Advanced Search (OLGA)

Gene: Irf3 (interferon regulatory factor 3) Rattus norvegicus

Analyze

Symbol:

Irf3

Name:

interferon regulatory factor 3

RGD ID:

1549774

Description:

Predicted to enable several functions, including DNA-binding transcription activator activity, RNA polymerase II-specific; promoter-specific chromatin binding activity; and protein homodimerization activity. Involved in cellular response to exogenous dsRNA; positive regulation of canonical NF-kappaB signal transduction; and positive regulation of cytokine production. Predicted to be located in cytosol and mitochondrion. Predicted to be active in chromatin; cytoplasm; and nucleus. Human ortholog(s) of this gene implicated in brain disease. Orthologous to human IRF3 (interferon regulatory factor 3); PARTICIPATES IN Toll-like receptor signaling pathway; hepatitis C pathway; influenza A pathway; INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine; 4,4'-sulfonyldiphenol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

MGC94729

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	IRF3 (interferon regulatory factor 3)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Irf3 (interferon regulatory factor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Irf3 (interferon regulatory factor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	IRF3 (interferon regulatory factor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	IRF3 (interferon regulatory factor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Irf3 (interferon regulatory factor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	IRF3 (interferon regulatory factor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	IRF3 (interferon regulatory factor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Irf3 (interferon regulatory factor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	IRF3 (interferon regulatory factor 3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Irf3 (interferon regulatory factor 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	irf3 (interferon regulatory factor 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	104,616,608 - 104,621,402 (+)	NCBI		GRCr8
mRatBN7.2	1	95,479,966 - 95,484,926 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	95,479,821 - 95,484,935 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	100,865,527 - 100,870,321 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	109,338,193 - 109,342,987 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	102,628,586 - 102,633,382 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	100,992,244 - 100,997,202 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	100,992,405 - 100,997,198 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	102,056,847 - 102,061,805 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	95,470,284 - 95,475,078 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	1	89,741,455 - 89,746,249 (+)	NCBI		Celera
Cytogenetic Map	1	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

RGD Manual Disease Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Irf3	Rat	asthma		ISO	RGD:1558245	5128793		RGD
Irf3	Rat	bacterial pneumonia		ISO	RGD:1558245	4891951		RGD
Irf3	Rat	Respiratory Tract Infections		ISO	RGD:1558245	5128795		RGD
Irf3	Rat	severe acute respiratory syndrome	disease_progression	ISO	RGD:1344104	5490168	mRNA:increased expression:lung (human)	RGD

Imported Disease Annotations - ClinVar

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Irf3	Rat	developmental and epileptic encephalopathy 12		ISO	RGD:1344104	8554872	ClinVar Annotator: match by term: Developmental and epileptic encephalopathy, 12	ClinVar	PMID:28492532
Irf3	Rat	Herpes Simplex Encephalitis 7		ISO	RGD:1344104	8554872	ClinVar Annotator: match by term: Encephalopathy, acute, infection-induced (herpes-specific), susceptibility to, 7 \| ClinVar Annotator: more ...	ClinVar	PMID:25741868\|PMID:26216125\|PMID:26513235\|PMID:28492532
Irf3	Rat	multisystem inflammatory syndrome in children		ISO	RGD:1344104	8554872	ClinVar Annotator: match by term: Multisystem inflammatory syndrome in children	ClinVar

Imported Disease Annotations - CTD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Irf3	Rat	Herpes Simplex Encephalitis		ISO	RGD:1344104	11554173	CTD Direct Evidence: marker/mechanism	CTD
Irf3	Rat	severe acute respiratory syndrome		ISO	RGD:1344104	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:26861016

Imported Disease Annotations - OMIM

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Irf3	Rat	Herpes Simplex Encephalitis 7	susceptibility	ISO	RGD:1344104	7240710		OMIM

