
GRCm38.p6 Ensembl	10	19,592,053 - 19,601,403 (+)	Ensembl

Ensembl Acc Id:

ENSMUST00000172253

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	10	19,467,810 - 19,479,522 (+)	Ensembl
GRCm38.p6 Ensembl	10	19,592,062 - 19,603,774 (+)	Ensembl

RefSeq Acc Id:

NM_010511 ⟹ NP_034641

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	10	19,467,697 - 19,485,977 (+)	NCBI
GRCm38	10	19,591,949 - 19,610,229 (+)	NCBI
MGSCv37	10	19,311,764 - 19,330,031 (+)	RGD
Celera	10	19,489,389 - 19,507,558 (+)	RGD
cM Map	10		ENTREZGENE

Sequence:

show sequence

TCAAGCTTTGGTTTTGGCCCCACCCAGCTCCCCGGCAGGCCGCTTGCGGACTTGGCGACTAGTC
TGCGGCGGACGTGACGCCAAGGCCAGGCCACGGGCAGCGCGGGTCCCCTGTCAGAGGTGTCCCT
CGCGCAGGAATGGGCCCGCAGGCGGCAGCTGGCAGGATGATTCTGCTGGTGGTCCTGATGCTGT
CTGCGAAGGTCGGGAGTGGAGCTTTGACGAGCACTGAGGATCCTGAGCCTCCCTCGGTGCCTGT
ACCGACGAATGTTCTAATTAAGTCTTATAACTTGAACCCTGTCGTATGCTGGGAATACCAGAAC
ATGTCACAGACTCCTATTTTTACTGTACAGGTAAAGGTGTATTCGGGTTCCTGGACTGATTCCT
GCACCAACATTTCTGATCATTGTTGTAATATCTATGAACAAATTATGTATCCTGATGTATCTGC
CTGGGCCAGAGTTAAAGCTAAGGTTGGACAAAAAGAATCTGACTATGCACGGTCAAAAGAGTTC
CTTATGTGCCTAAAGGGAAAGGTCGGGCCCCCTGGCCTGGAGATCAGGAGGAAGAAGGAAGAAC
AGCTCTCCGTCCTCGTATTTCACCCTGAAGTCGTTGTGAATGGAGAGAGCCAGGGAACCATGTT
TGGTGACGGGAGCACCTGTTACACATTCGACTATACTGTGTATGTGGAGCATAACCGGAGTGGG
GAGATCCTACATACGAAACATACGGTCGAAAAAGAAGAGTGTAATGAGACTCTGTGTGAGTTAA
ACATCTCAGTATCCACACTGGATTCCAGATATTGTATTTCAGTAGACGGAATCTCATCTTTCTG
GCAAGTTAGAACAGAAAAATCGAAAGACGTCTGTATCCCTCCTTTCCATGATGACAGAAAGGAT
TCAATTTGGATTCTGGTGGTTGCTCCTCTTACCGTCTTTACAGTAGTTATCCTGGTATTTGCGT
ATTGGTATACTAAGAAGAATTCATTCAAGAGAAAAAGCATAATGTTACCTAAGTCCTTGCTCTC
TGTGGTAAAAAGTGCCACGTTAGAGACAAAACCTGAATCGAAGTATTCACTTGTCACACCGCAC
CAGCCAGCTGTCCTAGAGAGTGAGACGGTGATCTGTGAAGAGCCCCTGTCCACAGTGACAGCTC
CAGACAGCCCCGAAGCAGCAGAACAGGAAGAACTTTCAAAAGAAACAAAGGCTCTGGAGGCTGG
AGGAAGCACGTCTGCCATGACCCCAGACAGCCCTCCAACTCCGACACAAAGACGCAGCTTTTCC
CTGTTAAGTAGTAACCAGTCAGGCCCTTGTAGCCTCACCGCCTATCACTCCCGAAACGGCTCTG
ACAGTGGCCTCGTGGGATCGGGCAGCTCCATATCGGACTTGGAATCTCTCCCAAACAACAACTC
AGAAACAAAGATGGCAGAGCACGACCCTCCACCCGTGAGAAAGGCCCCCATGGCCTCCGGTTAT
GACAAACCGCACATGTTGGTGGACGTGCTTGTGGATGTTGGGGGGAAGGAGTCTCTCATGGGGT
ATAGACTCACAGGAGAGGCCCAGGAGCTGTCCTAAGGTCTCCCGAGGCCTGCTGGTGGTAAAGA
AACTGACCTTTTAGGCAGTTTTTCTGCATTGATTTCATGAAAGAAGCTATACATTAGCTAATAC
TAACCACATAGAATATCAGACTTAGATACGTGAATAAGGATCCTGTGGGCACTGCTGGGTCCAC