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Irf3	Rat	17alpha-ethynylestradiol	affects expression	ISO	RGD:1558245	6480464	Ethinyl Estradiol affects the expression of IRF3 mRNA	CTD	PMID:17555576
Irf3	Rat	17alpha-ethynylestradiol	multiple interactions	ISO	RGD:1558245	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of IRF3 mRNA	CTD	PMID:17942748
Irf3	Rat	17alpha-ethynylestradiol	increases expression	ISO	RGD:1558245	6480464	Ethinyl Estradiol results in increased expression of IRF3 mRNA	CTD	PMID:17942748
Irf3	Rat	2,2',4,4'-Tetrabromodiphenyl ether	increases expression	EXP		6480464	2,2',4,4'-tetrabromodiphenyl ether results in increased expression of IRF3 mRNA	CTD	PMID:21394737
Irf3	Rat	2,2'-Methylenebis(4-methyl-6-tert-butylphenol)	multiple interactions	ISO	RGD:1344104	6480464	[CYP3A4 protein affects the susceptibility to 2,2'-methylenebis(4-methyl-6-tert-butylphenol)] which affects the expression of IRF3 mRNA	CTD	PMID:38160208
Irf3	Rat	2,3',4,4',5-Pentachlorobiphenyl	multiple interactions	ISO	RGD:1344104	6480464	[2,3',4,4',5-pentachlorobiphenyl co-treated with Lipopolysaccharides] results in increased phosphorylation of and affects the localization of IRF3 more ...	CTD	PMID:22906770
Irf3	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	RGD:1558245	6480464	Tetrachlorodibenzodioxin affects the expression of IRF3 mRNA	CTD	PMID:21570461\|PMID:24058054
Irf3	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of IRF3 mRNA	CTD	PMID:34747641
Irf3	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of IRF3 mRNA	CTD	PMID:21215274
Irf3	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	RGD:1558245	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of IRF3 mRNA	CTD	PMID:17942748
Irf3	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	RGD:1344104	6480464	[Tetrachlorodibenzodioxin results in increased activity of AHR protein] which results in increased expression of IRF3 more ...	CTD	PMID:17900530
Irf3	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	RGD:1558245	6480464	Tetrachlorodibenzodioxin results in increased expression of IRF3 mRNA	CTD	PMID:23798565
Irf3	Rat	3-phenylprop-2-enal	multiple interactions	ISO	RGD:1558245	6480464	cinnamaldehyde inhibits the reaction [Lipopolysaccharides results in increased activity of IRF3 protein]	CTD	PMID:17920563
Irf3	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	RGD:1558245	6480464	bisphenol S results in increased expression of IRF3 mRNA	CTD	PMID:39298647
Irf3	Rat	4,4'-sulfonyldiphenol	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of more ...	CTD	PMID:36041667
Irf3	Rat	4-hydroxynon-2-enal	multiple interactions	ISO	RGD:1558245	6480464	4-hydroxy-2-nonenal inhibits the reaction [Lipopolysaccharides results in increased activity of IRF3 protein]; 4-hydroxy-2-nonenal inhibits the more ...	CTD	PMID:19627980
Irf3	Rat	6-propyl-2-thiouracil	decreases expression	EXP		6480464	Propylthiouracil results in decreased expression of IRF3 mRNA	CTD	PMID:30047161
Irf3	Rat	acrolein	multiple interactions	ISO	RGD:1344104	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of more ...	CTD	PMID:32699268
Irf3	Rat	all-trans-retinoic acid	increases expression	ISO	RGD:1344104	6480464	Tretinoin results in increased expression of IRF3 mRNA	CTD	PMID:23724009
Irf3	Rat	alpha-D-galactose	multiple interactions	ISO	RGD:1558245	6480464	[lipopolysaccharide, Escherichia coli O111 B4 co-treated with Galactose] results in increased phosphorylation of IRF3 protein; more ...	CTD	PMID:23535186
Irf3	Rat	alpha-D-galactose	multiple interactions	EXP		6480464	[Galactose co-treated with Aluminum Chloride] results in increased expression of IRF3 mRNA; thymoquinone inhibits the more ...	CTD	PMID:29405769
Irf3	Rat	alpha-pinene	multiple interactions	ISO	RGD:1344104	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of more ...	CTD	PMID:32699268
Irf3	Rat	amitrole	decreases expression	EXP		6480464	Amitrole results in decreased expression of IRF3 mRNA	CTD	PMID:30047161
Irf3	Rat	amlexanox	multiple interactions	ISO	RGD:1558245	6480464	amlexanox inhibits the reaction [Palmitic Acid results in increased phosphorylation of IRF3 protein]; amlexanox inhibits more ...	CTD	PMID:32763286\|PMID:32905826
Irf3	Rat	aristolochic acid A	decreases expression	ISO	RGD:1344104	6480464	aristolochic acid I results in decreased expression of IRF3 mRNA	CTD	PMID:33212167
Irf3	Rat	arsenous acid	multiple interactions	ISO	RGD:1558245	6480464	Arsenic Trioxide inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of IRF3 protein]	CTD	PMID:23106696
Irf3	Rat	auranofin	multiple interactions	ISO	RGD:1558245	6480464	Auranofin inhibits the reaction [lipopolysaccharide A results in increased activity of IRF3 protein]; Auranofin inhibits more ...	CTD	PMID:17034761
Irf3	Rat	benzo[a]pyrene	increases expression	ISO	RGD:1558245	6480464	Benzo(a)pyrene results in increased expression of IRF3 mRNA	CTD	PMID:21964900
Irf3	Rat	benzo[a]pyrene	affects methylation	ISO	RGD:1344104	6480464	Benzo(a)pyrene affects the methylation of IRF3 promoter	CTD	PMID:30157460
Irf3	Rat	benzo[e]pyrene	increases methylation	ISO	RGD:1344104	6480464	benzo(e)pyrene results in increased methylation of IRF3 promoter	CTD	PMID:30157460
Irf3	Rat	beta-lapachone	decreases expression	ISO	RGD:1344104	6480464	beta-lapachone results in decreased expression of IRF3 mRNA	CTD	PMID:38218311
Irf3	Rat	bis(2-ethylhexyl) phthalate	increases phosphorylation	ISO	RGD:1558245	6480464	Diethylhexyl Phthalate results in increased phosphorylation of IRF3 protein	CTD	PMID:36583613
Irf3	Rat	bis(2-ethylhexyl) phthalate	multiple interactions	ISO	RGD:1558245	6480464	Lycopene inhibits the reaction [Diethylhexyl Phthalate results in increased expression of IRF3 mRNA]; Lycopene inhibits more ...	CTD	PMID:36583613
Irf3	Rat	bis(2-ethylhexyl) phthalate	increases expression	ISO	RGD:1558245	6480464	Diethylhexyl Phthalate results in increased expression of IRF3 mRNA	CTD	PMID:36583613
Irf3	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of IRF3 mRNA	CTD	PMID:26982218
Irf3	Rat	bisphenol A	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of more ...	CTD	PMID:36041667
Irf3	Rat	bisphenol A	decreases expression	ISO	RGD:1558245	6480464	bisphenol A results in decreased expression of IRF3 mRNA	CTD	PMID:35598803
Irf3	Rat	bisphenol A	increases methylation	EXP		6480464	bisphenol A results in increased methylation of IRF3 gene	CTD	PMID:28505145
Irf3	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of IRF3 mRNA	CTD	PMID:25181051
Irf3	Rat	bisphenol F	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of more ...	CTD	PMID:36041667
Irf3	Rat	butan-1-ol	multiple interactions	ISO	RGD:1344104	6480464	[[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic more ...	CTD	PMID:29432896
Irf3	Rat	cadmium atom	multiple interactions	ISO	RGD:1344104	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in increased ubiquitination of IRF3 more ...	CTD	PMID:33040242
Irf3	Rat	cadmium dichloride	increases expression	EXP		6480464	Cadmium Chloride results in increased expression of IRF3 mRNA	CTD	PMID:33453195
Irf3	Rat	cadmium dichloride	multiple interactions	ISO	RGD:1344104	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in increased ubiquitination of IRF3 more ...	CTD	PMID:33040242
Irf3	Rat	cannabidiol	multiple interactions	ISO	RGD:1344104	6480464	[Dronabinol co-treated with Cannabidiol] inhibits the reaction [Poly I-C affects the localization of IRF3 protein]; more ...	CTD	PMID:32244040
Irf3	Rat	chloroquine	multiple interactions	ISO	RGD:1558245	6480464	Chloroquine inhibits the reaction [lipopolysaccharide, E coli O55-B5 affects the localization of IRF3 protein]; Chloroquine more ...	CTD	PMID:22341560\|PMID:25780039\|PMID:28134560
Irf3	Rat	chlorpyrifos	increases expression	ISO	RGD:1558245	6480464	Chlorpyrifos results in increased expression of IRF3 mRNA	CTD	PMID:37019170
Irf3	Rat	chrysin	multiple interactions	ISO	RGD:1558245	6480464	chrysin inhibits the reaction [Poly I-C results in increased expression of IRF3 mRNA]	CTD	PMID:19426678
Irf3	Rat	Cirsimarin	multiple interactions	ISO	RGD:1558245	6480464	cirsimarin inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of IRF3 protein]	CTD	PMID:30053449
Irf3	Rat	copper atom	increases expression	EXP		6480464	Copper results in increased expression of IRF3 mRNA	CTD	PMID:30556269
Irf3	Rat	copper(0)	increases expression	EXP		6480464	Copper results in increased expression of IRF3 mRNA	CTD	PMID:30556269
Irf3	Rat	coumarin	increases phosphorylation	ISO	RGD:1344104	6480464	coumarin results in increased phosphorylation of IRF3 protein	CTD	PMID:35688186
Irf3	Rat	cudratricusxanthone A	multiple interactions	ISO	RGD:1558245	6480464	cudratricusxanthone A inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of and results in increased more ...	CTD	PMID:31350693
Irf3	Rat	curcumin	multiple interactions	ISO	RGD:1558245	6480464	Curcumin inhibits the reaction [[Lipopolysaccharides binds to TLR4 protein] which results in increased activity of more ...	CTD	PMID:16678799
Irf3	Rat	dexamethasone	multiple interactions	ISO	RGD:1558245	6480464	Dexamethasone inhibits the reaction [Paraquat affects the localization of IRF3 protein]; Dexamethasone inhibits the reaction more ...	CTD	PMID:34455893
Irf3	Rat	diarsenic trioxide	multiple interactions	ISO	RGD:1558245	6480464	Arsenic Trioxide inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of IRF3 protein]	CTD	PMID:23106696
Irf3	Rat	Dibutyl phosphate	affects expression	ISO	RGD:1344104	6480464	di-n-butylphosphoric acid affects the expression of IRF3 mRNA	CTD	PMID:37042841
Irf3	Rat	dibutyl phthalate	increases expression	EXP		6480464	Dibutyl Phthalate results in increased expression of IRF3 mRNA	CTD	PMID:21266533
Irf3	Rat	dibutyl phthalate	increases expression	ISO	RGD:1558245	6480464	Dibutyl Phthalate results in increased expression of IRF3 mRNA	CTD	PMID:21266533
Irf3	Rat	disodium selenite	multiple interactions	ISO	RGD:1558245	6480464	Sodium Selenite inhibits the reaction [Lipopolysaccharides results in increased activity of IRF3 protein]; Sodium Selenite more ...	CTD	PMID:18279804
Irf3	Rat	elemental selenium	increases expression	ISO	RGD:1344104	6480464	Selenium results in increased expression of IRF3 mRNA	CTD	PMID:19244175
Irf3	Rat	eriodictyol	multiple interactions	ISO	RGD:1558245	6480464	eriodictyol inhibits the reaction [Poly I-C results in increased expression of IRF3 mRNA]	CTD	PMID:19426678
Irf3	Rat	ethanol	increases expression	ISO	RGD:1558245	6480464	Ethanol results in increased expression of IRF3 mRNA	CTD	PMID:26858005
Irf3	Rat	ethanol	multiple interactions	ISO	RGD:1344104	6480464	[[Gasoline co-treated with Ethanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic more ...	CTD	PMID:29432896
Irf3	Rat	ethanol	multiple interactions	ISO	RGD:1558245	6480464	[Fructose co-treated with Ethanol] results in increased expression of IRF3 protein; Fructose promotes the reaction more ...	CTD	PMID:26858005
Irf3	Rat	ferroheme b	decreases expression	ISO	RGD:1558245	6480464	Heme metabolite results in decreased expression of IRF3 mRNA	CTD	PMID:19191707
Irf3	Rat	folic acid	increases expression	ISO	RGD:1558245	6480464	Folic Acid results in increased expression of IRF3 mRNA	CTD	PMID:25629700
Irf3	Rat	fructose	multiple interactions	ISO	RGD:1558245	6480464	[Fructose co-treated with Ethanol] results in increased expression of IRF3 protein; Fructose promotes the reaction more ...	CTD	PMID:26858005
Irf3	Rat	galactose	multiple interactions	ISO	RGD:1558245	6480464	[lipopolysaccharide, Escherichia coli O111 B4 co-treated with Galactose] results in increased phosphorylation of IRF3 protein; more ...	CTD	PMID:23535186
Irf3	Rat	galactose	multiple interactions	EXP		6480464	[Galactose co-treated with Aluminum Chloride] results in increased expression of IRF3 mRNA; thymoquinone inhibits the more ...	CTD	PMID:29405769
Irf3	Rat	gemcitabine	decreases expression	ISO	RGD:1344104	6480464	Gemcitabine results in decreased expression of IRF3 mRNA	CTD	PMID:17039268
Irf3	Rat	genistein	decreases expression	ISO	RGD:1558245	6480464	Genistein results in decreased expression of IRF3 mRNA	CTD	PMID:32186404
Irf3	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of IRF3 mRNA	CTD	PMID:22061828
Irf3	Rat	heme b	decreases expression	ISO	RGD:1558245	6480464	Heme metabolite results in decreased expression of IRF3 mRNA	CTD	PMID:19191707
Irf3	Rat	hexadecanoic acid	multiple interactions	ISO	RGD:1558245	6480464	amlexanox inhibits the reaction [Palmitic Acid results in increased phosphorylation of IRF3 protein]; pitavastatin inhibits more ...	CTD	PMID:18323514\|PMID:32905826
Irf3	Rat	hexadecanoic acid	increases phosphorylation	EXP		6480464	Palmitic Acid results in increased phosphorylation of IRF3 protein	CTD	PMID:35235096
Irf3	Rat	hexadecanoic acid	increases phosphorylation	ISO	RGD:1558245	6480464	Palmitic Acid results in increased phosphorylation of IRF3 protein	CTD	PMID:18323514\|PMID:32905826
Irf3	Rat	hydroquinone	multiple interactions	ISO	RGD:1558245	6480464	hydroquinone inhibits the reaction [AKT1 protein results in increased phosphorylation of IRF3 protein]; hydroquinone inhibits more ...	CTD	PMID:28883758
Irf3	Rat	hydroxychloroquine	increases expression	ISO	RGD:1558245	6480464	Hydroxychloroquine results in increased expression of IRF3 mRNA	CTD	PMID:25321315
Irf3	Rat	hydroxychloroquine	multiple interactions	ISO	RGD:1344104	6480464	phenyl-N-tert-butylnitrone inhibits the reaction [Hydroxychloroquine results in increased phosphorylation of IRF3 protein]	CTD	PMID:25321315
Irf3	Rat	hydroxychloroquine	increases phosphorylation	ISO	RGD:1344104	6480464	Hydroxychloroquine results in increased phosphorylation of IRF3 protein	CTD	PMID:25321315
Irf3	Rat	ivermectin	decreases expression	ISO	RGD:1344104	6480464	Ivermectin results in decreased expression of IRF3 protein	CTD	PMID:32959892
Irf3	Rat	linuron	increases expression	ISO	RGD:1558245	6480464	Linuron results in increased expression of IRF3 mRNA	CTD	PMID:30661753
Irf3	Rat	linuron	multiple interactions	ISO	RGD:1558245	6480464	XBP1 gene promotes the reaction [Linuron results in increased expression of IRF3 mRNA]	CTD	PMID:30661753
Irf3	Rat	lipopolysaccharide	multiple interactions	ISO	RGD:1344104	6480464	[2,3',4,4',5-pentachlorobiphenyl co-treated with Lipopolysaccharides] results in increased phosphorylation of and affects the localization of IRF3 more ...	CTD	PMID:22906770\|PMID:32244040
Irf3	Rat	lipopolysaccharide	increases phosphorylation	ISO	RGD:1558245	6480464	Lipopolysaccharides results in increased phosphorylation of IRF3 protein	CTD	PMID:18323514\|PMID:19426678\|PMID:19627980\|PMID:20023007\|PMID:21586572\|PMID:23106696\|PMID:25780039\|PMID:30053449
Irf3	Rat	lipopolysaccharide	increases expression	ISO	RGD:1558245	6480464	Lipopolysaccharides results in increased expression of IRF3 mRNA	CTD	PMID:24056979\|PMID:25896969
Irf3	Rat	lipopolysaccharide	increases activity	ISO	RGD:1558245	6480464	Lipopolysaccharides results in increased activity of IRF3 protein	CTD	PMID:16678799\|PMID:17920563\|PMID:19627980
Irf3	Rat	lipopolysaccharide	multiple interactions	ISO	RGD:1558245	6480464	4-hydroxy-2-nonenal inhibits the reaction [Lipopolysaccharides results in increased activity of IRF3 protein]; 4-hydroxy-2-nonenal inhibits the more ...	CTD	PMID:16116226\|PMID:16678799\|PMID:17920563\|PMID:18279804\|PMID:18323514\|PMID:19426678\|PMID:19627980\|PMID:20023007\|PMID:21586572\|PMID:23106696\|PMID:24056979\|PMID:25780039\|PMID:30053449\|PMID:31350693
Irf3	Rat	luteolin	multiple interactions	ISO	RGD:1558245	6480464	Luteolin inhibits the reaction [Lipopolysaccharides promotes the reaction [IRF3 protein binds to IRF3 protein]]; Luteolin more ...	CTD	PMID:19426678
Irf3	Rat	lycopene	multiple interactions	ISO	RGD:1558245	6480464	Lycopene inhibits the reaction [Diethylhexyl Phthalate results in increased expression of IRF3 mRNA]; Lycopene inhibits more ...	CTD	PMID:36583613
Irf3	Rat	metam	multiple interactions	ISO	RGD:1558245	6480464	methyldithiocarbamate inhibits the reaction [Lipopolysaccharides results in increased expression of IRF3 mRNA]	CTD	PMID:24056979
Irf3	Rat	metformin	multiple interactions	ISO	RGD:1344104	6480464	[Paclitaxel co-treated with Metformin] results in decreased expression of IRF3 mRNA	CTD	PMID:29309887
Irf3	Rat	methapyrilene	increases methylation	ISO	RGD:1344104	6480464	Methapyrilene results in increased methylation of IRF3 promoter	CTD	PMID:30157460
Irf3	Rat	methimazole	decreases expression	EXP		6480464	Methimazole results in decreased expression of IRF3 mRNA	CTD	PMID:30047161
Irf3	Rat	microcystin-LR	multiple interactions	ISO	RGD:1344104	6480464	cyanoginosin LR results in increased expression of and results in increased phosphorylation of IRF3 protein	CTD	PMID:36435412
Irf3	Rat	mono(2-ethylhexyl) phthalate	increases expression	ISO	RGD:1344104	6480464	mono-(2-ethylhexyl)phthalate results in increased expression of IRF3 mRNA	CTD	PMID:38685446
Irf3	Rat	monodansylcadaverine	multiple interactions	ISO	RGD:1558245	6480464	monodansylcadaverine inhibits the reaction [lipopolysaccharide, Escherichia coli O111 B4 results in increased degradation of IRF3 more ...	CTD	PMID:22341560
Irf3	Rat	N-methyl-4-phenylpyridinium	multiple interactions	ISO	RGD:1344104	6480464	MIR29A inhibits the reaction [1-Methyl-4-phenylpyridinium results in increased phosphorylation of IRF3 protein]	CTD	PMID:36174668
Irf3	Rat	N-methyl-4-phenylpyridinium	increases phosphorylation	ISO	RGD:1344104	6480464	1-Methyl-4-phenylpyridinium results in increased phosphorylation of IRF3 protein	CTD	PMID:36174668
Irf3	Rat	nickel dichloride	decreases expression	ISO	RGD:1344104	6480464	nickel chloride results in decreased expression of IRF3 mRNA	CTD	PMID:21466819
Irf3	Rat	nickel dichloride	multiple interactions	ISO	RGD:1344104	6480464	IRF3 protein inhibits the reaction [nickel chloride results in decreased expression of TP63 mRNA alternative more ...	CTD	PMID:21466819
Irf3	Rat	nitrates	multiple interactions	ISO	RGD:1558245	6480464	[Particulate Matter results in increased abundance of Nitrates] which results in increased expression of IRF3 more ...	CTD	PMID:35964746
Irf3	Rat	ozone	multiple interactions	ISO	RGD:1344104	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of more ...	CTD	PMID:32699268
Irf3	Rat	paclitaxel	multiple interactions	ISO	RGD:1344104	6480464	[Paclitaxel co-treated with Metformin] results in decreased expression of IRF3 mRNA	CTD	PMID:29309887
Irf3	Rat	paracetamol	affects expression	ISO	RGD:1558245	6480464	Acetaminophen affects the expression of IRF3 mRNA	CTD	PMID:17562736
Irf3	Rat	paracetamol	increases expression	EXP		6480464	Acetaminophen results in increased expression of IRF3 mRNA	CTD	PMID:33387578
Irf3	Rat	paracetamol	decreases expression	ISO	RGD:1344104	6480464	Acetaminophen results in decreased expression of IRF3 mRNA	CTD	PMID:21420995
Irf3	Rat	paraquat	affects localization	ISO	RGD:1558245	6480464	Paraquat affects the localization of IRF3 protein	CTD	PMID:32763286\|PMID:34455893
Irf3	Rat	paraquat	increases expression	ISO	RGD:1558245	6480464	Paraquat results in increased expression of IRF3 mRNA	CTD	PMID:34455893
Irf3	Rat	paraquat	multiple interactions	ISO	RGD:1558245	6480464	amlexanox inhibits the reaction [Paraquat affects the localization of IRF3 protein]; Dexamethasone inhibits the reaction more ...	CTD	PMID:32763286\|PMID:34455893
Irf3	Rat	pentachlorophenol	increases expression	ISO	RGD:1558245	6480464	Pentachlorophenol results in increased expression of IRF3 mRNA	CTD	PMID:23892564
Irf3	Rat	perfluorooctanoic acid	decreases expression	EXP		6480464	perfluorooctanoic acid results in decreased expression of IRF3 mRNA	CTD	PMID:19162173
Irf3	Rat	Phytolaccoside E	increases phosphorylation	ISO	RGD:1344104	6480464	esculentoside A results in increased phosphorylation of IRF3 protein	CTD	PMID:36460195
Irf3	Rat	pirinixic acid	decreases expression	ISO	RGD:1558245	6480464	pirinixic acid results in decreased expression of IRF3 mRNA	CTD	PMID:18445702
Irf3	Rat	pirinixic acid	decreases expression	EXP		6480464	pirinixic acid results in decreased expression of IRF3 mRNA	CTD	PMID:19162173
Irf3	Rat	pitavastatin	multiple interactions	ISO	RGD:1558245	6480464	pitavastatin inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of IRF3 protein]; pitavastatin inhibits the more ...	CTD	PMID:18323514
Irf3	Rat	pitavastatin(1-)	multiple interactions	ISO	RGD:1558245	6480464	pitavastatin inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of IRF3 protein]; pitavastatin inhibits the more ...	CTD	PMID:18323514
Irf3	Rat	poly(I:C)	multiple interactions	ISO	RGD:1344104	6480464	[Dronabinol co-treated with Cannabidiol] inhibits the reaction [Poly I-C affects the localization of IRF3 protein]; more ...	CTD	PMID:16399790\|PMID:18779317\|PMID:32244040
Irf3	Rat	poly(I:C)	affects localization	ISO	RGD:1344104	6480464	Poly I-C affects the localization of IRF3 protein	CTD	PMID:32244040
Irf3	Rat	poly(I:C)	increases phosphorylation	ISO	RGD:1558245	6480464	Poly I-C results in increased phosphorylation of IRF3 protein	CTD	PMID:25780039\|PMID:36958387
Irf3	Rat	poly(I:C)	increases phosphorylation	ISO	RGD:1344104	6480464	Poly I-C results in increased phosphorylation of IRF3 protein	CTD	PMID:18779317\|PMID:36958387
Irf3	Rat	poly(I:C)	multiple interactions	ISO	RGD:1558245	6480464	APPL1 protein promotes the reaction [Poly I-C results in increased phosphorylation of IRF3 protein]; BX795 more ...	CTD	PMID:18279804\|PMID:19426678\|PMID:25780039
Irf3	Rat	pravastatin	multiple interactions	ISO	RGD:1558245	6480464	Pravastatin inhibits the reaction [Palmitic Acid results in increased phosphorylation of IRF3 protein]	CTD	PMID:18323514
Irf3	Rat	quercetin	multiple interactions	ISO	RGD:1558245	6480464	Quercetin inhibits the reaction [Poly I-C results in increased expression of IRF3 mRNA]	CTD	PMID:19426678
Irf3	Rat	quercetin	increases expression	ISO	RGD:1344104	6480464	Quercetin results in increased expression of IRF3 mRNA	CTD	PMID:21632981
Irf3	Rat	resveratrol	multiple interactions	ISO	RGD:1558245	6480464	resveratrol inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of and results in increased activity more ...	CTD	PMID:16116226\|PMID:16678799
Irf3	Rat	resveratrol	decreases phosphorylation	ISO	RGD:1558245	6480464	resveratrol results in decreased phosphorylation of IRF3 protein	CTD	PMID:22118570
Irf3	Rat	scoparone	multiple interactions	ISO	RGD:1558245	6480464	scoparone inhibits the reaction [[lipopolysaccharide, Escherichia coli O111 B4 co-treated with Galactose] results in increased more ...	CTD	PMID:23535186
Irf3	Rat	selenium atom	increases expression	ISO	RGD:1344104	6480464	Selenium results in increased expression of IRF3 mRNA	CTD	PMID:19244175
Irf3	Rat	sodium arsenite	decreases expression	ISO	RGD:1558245	6480464	sodium arsenite results in decreased expression of IRF3 mRNA	CTD	PMID:16014739
Irf3	Rat	sulfadimethoxine	decreases expression	EXP		6480464	Sulfadimethoxine results in decreased expression of IRF3 mRNA	CTD	PMID:30047161
Irf3	Rat	sunitinib	decreases expression	ISO	RGD:1344104	6480464	Sunitinib results in decreased expression of IRF3 mRNA	CTD	PMID:31533062
Irf3	Rat	tamoxifen	affects expression	ISO	RGD:1558245	6480464	Tamoxifen affects the expression of IRF3 mRNA	CTD	PMID:17555576
Irf3	Rat	thioacetamide	decreases expression	EXP		6480464	Thioacetamide results in decreased expression of IRF3 mRNA	CTD	PMID:23411599\|PMID:34492290
Irf3	Rat	thymoquinone	increases expression	EXP		6480464	thymoquinone results in increased expression of IRF3 mRNA	CTD	PMID:29405769
Irf3	Rat	thymoquinone	multiple interactions	EXP		6480464	thymoquinone inhibits the reaction [[Galactose co-treated with Aluminum Chloride] results in increased expression of IRF3 more ...	CTD	PMID:29405769
Irf3	Rat	titanium dioxide	decreases methylation	ISO	RGD:1558245	6480464	titanium dioxide results in decreased methylation of IRF3 gene	CTD	PMID:35295148
Irf3	Rat	trametinib	multiple interactions	ISO	RGD:1558245	6480464	trametinib promotes the reaction [Lipopolysaccharides results in increased phosphorylation of IRF3 protein]	CTD	PMID:25780039
Irf3	Rat	triphenyl phosphate	affects expression	ISO	RGD:1344104	6480464	triphenyl phosphate affects the expression of IRF3 mRNA	CTD	PMID:37042841
Irf3	Rat	Triptolide	increases expression	ISO	RGD:1558245	6480464	triptolide results in increased expression of IRF3 protein	CTD	PMID:36520315
Irf3	Rat	triptonide	decreases expression	ISO	RGD:1558245	6480464	triptonide results in decreased expression of IRF3 mRNA	CTD	PMID:33045310
Irf3	Rat	vadimezan	increases phosphorylation	ISO	RGD:1558245	6480464	vadimezan results in increased phosphorylation of IRF3 protein	CTD	PMID:36958387
Irf3	Rat	valproic acid	increases methylation	ISO	RGD:1344104	6480464	Valproic Acid results in increased methylation of IRF3 gene	CTD	PMID:29154799
Irf3	Rat	vinclozolin	increases expression	EXP		6480464	vinclozolin results in increased expression of IRF3 mRNA	CTD	PMID:23034163
Irf3	Rat	zingerone	multiple interactions	ISO	RGD:1558245	6480464	zingerone inhibits the reaction [lipopolysaccharide, Escherichia coli O111 B4 results in increased phosphorylation of IRF3 more ...	CTD	PMID:29289488

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Irf3	Rat	antiviral innate immune response	involved_in	ISO	RGD:1344104,UniProtKB:Q14653-5	1624291	PMID:9891032	RGD	PMID:9891032
Irf3	Rat	cellular response to exogenous dsRNA		IEP		5128810		RGD
Irf3	Rat	cellular response to lipopolysaccharide	acts_upstream_of_or_within	ISO	RGD:1558245	1624291	PMID:21606371	RGD	PMID:21606371
Irf3	Rat	cellular response to virus	involved_in	ISO	RGD:1344104	1624291	PMID:25609812	RGD	PMID:25609812
Irf3	Rat	cellular response to virus	involved_in	IEA	UniProtKB:Q14653\|ensembl:ENSP00000366344	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Irf3	Rat	cellular response to virus	involved_in	ISO	RGD:1558245	1624291	PMID:18802055	RGD	PMID:18802055
Irf3	Rat	cytoplasmic pattern recognition receptor signaling pathway	involved_in	ISO	RGD:1344104	1624291	PMID:8524823	RGD	PMID:8524823
Irf3	Rat	cytoplasmic pattern recognition receptor signaling pathway	involved_in	IEA	UniProtKB:Q14653\|ensembl:ENSP00000366344	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Irf3	Rat	defense response to virus	acts_upstream_of_or_within	ISO	RGD:1558245	1624291	MGI:3577601 PMID:23770239	RGD	PMID:23770239
Irf3	Rat	defense response to virus	involved_in	ISO	RGD:1558245	1624291	PMID:18562536, PMID:20451243, PMID:27129230	RGD	PMID:18562536\|PMID:20451243\|PMID:27129230
Irf3	Rat	immune system process	involved_in	IBA	MGI:1096873\|MGI:1350924\|MGI:1859179\|MGI:1859212\|MGI:96395\|MGI:96590\|PANTHER:PTN000942747\|RGD:1312024\|RGD:2920\|UniProtKB:Q02556\|UniProtKB:Q14653\|UniProtKB:Q92985	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Irf3	Rat	lipopolysaccharide-mediated signaling pathway	acts_upstream_of_or_within	ISO	RGD:1558245	1624291	PMID:12855817, PMID:12872135	RGD	PMID:12855817\|PMID:12872135
Irf3	Rat	mRNA transcription	involved_in	ISO	RGD:1344104,UniProtKB:Q14653-5	1624291	PMID:9891032	RGD	PMID:9891032
Irf3	Rat	positive regulation of canonical NF-kappaB signal transduction		IMP		5128809		RGD
Irf3	Rat	positive regulation of cytokine production		IMP		5128809		RGD
Irf3	Rat	positive regulation of DNA-templated transcription	involved_in	ISO	RGD:1558245	1624291	PMID:27129230	RGD	PMID:27129230
Irf3	Rat	positive regulation of DNA-templated transcription	involved_in	IEA	ARBA:ARBA00029082	1600115	GO_REF:0000117	UniProt	GO_REF:0000117
Irf3	Rat	positive regulation of interferon-alpha production	involved_in	ISO	RGD:1558245	1624291	PMID:18562536	RGD	PMID:18562536
Irf3	Rat	positive regulation of interferon-beta production	involved_in	ISO	RGD:1558245	1624291	PMID:18562536	RGD	PMID:18562536
Irf3	Rat	positive regulation of transcription by RNA polymerase II	involved_in	ISO	RGD:1344104	1624291	PMID:17560375, PMID:8524823, PMID:9660935	RGD	PMID:17560375\|PMID:8524823\|PMID:9660935
Irf3	Rat	positive regulation of transcription by RNA polymerase II	involved_in	IEA	UniProtKB:Q14653\|ensembl:ENSP00000366344	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Irf3	Rat	positive regulation of type I interferon production	involved_in	ISO	RGD:1344104	1624291	PMID:25636800, PMID:36603579	RGD	PMID:25636800\|PMID:36603579
Irf3	Rat	positive regulation of type I interferon production	involved_in	ISO	RGD:1558245	1624291	PMID:30842237	RGD	PMID:30842237
Irf3	Rat	positive regulation of type I interferon production	involved_in	IEA	UniProtKB:Q14653\|ensembl:ENSP00000366344	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Irf3	Rat	positive regulation of type I interferon production	involved_in	ISO	RGD:1344104\|UniProtKB:Q14653-5	1624291	PMID:18636090	RGD	PMID:18636090
Irf3	Rat	positive regulation of type I interferon-mediated signaling pathway	acts_upstream_of_or_within	ISO	RGD:1558245	1624291	PMID:17618271	RGD	PMID:17618271
Irf3	Rat	programmed necrotic cell death	acts_upstream_of_or_within	ISO	RGD:1558245	1624291	MGI:3577601 PMID:23770239	RGD	PMID:23770239
Irf3	Rat	regulation of apoptotic process	involved_in	ISO	RGD:1344104	1624291	PMID:25609812	RGD	PMID:25609812
Irf3	Rat	regulation of apoptotic process	involved_in	IEA	UniProtKB:Q14653\|ensembl:ENSP00000366344	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Irf3	Rat	regulation of DNA-templated transcription	involved_in	IEA	InterPro:IPR019471\|InterPro:IPR019817	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Irf3	Rat	regulation of gene expression	acts_upstream_of_or_within	ISO	RGD:1558245	1624291	MGI:1328317\|MGI:1859212\|MGI:1919762\|MGI:1929658 PMID:23160154	RGD	PMID:23160154
Irf3	Rat	regulation of inflammatory response	acts_upstream_of_or_within	ISO	RGD:1558245	1624291	MGI:1328317 PMID:28069950	RGD	PMID:28069950
Irf3	Rat	regulation of transcription by RNA polymerase II	involved_in	IBA	MGI:1096873\|MGI:1350924\|MGI:96395\|MGI:96590\|MGI:96591\|PANTHER:PTN000942746\|RGD:2920\|UniProtKB:O14896\|UniProtKB:P10914\|UniProtKB:P14316\|UniProtKB:Q00978\|UniProtKB:Q02556\|UniProtKB:Q13568\|UniProtKB:Q14653\|UniProtKB:Q15306\|UniProtKB:Q92985	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Irf3	Rat	regulation of transcription by RNA polymerase II	involved_in	IEA	ARBA:ARBA00028137	1600115	GO_REF:0000117	UniProt	GO_REF:0000117
Irf3	Rat	response to bacterium	acts_upstream_of_or_within	ISO	RGD:1558245	1624291	PMID:15661922	RGD	PMID:15661922
Irf3	Rat	response to exogenous dsRNA	acts_upstream_of_or_within	ISO	RGD:1558245	1624291	PMID:12855817, PMID:12872135	RGD	PMID:12855817\|PMID:12872135
Irf3	Rat	response to lipopolysaccharide	acts_upstream_of_or_within	ISO	RGD:1558245	1624291	PMID:12855817, PMID:12872135	RGD	PMID:12855817\|PMID:12872135
Irf3	Rat	toll-like receptor 4 signaling pathway	involved_in	ISO	RGD:1344104	1624291	PMID:25636800	RGD	PMID:25636800
Irf3	Rat	toll-like receptor 4 signaling pathway	involved_in	IEA	UniProtKB:Q14653\|ensembl:ENSP00000366344	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Irf3	Rat	TRIF-dependent toll-like receptor signaling pathway	involved_in	ISO	RGD:1344104	1624291	PMID:25636800	RGD	PMID:25636800
Irf3	Rat	TRIF-dependent toll-like receptor signaling pathway	involved_in	IEA	UniProtKB:Q14653\|ensembl:ENSP00000366344	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Irf3	Rat	type I interferon-mediated signaling pathway	involved_in	ISO	RGD:1558245	1624291	PMID:27129230	RGD	PMID:27129230