TCTGCAAATGCCAAGACTATCAAAGGAACGTATTGTCGCTTCTGGCTCCTTCCCAGGTGGGCTA
GCATCTGTGAGTTTGCCTCGGCTAGCCTTGCTTCCTACAGCCGCCACTGCTCCTCCACCCTGAT
CATCTCACAGGACAGGGTGGACCGGGTTTTTTTTTTTTTTCACACACCTTTGTATATGTAAGTT
CATGTATATAATATGTTTACATGTTTCACTTTGAACTGAAAGCTACTCAAAGCCAGCCGTAAGT
CTATGGTAGAATGTGATGGAACATGTTGGTGGAAGCTTGTACAATAGAACACATTGGTGGGAGC
TTGTACATACTTTTTTATGGAGCATTACTTACGATTTTTTAAGTAAAATGTTTTGAAACCAAAA
AAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_034641	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA37895	(Get FASTA)	NCBI Sequence Viewer
	AAA37896	(Get FASTA)	NCBI Sequence Viewer
	AAA37898	(Get FASTA)	NCBI Sequence Viewer
	AAA39177	(Get FASTA)	NCBI Sequence Viewer
	AAA39178	(Get FASTA)	NCBI Sequence Viewer
	AAA80980	(Get FASTA)	NCBI Sequence Viewer
	AAF22557	(Get FASTA)	NCBI Sequence Viewer
	AAF22558	(Get FASTA)	NCBI Sequence Viewer
	AAI32600	(Get FASTA)	NCBI Sequence Viewer
	AAI38618	(Get FASTA)	NCBI Sequence Viewer
	AAO21311	(Get FASTA)	NCBI Sequence Viewer
	AAO21312	(Get FASTA)	NCBI Sequence Viewer
	BAE29616	(Get FASTA)	NCBI Sequence Viewer
	BAE30094	(Get FASTA)	NCBI Sequence Viewer
	BAE30935	(Get FASTA)	NCBI Sequence Viewer
	BAE31172	(Get FASTA)	NCBI Sequence Viewer
	BAE31709	(Get FASTA)	NCBI Sequence Viewer
	BAE31923	(Get FASTA)	NCBI Sequence Viewer
	BAE35017	(Get FASTA)	NCBI Sequence Viewer
	BAE35269	(Get FASTA)	NCBI Sequence Viewer
	BAE35417	(Get FASTA)	NCBI Sequence Viewer
	BAE41245	(Get FASTA)	NCBI Sequence Viewer
	EDL03452	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSMUSP00000020188
	ENSMUSP00000020188.7
GenBank Protein	P15261	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_034641 ⟸ NM_010511
- Peptide Label:	precursor
- UniProtKB:	Q91Y85 (UniProtKB/Swiss-Prot), P15261 (UniProtKB/Swiss-Prot), Q3TW49 (UniProtKB/TrEMBL), Q3U8T2 (UniProtKB/TrEMBL), Q540M5 (UniProtKB/TrEMBL)
- Sequence:	show sequence MGPQAAAGRMILLVVLMLSAKVGSGALTSTEDPEPPSVPVPTNVLIKSYNLNPVVCWEYQNMSQ TPIFTVQVKVYSGSWTDSCTNISDHCCNIYEQIMYPDVSAWARVKAKVGQKESDYARSKEFLMC LKGKVGPPGLEIRRKKEEQLSVLVFHPEVVVNGESQGTMFGDGSTCYTFDYTVYVEHNRSGEIL HTKHTVEKEECNETLCELNISVSTLDSRYCISVDGISSFWQVRTEKSKDVCIPPFHDDRKDSIW ILVVAPLTVFTVVILVFAYWYTKKNSFKRKSIMLPKSLLSVVKSATLETKPESKYSLVTPHQPA VLESETVICEEPLSTVTAPDSPEAAEQEELSKETKALEAGGSTSAMTPDSPPTPTQRRSFSLLS SNQSGPCSLTAYHSRNGSDSGLVGSGSSISDLESLPNNNSETKMAEHDPPPVRKAPMASGYDKP HMLVDVLVDVGGKESLMGYRLTGEAQELS hide sequence