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Irf3	Rat	chromatin	is_active_in	ISO	RGD:1344104	1624291	PMID:8524823	RGD	PMID:8524823
Irf3	Rat	chromatin	is_active_in	IEA	UniProtKB:Q14653\|ensembl:ENSP00000366344	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Irf3	Rat	cytoplasm	located_in	ISO	RGD:1344104	1624291	UniProtKB:P24001-1 PMID:17079289, PMID:18818105, PMID:23729669	RGD	PMID:17079289\|PMID:18818105\|PMID:23729669
Irf3	Rat	cytoplasm	located_in	IEA	UniProtKB:Q14653\|ensembl:ENSP00000366344	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Irf3	Rat	cytoplasm	is_active_in	ISO	RGD:1344104	1624291	PMID:9566918	RGD	PMID:9566918
Irf3	Rat	cytosol	located_in	IEA	UniProtKB:Q14653\|ensembl:ENSP00000366344	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Irf3	Rat	cytosol	located_in	ISO	RGD:1344104\|UniProtKB:Q14653-1\|UniProtKB:Q14653-2\|UniProtKB:Q14653-4	1624291		RGD	GO_REF:0000052
Irf3	Rat	mitochondrion	located_in	ISO	RGD:1344104	1624291	PMID:25609812	RGD	PMID:25609812
Irf3	Rat	mitochondrion	located_in	IEA	UniProtKB:Q14653\|ensembl:ENSP00000366344	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Irf3	Rat	nucleus	is_active_in	ISO	RGD:1344104	1624291	PMID:10805757, PMID:36603579	RGD	PMID:10805757\|PMID:36603579
Irf3	Rat	nucleus	located_in	IEA	UniProtKB-KW:KW-0539	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Irf3	Rat	nucleus	located_in	IEA	UniProtKB-SubCell:SL-0191	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Irf3	Rat	nucleus	located_in	IEA	UniProtKB:Q14653\|ensembl:ENSP00000366344	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Irf3	Rat	nucleus	located_in	ISO	RGD:1558245	1624291	PMID:15661922, PMID:21606371	RGD	PMID:15661922\|PMID:21606371
Irf3	Rat	nucleus	is_active_in	IBA	MGI:1350924\|MGI:1859179\|MGI:96395\|MGI:96590\|PANTHER:PTN000942746\|UniProtKB:P14316\|UniProtKB:Q00978\|UniProtKB:Q02556\|UniProtKB:Q13568\|UniProtKB:Q14653\|UniProtKB:Q15306\|UniProtKB:Q92985\|ZFIN:ZDB-GENE-041114-13\|ZFIN:ZDB-GENE-070912-330	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Irf3	Rat	nucleus	located_in	ISO	RGD:1344104	1624291	PMID:17079289, PMID:18818105	RGD	PMID:17079289\|PMID:18818105
Irf3	Rat	nucleus	is_active_in	ISO	RGD:1344104,UniProtKB:Q14653-5	1624291	PMID:31340999	RGD	PMID:31340999
Irf3	Rat	nucleus	is_active_in	ISO	RGD:1344104\|UniProtKB:Q14653-5	1624291	PMID:25636800	RGD	PMID:25636800

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Irf3	Rat	DNA-binding transcription activator activity	enables	ISO	RGD:1344104	1624291	PMID:36603579	RGD	PMID:36603579
Irf3	Rat	DNA-binding transcription activator activity	enables	IEA	UniProtKB:Q14653\|ensembl:ENSP00000366344	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Irf3	Rat	DNA-binding transcription activator activity	enables	ISO	RGD:1344104\|UniProtKB:Q14653-5	1624291	PMID:8524823	RGD	PMID:8524823
Irf3	Rat	DNA-binding transcription activator activity, RNA polymerase II-specific	enables	ISO	RGD:1344104	1624291	PMID:17560375	RGD	PMID:17560375
Irf3	Rat	DNA-binding transcription activator activity, RNA polymerase II-specific	enables	IEA	UniProtKB:Q14653\|ensembl:ENSP00000366344	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Irf3	Rat	DNA-binding transcription factor activity	enables	ISO	RGD:1344104	1624291	PMID:8524823	RGD	PMID:8524823
Irf3	Rat	DNA-binding transcription factor activity	enables	IEA	InterPro:IPR019471\|InterPro:IPR019817	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Irf3	Rat	DNA-binding transcription factor activity	enables	IEA	UniProtKB:Q14653\|ensembl:ENSP00000366344	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Irf3	Rat	DNA-binding transcription factor activity	enables	IEA	ARBA:ARBA00028295	1600115	GO_REF:0000117	UniProt	GO_REF:0000117
Irf3	Rat	DNA-binding transcription factor activity, RNA polymerase II-specific	enables	ISO	RGD:1558245	1624291	PMID:27129230, PMID:30842237	RGD	PMID:27129230\|PMID:30842237
Irf3	Rat	DNA-binding transcription factor activity, RNA polymerase II-specific	enables	IEA	UniProtKB:Q14653\|ensembl:ENSP00000366344	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Irf3	Rat	DNA-binding transcription factor activity, RNA polymerase II-specific	enables	IBA	MGI:1350924\|MGI:1859179\|MGI:1859211\|MGI:1859212\|MGI:96590\|PANTHER:PTN000942746\|UniProtKB:P10914\|UniProtKB:P14316\|UniProtKB:Q02556\|UniProtKB:Q13568\|UniProtKB:Q14653\|UniProtKB:Q15306\|UniProtKB:Q92985\|ZFIN:ZDB-GENE-070912-330	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Irf3	Rat	DNA-binding transcription factor activity, RNA polymerase II-specific	enables	ISO	RGD:1344104	1624291	PMID:8524823	RGD	PMID:8524823
Irf3	Rat	identical protein binding	enables	ISO	RGD:1344104	1624291	UniProtKB:Q14653 PMID:15841462, PMID:16301520, PMID:18725644, PMID:19416887, PMID:19454348, PMID:20403326, PMID:20581830, PMID:21102435, PMID:21782231, PMID:22000020, PMID:22728658, PMID:23746807, PMID:25609649, more ...	RGD	PMID:15841462\|PMID:16301520\|PMID:18725644\|PMID:19416887\|PMID:19454348\|PMID:20403326\|PMID:20581830\|PMID:21102435\|PMID:21782231\|PMID:22000020\|PMID:22728658\|PMID:23746807\|PMID:25609649\|PMID:32726803\|PMID:34084167
Irf3	Rat	identical protein binding	enables	IEA	UniProtKB:Q14653\|ensembl:ENSP00000366344	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Irf3	Rat	identical protein binding	enables	ISO	RGD:1558245	1624291	PR:P70671\|UniProtKB:P70671 PMID:12855817, PMID:12872135, PMID:14556004, PMID:19805092, PMID:19890330, PMID:24696485	RGD	PMID:12855817\|PMID:12872135\|PMID:14556004\|PMID:19805092\|PMID:19890330\|PMID:24696485
Irf3	Rat	promoter-specific chromatin binding	enables	ISO	RGD:1558245	1624291	PMID:18802055	RGD	PMID:18802055
Irf3	Rat	protein binding	enables	ISO	RGD:14183272	1624291	UniProtKB:F1RK46\|UniProtKB:P19712-PRO_0000038050\|UniProtKB:Q68871 PMID:17215286, PMID:19540847, PMID:21680532, PMID:25809915, PMID:27334592	RGD	PMID:17215286\|PMID:19540847\|PMID:21680532\|PMID:25809915\|PMID:27334592
Irf3	Rat	protein binding	enables	ISO	RGD:1344104	1624291	UniProtKB:O00571\|UniProtKB:O14730\|UniProtKB:O43765\|UniProtKB:O60684\|UniProtKB:O94826\|UniProtKB:P05161\|UniProtKB:P06400\|UniProtKB:P07900\|UniProtKB:P0C6X7-PRO_0000037311\|UniProtKB:P10415\|UniProtKB:P10914\|UniProtKB:P19474\|UniProtKB:P28749\|UniProtKB:P52292\|UniProtKB:P67775\|UniProtKB:Q07812\|UniProtKB:Q13114\|UniProtKB:Q14164\|UniProtKB:Q7Z434\|UniProtKB:Q86WV6\|UniProtKB:Q92793\|UniProtKB:Q9BYM8\|UniProtKB:Q9H6K1\|UniProtKB:Q9H8X9\|UniProtKB:Q9NX58\|UniProtKB:Q9UHD2\|UniProtKB:Q9UII4\|UniProtKB:Q9Y3R0\|UniProtKB:Q9Y5Q3 PMID:10920266, PMID:15841462, PMID:16154084, PMID:16362036, PMID:17599067, PMID:17761676, PMID:18309294, PMID:18583960, PMID:18711448, PMID:18818105, PMID:19153231, PMID:20308324, PMID:20581830, more ...	RGD	PMID:10920266\|PMID:15841462\|PMID:16154084\|PMID:16362036\|PMID:17599067\|PMID:17761676\|PMID:18309294\|PMID:18583960\|PMID:18711448\|PMID:18818105\|PMID:19153231\|PMID:20308324\|PMID:20581830\|PMID:20628368\|PMID:21903422\|PMID:21988832\|PMID:22908223\|PMID:23746807\|PMID:24622840\|PMID:24807708\|PMID:25609812\|PMID:25803835\|PMID:26347139\|PMID:27980081\|PMID:29429998\|PMID:29802199\|PMID:31413131\|PMID:32726803\|PMID:32878885\|PMID:34950606
Irf3	Rat	protein binding	enables	ISO	RGD:1558245	1624291	UniProtKB:Q9CUN6 PMID:37330913	RGD	PMID:37330913
Irf3	Rat	protein domain specific binding	enables	ISO	RGD:1344104	1624291	UniProtKB:P45481 PMID:11583620	RGD	PMID:11583620
Irf3	Rat	protein domain specific binding	enables	IEA	UniProtKB:Q14653\|ensembl:ENSP00000366344	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Irf3	Rat	protein homodimerization activity	enables	ISO	RGD:1344104	1624291	UniProtKB:Q14653 PMID:12062447, PMID:22394562, PMID:30699354	RGD	PMID:12062447\|PMID:22394562\|PMID:30699354
Irf3	Rat	protein homodimerization activity	enables	IEA	UniProtKB:Q14653\|ensembl:ENSP00000366344	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Irf3	Rat	RNA polymerase II cis-regulatory region sequence-specific DNA binding	enables	ISO	RGD:1344104	1624291	PMID:17560375, PMID:8524823	RGD	PMID:17560375\|PMID:8524823
Irf3	Rat	RNA polymerase II cis-regulatory region sequence-specific DNA binding	enables	IEA	UniProtKB:Q14653\|ensembl:ENSP00000366344	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Irf3	Rat	RNA polymerase II cis-regulatory region sequence-specific DNA binding	enables	IBA	PANTHER:PTN000942746\|UniProtKB:P10914\|UniProtKB:Q00978\|UniProtKB:Q02556\|UniProtKB:Q14653\|UniProtKB:Q15306\|UniProtKB:Q92985	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Irf3	Rat	sequence-specific DNA binding	enables	ISO	RGD:1344104	1624291	PMID:17574024, PMID:23332764	RGD	PMID:17574024\|PMID:23332764
Irf3	Rat	sequence-specific DNA binding	enables	IEA	UniProtKB:Q14653\|ensembl:ENSP00000366344	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Irf3	Rat	sequence-specific double-stranded DNA binding	enables	ISO	RGD:1344104	1624291	PMID:28473536	RGD	PMID:28473536
Irf3	Rat	sequence-specific double-stranded DNA binding	enables	IEA	UniProtKB:Q14653\|ensembl:ENSP00000366344	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Irf3	Rat	transcription cis-regulatory region binding	enables	IEA	InterPro:IPR001346	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

Molecular Pathway Annotations Click to see Annotation Detail View

RGD Manual Annotations

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Irf3	Rat	Toll-like receptor signaling pathway		ISO	RGD:1344104	5685014		RGD

Imported Annotations - KEGG (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Irf3	Rat	hepatitis C pathway		IEA		6907045		KEGG	rno:05160
Irf3	Rat	influenza A pathway		IEA		6907045		KEGG	rno:05164
Irf3	Rat	measles pathway		IEA		6907045		KEGG	rno:05162
Irf3	Rat	Retinoic acid-inducible gene (RIG) I-like receptor signaling pathway		IEA		6907045		KEGG	rno:04622
Irf3	Rat	Toll-like receptor signaling pathway		IEA		6907045		KEGG	rno:04620

Disease Annotations Click to see Annotation Detail View

asthma (ISO)

bacterial pneumonia (ISO)

developmental and epileptic encephalopathy 12 (ISO)

Herpes Simplex Encephalitis (ISO)

Herpes Simplex Encephalitis 7 (ISO)

multisystem inflammatory syndrome in children (ISO)

Respiratory Tract Infections (ISO)

severe acute respiratory syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17alpha-ethynylestradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,2'-Methylenebis(4-methyl-6-tert-butylphenol) (ISO)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3-phenylprop-2-enal (ISO)

4,4'-sulfonyldiphenol (EXP,ISO)

4-hydroxynon-2-enal (ISO)

6-propyl-2-thiouracil (EXP)

acrolein (ISO)

all-trans-retinoic acid (ISO)

alpha-D-galactose (EXP,ISO)

alpha-pinene (ISO)

amitrole (EXP)

amlexanox (ISO)

aristolochic acid A (ISO)

arsenous acid (ISO)

auranofin (ISO)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

beta-lapachone (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (EXP)

butan-1-ol (ISO)

cadmium atom (ISO)

cadmium dichloride (EXP,ISO)

cannabidiol (ISO)

chloroquine (ISO)

chlorpyrifos (ISO)

chrysin (ISO)

Cirsimarin (ISO)

copper atom (EXP)

copper(0) (EXP)

coumarin (ISO)

cudratricusxanthone A (ISO)

curcumin (ISO)

dexamethasone (ISO)

diarsenic trioxide (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP,ISO)

disodium selenite (ISO)

elemental selenium (ISO)

eriodictyol (ISO)

ethanol (ISO)

ferroheme b (ISO)

folic acid (ISO)

fructose (ISO)

galactose (EXP,ISO)

gemcitabine (ISO)

genistein (ISO)

gentamycin (EXP)

heme b (ISO)

hexadecanoic acid (EXP,ISO)

hydroquinone (ISO)

hydroxychloroquine (ISO)

ivermectin (ISO)

linuron (ISO)

lipopolysaccharide (ISO)

luteolin (ISO)

lycopene (ISO)

metam (ISO)

metformin (ISO)

methapyrilene (ISO)

methimazole (EXP)

microcystin-LR (ISO)

mono(2-ethylhexyl) phthalate (ISO)

monodansylcadaverine (ISO)

N-methyl-4-phenylpyridinium (ISO)

nickel dichloride (ISO)

nitrates (ISO)

ozone (ISO)

paclitaxel (ISO)

paracetamol (EXP,ISO)

paraquat (ISO)

pentachlorophenol (ISO)

perfluorooctanoic acid (EXP)

Phytolaccoside E (ISO)

pirinixic acid (EXP,ISO)

pitavastatin (ISO)

pitavastatin(1-) (ISO)

poly(I:C) (ISO)

pravastatin (ISO)

quercetin (ISO)

resveratrol (ISO)

scoparone (ISO)

selenium atom (ISO)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

sunitinib (ISO)

tamoxifen (ISO)

thioacetamide (EXP)

thymoquinone (EXP)

titanium dioxide (ISO)

trametinib (ISO)

triphenyl phosphate (ISO)