Ensembl Acc Id:

ENSMUSP00000129309 ⟸ ENSMUST00000164591

Ensembl Acc Id:

ENSMUSP00000020188 ⟸ ENSMUST00000020188

Protein Domains

Fibronectin type-III Interferon gamma receptor D2

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P15261-F1-model_v2	AlphaFold	P15261	1-477	view protein structure

Promoters

RGD ID:

6819459

Promoter ID:

MM_KWN:3642

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day4, 3T3L1_Day6, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen

Transcripts:

NM_010511

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv36	10	19,311,441 - 19,311,962 (+)	MPROMDB

RGD ID:

8671574

Promoter ID:

EPDNEW_M13817

Type:

initiation region

Name:

Ifngr1_1

Description:

Mus musculus interferon gamma receptor 1 , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	10	19,592,009 - 19,592,069	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	MGI:107655	AgrOrtholog
Ensembl Genes	ENSMUSG00000020009	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000020188	ENTREZGENE
	ENSMUST00000020188.13	UniProtKB/Swiss-Prot
Gene3D-CATH	2.60.40.10	UniProtKB/Swiss-Prot
InterPro	FN3_dom	UniProtKB/Swiss-Prot
	FN3_sf	UniProtKB/Swiss-Prot
	Ig-like_fold	UniProtKB/Swiss-Prot
	Interferon_gamma_pox/mammal	UniProtKB/Swiss-Prot
	Interferon_gamma_rcpt_asu	UniProtKB/Swiss-Prot
	Type-II_Cytokine-TF_Rcpt	UniProtKB/Swiss-Prot
KEGG Report	mmu:15979	UniProtKB/Swiss-Prot
MGD	MGI:107655	ENTREZGENE
NCBI Gene	15979	ENTREZGENE
PANTHER	INTERFERON/INTERLEUKIN RECEPTOR	UniProtKB/Swiss-Prot
	PTHR20859:SF5	UniProtKB/Swiss-Prot
Pfam	IFNGR1	UniProtKB/Swiss-Prot
	IFNGR1_transm	UniProtKB/Swiss-Prot
	Tissue_fac	UniProtKB/Swiss-Prot
PhenoGen	Ifngr1	PhenoGen
PRINTS	INTERFERONGR	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF49265	UniProtKB/Swiss-Prot
UniProt	E9PX11_MOUSE	UniProtKB/TrEMBL
	INGR1_MOUSE	UniProtKB/Swiss-Prot, ENTREZGENE
	Q3TW49	ENTREZGENE, UniProtKB/TrEMBL
	Q3U8T2	ENTREZGENE, UniProtKB/TrEMBL
	Q540M5	ENTREZGENE, UniProtKB/TrEMBL
	Q91Y85	ENTREZGENE
UniProt Secondary	Q91Y85	UniProtKB/Swiss-Prot

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Mammalian Phenotype

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Mammalian Phenotype