Triptolide (ISO)

triptonide (ISO)

vadimezan (ISO)

valproic acid (ISO)

vinclozolin (EXP)

zingerone (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

antiviral innate immune response (ISO)

cellular response to exogenous dsRNA (IEP)

cellular response to lipopolysaccharide (ISO)

cellular response to virus (IEA,ISO)

cytoplasmic pattern recognition receptor signaling pathway (IEA,ISO)

defense response to virus (ISO)

immune system process (IBA)

lipopolysaccharide-mediated signaling pathway (ISO)

mRNA transcription (ISO)

positive regulation of canonical NF-kappaB signal transduction (IMP)

positive regulation of cytokine production (IMP)

positive regulation of DNA-templated transcription (IEA,ISO)

positive regulation of interferon-alpha production (ISO)

positive regulation of interferon-beta production (ISO)

positive regulation of transcription by RNA polymerase II (IEA,ISO)

positive regulation of type I interferon production (IEA,ISO)

positive regulation of type I interferon-mediated signaling pathway (ISO)

programmed necrotic cell death (ISO)

regulation of apoptotic process (IEA,ISO)

regulation of DNA-templated transcription (IEA)

regulation of gene expression (ISO)

regulation of inflammatory response (ISO)

regulation of transcription by RNA polymerase II (IBA,IEA)

response to bacterium (ISO)

response to exogenous dsRNA (ISO)

response to lipopolysaccharide (ISO)

toll-like receptor 4 signaling pathway (IEA,ISO)

TRIF-dependent toll-like receptor signaling pathway (IEA,ISO)

type I interferon-mediated signaling pathway (ISO)

Cellular Component

chromatin (IEA,ISO)

cytoplasm (IEA,ISO)

cytosol (IEA,ISO)

mitochondrion (IEA,ISO)

nucleus (IBA,IEA,ISO)

Molecular Function

DNA-binding transcription activator activity (IEA,ISO)

DNA-binding transcription activator activity, RNA polymerase II-specific (IEA,ISO)

DNA-binding transcription factor activity (IEA,ISO)

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA,IEA,ISO)

identical protein binding (IEA,ISO)

promoter-specific chromatin binding (ISO)

protein binding (ISO)

protein domain specific binding (IEA,ISO)

protein homodimerization activity (IEA,ISO)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA,IEA,ISO)

sequence-specific DNA binding (IEA,ISO)

sequence-specific double-stranded DNA binding (IEA,ISO)

transcription cis-regulatory region binding (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

hepatitis C pathway (IEA)

influenza A pathway (IEA)

measles pathway (IEA)

Retinoic acid-inducible gene (RIG) I-like receptor signaling pathway (IEA)

Toll-like receptor signaling pathway (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	IFN regulatory factor 3 contributes to the host response during Pseudomonas aeruginosa lung infection in mice.	Carrigan SO, etal., J Immunol. 2010 Sep 15;185(6):3602-9. Epub 2010 Aug 18.
2.	Double-stranded RNA induces pancreatic beta-cell apoptosis by activation of the toll-like receptor 3 and interferon regulatory factor 3 pathways.	Dogusan Z, etal., Diabetes. 2008 May;57(5):1236-45. Epub 2008 Jan 25.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Paramyxovirus Sendai virus V protein counteracts innate virus clearance through IRF-3 activation, but not via interferon, in mice.	Kiyotani K, etal., Virology. 2007 Mar 1;359(1):82-91. Epub 2006 Oct 6.
5.	Elucidating the molecular physiopathology of acute respiratory distress syndrome in severe acute respiratory syndrome patients.	Kong SL, etal., Virus Res. 2009 Nov;145(2):260-9. Epub 2009 Jul 25.
6.	Pathogen recognition by the innate immune system.	Kumar H, etal., Int Rev Immunol. 2011 Feb;30(1):16-34.
7.	C-reactive protein triggers inflammatory responses partly via TLR4/IRF3/NF-kappaB signaling pathway in rat vascular smooth muscle cells.	Liu N, etal., Life Sci. 2010 Sep 11;87(11-12):367-74. Epub 2010 Aug 4.
8.	Interferon response factor 3 is essential for house dust mite-induced airway allergy.	Marichal T, etal., J Allergy Clin Immunol. 2010 Oct;126(4):836-844.e13. Epub 2010 Jul 31.
9.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
10.	GOA pipeline	RGD automated data pipeline
11.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
13.	Comprehensive gene review and curation	RGD comprehensive gene curation
14.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:9660935	PMID:11583620	PMID:12062447	PMID:12855817	PMID:12872135	PMID:14556004	PMID:15661922	PMID:15800576	PMID:15841462	PMID:16301520	PMID:17079289	PMID:17560375
PMID:17618271	PMID:18562536	PMID:18725644	PMID:18818105	PMID:18851954	PMID:19416887	PMID:19454348	PMID:19805092	PMID:19890330	PMID:20403326	PMID:20451243	PMID:20581830
PMID:21102435	PMID:21606371	PMID:21782231	PMID:22000020	PMID:22394562	PMID:22728658	PMID:23160154	PMID:23332764	PMID:23729669	PMID:23746807	PMID:23770239	PMID:24627105
PMID:24696485	PMID:25169970	PMID:25609649	PMID:25636800	PMID:27129230	PMID:27447882	PMID:27448985	PMID:28069950	PMID:28122305	PMID:28849230	PMID:36964897	PMID:37935918

Genomics

Comparative Map Data

Irf3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	104,616,608 - 104,621,402 (+)	NCBI		GRCr8
mRatBN7.2	1	95,479,966 - 95,484,926 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	95,479,821 - 95,484,935 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	100,865,527 - 100,870,321 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	109,338,193 - 109,342,987 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	102,628,586 - 102,633,382 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	100,992,244 - 100,997,202 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	100,992,405 - 100,997,198 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	102,056,847 - 102,061,805 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	95,470,284 - 95,475,078 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	1	89,741,455 - 89,746,249 (+)	NCBI		Celera
Cytogenetic Map	1	q22	NCBI

IRF3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	49,659,572 - 49,665,857 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	49,659,569 - 49,665,875 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	50,162,829 - 50,169,114 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	54,854,641 - 54,860,936 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	54,854,641 - 54,860,926	NCBI
Celera	19	47,032,161 - 47,038,466 (-)	NCBI		Celera
Cytogenetic Map	19	q13.33	NCBI
HuRef	19	46,539,596 - 46,545,904 (-)	NCBI		HuRef
CHM1_1	19	50,164,615 - 50,170,921 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	19	52,659,601 - 52,665,933 (-)	NCBI		T2T-CHM13v2.0

Irf3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	44,647,072 - 44,652,272 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	44,647,072 - 44,652,272 (+)	Ensembl		GRCm39 Ensembl
GRCm38	7	44,997,648 - 45,002,848 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	44,997,648 - 45,002,848 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	52,253,030 - 52,258,218 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	44,865,702 - 44,870,890 (+)	NCBI		MGSCv36	mm8
Celera	7	40,449,220 - 40,454,417 (+)	NCBI		Celera
Cytogenetic Map	7	B3	NCBI
cM Map	7	29.07	NCBI

Irf3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955559	1,224,874 - 1,228,624 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955559	1,223,986 - 1,228,671 (+)	NCBI	ChiLan1.0	ChiLan1.0

IRF3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	55,776,859 - 55,783,043 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	57,697,602 - 57,703,818 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	46,674,193 - 46,680,464 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	55,593,627 - 55,599,903 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	55,593,627 - 55,599,903 (-)	Ensembl	panpan1.1		panPan2

IRF3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	106,875,016 - 106,879,065 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	106,875,118 - 106,879,065 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	106,457,016 - 106,462,843 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	107,394,678 - 107,400,508 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	107,394,687 - 107,400,506 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	107,066,914 - 107,072,739 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	106,709,002 - 106,714,828 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	107,550,123 - 107,555,958 (+)	NCBI		UU_Cfam_GSD_1.0

Irf3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	21,859,560 - 21,863,357 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936664	3,475,543 - 3,481,533 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936664	3,477,750 - 3,482,489 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

IRF3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	54,701,668 - 54,707,151 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	54,701,733 - 54,706,079 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	50,430,689 - 50,441,627 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

IRF3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	42,835,285 - 42,841,487 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	42,831,203 - 42,840,796 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666073	22,779,185 - 22,785,813 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Irf3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624832	4,612,374 - 4,616,276 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624832	4,611,445 - 4,616,319 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Irf3
14 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	104
Count of miRNA genes:	91
Interacting mature miRNAs:	96
Transcripts:	ENSRNOT00000027786
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2313059	Bss55	Bone structure and strength QTL 55	3.2	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
70209	Niddm23	Non-insulin dependent diabetes mellitus QTL 23	2.82		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	94494440	198324465	Rat
631688	Hcas2	Hepatocarcinoma susceptibility QTL 2	3	0.0001	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	5925874	115540829	Rat
1582234	Gluco18	Glucose level QTL 18	3.4	0.0003	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	78479925	123479925	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	30882023	123479925	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	49393289	199050459	Rat
1578780	Cm52	Cardiac mass QTL 52	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	1	81591954	219808434	Rat
1331793	Bp200	Blood pressure QTL 200	3.71601		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	94494440	172949803	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	49393172	159356837	Rat
2300324	Fetw1	Fetal weight QTL 1	12.1	0.005	fetal growth trait (VT:0004201)	fetal body weight (CMO:0002080)	1	85424647	100358001	Rat
1300121	Hrtrt1	Heart rate QTL 1	3.7		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	65789093	115540829	Rat
1331800	Scl25	Serum cholesterol level QTL 25	3.013		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	94494440	117601394	Rat
7421628	Bp361	Blood pressure QTL 361		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	66023617	118608521	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	22340647	102268831	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32356093	162846471	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	57336763	151090257	Rat
2313072	Bss53	Bone structure and strength QTL 53	4.3	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	43284731	118944897	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
2313078	Bss54	Bone structure and strength QTL 54	3.5	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
1302788	Scl19	Serum cholesterol QTL 19	4.6	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	90532338	123479925	Rat
1549903	Bp267	Blood pressure QTL 267			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	77876254	106047988	Rat
2313083	Bmd74	Bone mineral density QTL 74	4	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	82174743	118944897	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	48963584	144267916	Rat
4889494	Scort2	Serum corticosterone level QTL 2	4.2		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	1	80592172	125592172	Rat
724567	Tcas6	Tongue tumor susceptibility QTL 6	6.85		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	1	92948896	144267916	Rat
61342	Bp27	Blood pressure QTL 27	3.4	0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	56732668	98773277	Rat
61344	Bp29	Blood pressure QTL 29	7.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	78350581	123350581	Rat
724521	Uae1	Urinary albumin excretion QTL 1	3.8	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	90508614	173018436	Rat
1358902	Bw47	Body weight QTL 47	1.67		body mass (VT:0001259)	body weight (CMO:0000012)	1	90508614	180359386	Rat
1358192	Ept13	Estrogen-induced pituitary tumorigenesis QTL 13	3.4		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	77494165	122494165	Rat
2313094	Bss58	Bone structure and strength QTL 58	3.7	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	43284731	118944897	Rat
2300164	Bmd44	Bone mineral density QTL 44	5.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	1	56949932	101949932	Rat
2313099	Bss56	Bone structure and strength QTL 56	2.4	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	1	43284731	118944897	Rat
2313098	Bmd70	Bone mineral density QTL 70	3.6	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	43284731	118944897	Rat
1300153	Bp171	Blood pressure QTL 171	3.37		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	90664883	143200202	Rat
731168	Bp154	Blood pressure QTL 154	3.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	94642644	214537671	Rat
738022	Anxrr13	Anxiety related response QTL 13	4.6	0.00039	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of, or within a discrete space in an open field apparatus (CMO:0001514)	1	83547917	128547917	Rat
152025249	Scl82	Serum cholesterol level QTL 82	4.77		blood cholesterol amount (VT:0000180)		1	50343510	99980958	Rat
10054135	Gmadr2	Adrenal mass QTL 2	1.97	0.0129	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	77857876	122857876	Rat
7411712	Strs4	Sensitivity to stroke QTL 4	8.7		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	1	78430536	123430536	Rat
1331749	Hrtrt11	Heart rate QTL 11	2.973		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	94494440	198211706	Rat
1331751	Bp199	Blood pressure QTL 199	3.60022		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	94494440	181830018	Rat
2293142	Bp314	Blood pressure QTL 314			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	92184926	137184926	Rat
2313051	Bss57	Bone structure and strength QTL 57	3.7	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	43284731	118944897	Rat
724529	Cm16	Cardiac mass QTL 16	2.7		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	1	87580395	150700247	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001006969	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006229021	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006229022	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006229024	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008759337	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC127719	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC083776	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473979	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213393	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218848	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000027786 ⟹ ENSRNOP00000027786

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	95,479,821 - 95,484,935 (+)	Ensembl
Rnor_6.0 Ensembl	1	100,992,405 - 100,997,198 (+)	Ensembl

RefSeq Acc Id:

NM_001006969 ⟹ NP_001006970

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	104,616,608 - 104,621,402 (+)	NCBI
mRatBN7.2	1	95,480,127 - 95,484,923 (+)	NCBI
Rnor_6.0	1	100,992,405 - 100,997,199 (+)	NCBI
Rnor_5.0	1	102,056,847 - 102,061,805 (+)	NCBI
RGSC_v3.4	1	95,470,284 - 95,475,078 (+)	RGD
Celera	1	89,741,455 - 89,746,249 (+)	RGD

Sequence:

show sequence

GACAAAGAAGGGGGTTGCGTGGCTGCGAGTCTCAACTACTGTTTGGGAGCCCCAAAACCAGTGC
TGACACCCGCGCCCCACGAGCGCGCAATTCCTCCCCTGGCTCAGGAACTGCACTGTATGCGCAG
GCTGGATCATGGGAACCCCGAAACCGCTGATTTTGCCTTGGCTGGTGTCTCAGCTGGACCTGGG
ACAGCTGAAAGGTGTGGCCTGGCTGGACGAGAGCCGTACAAAGTTCAGGATCCCATGGAAGCAT
GGCTTACGACAGGACGCACAGATGGCTGACTTTGGCATCTTCCAGGCCTGGGCGGAAGCCAGTG
GTGCCTACACCCCAGGGAAGGATAAGCCAGACCTGTCAACCTGGAAGAGGAATTTCCGGTCAGC
CCTGAACCGGAAAGAAGTGTTGCGATTAGCTGAGGACCGGAGCAAGGACCCTTTTGACCCTCAT
AAAGTGTATGAGTTTGTGACTCCAGGAGGAGCAAGGGACTTTGTACATCTGGACACCTCCCCTG
ACACCAATGGCAAAAGCAGTCTGTCTGATCACCAGGAAGACCTCTTGGAATTACTCGATCACAT
GGCCTTGGGACCCCTCCCAGATGAGGGGTCCTCAGACCTGCCTATTGCTTCTGATCCTTCTCAA
CCACCACTAAGCCCCATTGTAAACAACTTCCCAAACCCAGCACCCCAGGAAAACCCACTAAGGC
AGCTGCTAGCTGAGGAACAGTGGGAGTTCGAGGTGACTGCCTTCTACCGAGGCCGCCAGGTCTT
CCAGCAGACACTCTTTTGCCCCGGGGGCCTGCGGCTGGTGGGCAGCACGTCTGACAACGGGACA
CTGCCCTGGCAGCCAGTCACCCTGCCAGACCCTGAGGAGTTTCTGACAGACAGGCTTGTGAGGG
AGTATGTGAGGCAGGTACTCAAGGGGCTGGGCAAGGGGCTGGTGCTGTGGCGGGCAGGGCAGTG
CCTCTGGGCCCAGCGCCTAGGCCACTCGCATTCCTTCTGGGCCCTGGGTGAGGAGCTGCTTCCA
GACAGTGGGAGAGGGCCTGATGGAGAGGTCCCCAAGGACAAGAACGGAGTCGTGTTCGACCTCA
GGCCCTTTGTGGCAGATCTCATTGCCTTCATGGAAGGAAGCAGACATTCCCCACGATACACTCT
GTGGTTCTGTGTGGGGGAATCGTGGCCCCAGGACCAGCCGTGGGTCAAGAGGCTTGTGATGGTC
AAGGTTGTTCCTACATGTCTTAAGGAGCTGTTAGAGATGGCCCGGGAAGGGGGAGCCTCATCAC
TGAAAACCGTGGACTTGCACATCTCCAACAGCCAGCCGATCTCCCTTACCTCTGACCAGTACAA
GGCCTGCCTCCAGGACTTGGTGGAAGACATGGACTTCCAGGCCACTGGAGAAACCTGAGCCCAG
CTCAGCTGCTCCAATAAAGCAATTTATGCCACCATCAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_006229021 ⟹ XP_006229083

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	104,617,012 - 104,621,399 (+)	NCBI
mRatBN7.2	1	95,479,966 - 95,484,926 (+)	NCBI
Rnor_6.0	1	100,992,244 - 100,997,202 (+)	NCBI
Rnor_5.0	1	102,056,847 - 102,061,805 (+)	NCBI

Sequence:

show sequence

TGTAGGCGGAAGGCCAAAAAAGGGCATTGAGGGAGTTAGGCCGGTTCAGTCGGAGTGTGCTCCT
AGGTTTTCTGACTTTTCTTAAAGTAAATGATGAGAAATTTTTTTTTTATCTCAAAATACCATTA
GAAAGGAAAGTCCCAACGCTCGGAAGCTTAGTTGACAAAGAAGGGGGTTGCGTGGCTGCGAGTC
TCAACTACTGTTTGGGAGCCCCAAAACCAGTGCTGACACCCGCGCCCCACGAGCGCGCAATTCC
TCCCCTGGTAGGTAACGCGGAAGAACCGGGAGGGTGGCGGCCTCAGGGCACAGGAGCTCGGCTA
CCGAAAACCAGAATGGTTACGCGTTGTAGACGGAAGCCTGCAGTCTCAGCATCCAGACTGGAGG
CAGTAAAGATTGCTGCAAGTTCGAGGCCAGTGAGCTCCAGGCCAGGCTGAACCACAGAATGAGC
TCCAAACCAGCATGGGTTAAGCGAGTTGAAGACCAGCCTGAGCTACTGAATAAGTTTGAGGGTA
GCTTGGGTTACAGAGTGCATTCGAGGCCAGCCTGGGCCACACAGTGAGTTGAAGACCAATCATG
GCTACATAGCAAGTTCGAGGACAGCCTATGCTCCATACTAAGACCCTGTCTCAAAACATCCATA
AAAACAATGTAGAAAAGACAAAGCAGAAGAAGCGACAGCAGCTGGGAGAAGACTCTGGAAATGA
GCTCAGGAACTGCACTGTATGCGCAGGCTGGATCATGGGAACCCCGAAACCGCTGATTTTGCCT
TGGCTGGTGTCTCAGCTGGACCTGGGACAGCTGAAAGGTGTGGCCTGGCTGGACGAGAGCCGTA
CAAAGTTCAGGATCCCATGGAAGCATGGCTTACGACAGGACGCACAGATGGCTGACTTTGGCAT
CTTCCAGGCCTGGGCGGAAGCCAGTGGTGCCTACACCCCAGGGAAGGATAAGCCAGACCTGTCA
ACCTGGAAGAGGAATTTCCGGTCAGCCCTGAACCGGAAAGAAGTGTTGCGATTAGCTGAGGACC
GGAGCAAGGACCCTTTTGACCCTCATAAAGTGTATGAGTTTGTGACTCCAGGAGGAGCAAGGGA
CTTTGTACATCTGGACACCTCCCCTGACACCAATGGCAAAAGCAGTCTGTCTGATCACCAGGAA
GACCTCTTGGAATTACTCGATCACATGGCCTTGGGACCCCTCCCAGATGAGGGGTCCTCAGACC
TGCCTATTGCTTCTGATCCTTCTCAACCACCACTAAGCCCCATTGTAAACAACTTCCCAAACCC
AGCACCCCAGGAAAACCCACTAAGGCAGCTGCTAGCTGAGGAACAGTGGGAGTTCGAGGTGACT
GCCTTCTACCGAGGCCGCCAGGTCTTCCAGCAGACACTCTTTTGCCCCGGGGGCCTGCGGCTGG
TGGGCAGCACGTCTGACAACGGGACACTGCCCTGGCAGCCAGTCACCCTGCCAGACCCTGAGGA
GTTTCTGACAGACAGGCTTGTGAGGGAGTATGTGAGGCAGGTACTCAAGGGGCTGGGCAAGGGG
CTGGTGCTGTGGCGGGCAGGGCAGTGCCTCTGGGCCCAGCGCCTAGGCCACTCGCATTCCTTCT
GGGCCCTGGGTGAGGAGCTGCTTCCAGACAGTGGGAGAGGGCCTGATGGAGAGGTCCCCAAGGA
CAAGAACGGAGTCGTGTTCGACCTCAGGCCCTTTGTGGCAGATCTCATTGCCTTCATGGAAGGA
AGCAGACATTCCCCACGATACACTCTGTGGTTCTGTGTGGGGGAATCGTGGCCCCAGGACCAGC
CGTGGGTCAAGAGGCTTGTGATGGTCAAGGTTGTTCCTACATGTCTTAAGGAGCTGTTAGAGAT
GGCCCGGGAAGGGGGAGCCTCATCACTGAAAACCGTGGACTTGCACATCTCCAACAGCCAGCCG
ATCTCCCTTACCTCTGACCAGTACAAGGCCTGCCTCCAGGACTTGGTGGAAGACATGGACTTCC
AGGCCACTGGAGAAACCTGAGCCCAGCTCAGCTGCTCCAATAAAGCAATTTATGCCACCATCAC
AA

hide sequence

RefSeq Acc Id:

XM_006229022 ⟹ XP_006229084

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	104,617,012 - 104,621,399 (+)	NCBI
mRatBN7.2	1	95,479,987 - 95,484,926 (+)	NCBI
Rnor_6.0	1	100,992,258 - 100,997,202 (+)	NCBI
Rnor_5.0	1	102,056,847 - 102,061,805 (+)	NCBI

Sequence:

show sequence

CAAAAAAGGGCATTGAGGGAGTTAGGCCGGTTCAGTCGGAGTGTGCTCCTAGGTTTTCTGACTT
TTCTTAAAGTAAATGATGAGAAATTTTTTTTTTATCTCAAAATACCATTAGAAAGGAAAGTCCC
AACGCTCGGAAGCTTAGTTGACAAAGAAGGGGGTTGCGTGGCTGCGAGTCTCAACTACTGTTTG
GGAGCCCCAAAACCAGTGCTGACACCCGCGCCCCACGAGCGCGCAATTCCTCCCCTGGTAGGTA
ACGCGGAAGAACCGGGAGGGTGGCGGCCTCAGGGCACAGGAGCTCGGCTACCGAAAACCAGAAT
GGTTACGCGTTGTAGACGGAAGCCTGCAGTCTCAGCATCCAGACTGGAGGCAGTAAAGATTGCT
GCAAGTTCGAGGCCAGTGAGCTCCAGGCCAGGCTGAACCACAGAATGAGCTCCAAACCAGCATG
GGTTAAGCGAGTTGAAGACCAGCCTGAGCTACTGAATAAGTTTGAGGGTAGCTTGGGTTACAGA
GTGCATTCGAGGCCAGCCTGGGCCACACAGTGAGTTGAAGACCAATCATGGCTACATAGCAAGT
TCGAGGACAGCCTATGCTCCATACTAAGACCCTGTCTCAAAACATCCATAAAAACAATGTAGAA
AAGACAAAGCAGAAGAAGCGACAGCAGCTGGGAGAAGACTCTGGAAATGAGCTGGATCATGGGA
ACCCCGAAACCGCTGATTTTGCCTTGGCTGGTGTCTCAGCTGGACCTGGGACAGCTGAAAGGTG
TGGCCTGGCTGGACGAGAGCCGTACAAAGTTCAGGATCCCATGGAAGCATGGCTTACGACAGGA
CGCACAGATGGCTGACTTTGGCATCTTCCAGGCCTGGGCGGAAGCCAGTGGTGCCTACACCCCA
GGGAAGGATAAGCCAGACCTGTCAACCTGGAAGAGGAATTTCCGGTCAGCCCTGAACCGGAAAG
AAGTGTTGCGATTAGCTGAGGACCGGAGCAAGGACCCTTTTGACCCTCATAAAGTGTATGAGTT
TGTGACTCCAGGAGGAGCAAGGGACTTTGTACATCTGGACACCTCCCCTGACACCAATGGCAAA
AGCAGTCTGTCTGATCACCAGGAAGACCTCTTGGAATTACTCGATCACATGGCCTTGGGACCCC
TCCCAGATGAGGGGTCCTCAGACCTGCCTATTGCTTCTGATCCTTCTCAACCACCACTAAGCCC
CATTGTAAACAACTTCCCAAACCCAGCACCCCAGGAAAACCCACTAAGGCAGCTGCTAGCTGAG
GAACAGTGGGAGTTCGAGGTGACTGCCTTCTACCGAGGCCGCCAGGTCTTCCAGCAGACACTCT
TTTGCCCCGGGGGCCTGCGGCTGGTGGGCAGCACGTCTGACAACGGGACACTGCCCTGGCAGCC
AGTCACCCTGCCAGACCCTGAGGAGTTTCTGACAGACAGGCTTGTGAGGGAGTATGTGAGGCAG
GTACTCAAGGGGCTGGGCAAGGGGCTGGTGCTGTGGCGGGCAGGGCAGTGCCTCTGGGCCCAGC
GCCTAGGCCACTCGCATTCCTTCTGGGCCCTGGGTGAGGAGCTGCTTCCAGACAGTGGGAGAGG
GCCTGATGGAGAGGTCCCCAAGGACAAGAACGGAGTCGTGTTCGACCTCAGGCCCTTTGTGGCA
GATCTCATTGCCTTCATGGAAGGAAGCAGACATTCCCCACGATACACTCTGTGGTTCTGTGTGG
GGGAATCGTGGCCCCAGGACCAGCCGTGGGTCAAGAGGCTTGTGATGGTCAAGGTTGTTCCTAC
ATGTCTTAAGGAGCTGTTAGAGATGGCCCGGGAAGGGGGAGCCTCATCACTGAAAACCGTGGAC
TTGCACATCTCCAACAGCCAGCCGATCTCCCTTACCTCTGACCAGTACAAGGCCTGCCTCCAGG
ACTTGGTGGAAGACATGGACTTCCAGGCCACTGGAGAAACCTGAGCCCAGCTCAGCTGCTCCAA
TAAAGCAATTTATGCCACCATCACAA

hide sequence

RefSeq Acc Id:

XM_008759337 ⟹ XP_008757559

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	104,617,500 - 104,621,399 (+)	NCBI
mRatBN7.2	1	95,479,987 - 95,484,926 (+)	NCBI
Rnor_6.0	1	100,992,257 - 100,997,202 (+)	NCBI

Sequence:

show sequence

CCAAAAAAGGGCATTGAGGGAGTTAGGCCGGTTCAGTCGGAGTGTGCTCCTAGGTTTTCTGACT
TTTCTTAAAGTAAATGATGAGAAATTTTTTTTTTATCTCAAAATACCATTAGAAAGGAAAGTCC
CAACGCTCGGAAGCTTAGTTGACAAAGAAGGGGGTTGCGTGGCTGCGAGTCTCAACTACTGTTT
GGGAGCCCCAAAACCAGTGCTGACACCCGCGCCCCACGAGCGCGCAATTCCTCCCCTGGCTGGA
TCATGGGAACCCCGAAACCGCTGATTTTGCCTTGGCTGGTGTCTCAGCTGGACCTGGGACAGCT
GAAAGGTGTGGCCTGGCTGGACGAGAGCCGTACAAAGTTCAGGATCCCATGGAAGCATGGCTTA
CGACAGGACGCACAGATGGCTGACTTTGGCATCTTCCAGGAGGAGCAAGGGACTTTGTACATCT
GGACACCTCCCCTGACACCAATGGCAAAAGCAGTCTGTCTGATCACCAGGAAGACCTCTTGGAA
TTACTCGATCACATGGCCTTGGGACCCCTCCCAGATGAGGGGTCCTCAGACCTGCCTATTGCTT
CTGATCCTTCTCAACCACCACTAAGCCCCATTGTAAACAACTTCCCAAACCCAGCACCCCAGGA
AAACCCACTAAGGCAGCTGCTAGCTGAGGAACAGTGGGAGTTCGAGGTGACTGCCTTCTACCGA
GGCCGCCAGGTCTTCCAGCAGACACTCTTTTGCCCCGGGGGCCTGCGGCTGGTGGGCAGCACGT
CTGACAACGGGACACTGCCCTGGCAGCCAGTCACCCTGCCAGACCCTGAGGAGTTTCTGACAGA
CAGGCTTGTGAGGGAGTATGTGAGGCAGGTACTCAAGGGGCTGGGCAAGGGGCTGGTGCTGTGG
CGGGCAGGGCAGTGCCTCTGGGCCCAGCGCCTAGGCCACTCGCATTCCTTCTGGGCCCTGGGTG
AGGAGCTGCTTCCAGACAGTGGGAGAGGGCCTGATGGAGAGGTCCCCAAGGACAAGAACGGAGT
CGTGTTCGACCTCAGGCCCTTTGTGGCAGATCTCATTGCCTTCATGGAAGGAAGCAGACATTCC
CCACGATACACTCTGTGGTTCTGTGTGGGGGAATCGTGGCCCCAGGACCAGCCGTGGGTCAAGA
GGCTTGTGATGGTCAAGGTTGTTCCTACATGTCTTAAGGAGCTGTTAGAGATGGCCCGGGAAGG
GGGAGCCTCATCACTGAAAACCGTGGACTTGCACATCTCCAACAGCCAGCCGATCTCCCTTACC
TCTGACCAGTACAAGGCCTGCCTCCAGGACTTGGTGGAAGACATGGACTTCCAGGCCACTGGAG
AAACCTGAGCCCAGCTCAGCTGCTCCAATAAAGCAATTTATGCCACCATCACAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001006970	(Get FASTA)	NCBI Sequence Viewer
	XP_006229083	(Get FASTA)	NCBI Sequence Viewer
	XP_006229084	(Get FASTA)	NCBI Sequence Viewer
	XP_008757559	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH83776	(Get FASTA)	NCBI Sequence Viewer
	EDM07429	(Get FASTA)	NCBI Sequence Viewer
	EDM07430	(Get FASTA)	NCBI Sequence Viewer
	EDM07431	(Get FASTA)	NCBI Sequence Viewer
	EDM07432	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000027786
	ENSRNOP00000027786.5

RefSeq Acc Id:

NP_001006970 ⟸ NM_001006969

- UniProtKB:

Q5XIB0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MGTPKPLILPWLVSQLDLGQLKGVAWLDESRTKFRIPWKHGLRQDAQMADFGIFQAWAEASGAY
TPGKDKPDLSTWKRNFRSALNRKEVLRLAEDRSKDPFDPHKVYEFVTPGGARDFVHLDTSPDTN
GKSSLSDHQEDLLELLDHMALGPLPDEGSSDLPIASDPSQPPLSPIVNNFPNPAPQENPLRQLL
AEEQWEFEVTAFYRGRQVFQQTLFCPGGLRLVGSTSDNGTLPWQPVTLPDPEEFLTDRLVREYV
RQVLKGLGKGLVLWRAGQCLWAQRLGHSHSFWALGEELLPDSGRGPDGEVPKDKNGVVFDLRPF
VADLIAFMEGSRHSPRYTLWFCVGESWPQDQPWVKRLVMVKVVPTCLKELLEMAREGGASSLKT
VDLHISNSQPISLTSDQYKACLQDLVEDMDFQATGET

hide sequence

RefSeq Acc Id:	XP_006229083 ⟸ XM_006229021
- Peptide Label:	isoform X1
- UniProtKB:	F7EXX5 (UniProtKB/TrEMBL)
- Sequence:	show sequence MLHTKTLSQNIHKNNVEKTKQKKRQQLGEDSGNELRNCTVCAGWIMGTPKPLILPWLVSQLDLG QLKGVAWLDESRTKFRIPWKHGLRQDAQMADFGIFQAWAEASGAYTPGKDKPDLSTWKRNFRSA LNRKEVLRLAEDRSKDPFDPHKVYEFVTPGGARDFVHLDTSPDTNGKSSLSDHQEDLLELLDHM ALGPLPDEGSSDLPIASDPSQPPLSPIVNNFPNPAPQENPLRQLLAEEQWEFEVTAFYRGRQVF QQTLFCPGGLRLVGSTSDNGTLPWQPVTLPDPEEFLTDRLVREYVRQVLKGLGKGLVLWRAGQC LWAQRLGHSHSFWALGEELLPDSGRGPDGEVPKDKNGVVFDLRPFVADLIAFMEGSRHSPRYTL WFCVGESWPQDQPWVKRLVMVKVVPTCLKELLEMAREGGASSLKTVDLHISNSQPISLTSDQYK ACLQDLVEDMDFQATGET hide sequence

RefSeq Acc Id:

XP_006229084 ⟸ XM_006229022

- Peptide Label:

isoform X2

- Sequence:

show sequence

MSWIMGTPKPLILPWLVSQLDLGQLKGVAWLDESRTKFRIPWKHGLRQDAQMADFGIFQAWAEA
SGAYTPGKDKPDLSTWKRNFRSALNRKEVLRLAEDRSKDPFDPHKVYEFVTPGGARDFVHLDTS
PDTNGKSSLSDHQEDLLELLDHMALGPLPDEGSSDLPIASDPSQPPLSPIVNNFPNPAPQENPL
RQLLAEEQWEFEVTAFYRGRQVFQQTLFCPGGLRLVGSTSDNGTLPWQPVTLPDPEEFLTDRLV
REYVRQVLKGLGKGLVLWRAGQCLWAQRLGHSHSFWALGEELLPDSGRGPDGEVPKDKNGVVFD
LRPFVADLIAFMEGSRHSPRYTLWFCVGESWPQDQPWVKRLVMVKVVPTCLKELLEMAREGGAS
SLKTVDLHISNSQPISLTSDQYKACLQDLVEDMDFQATGET

hide sequence

RefSeq Acc Id:

XP_008757559 ⟸ XM_008759337

- Peptide Label:

isoform X3

- Sequence:

show sequence

MALGPLPDEGSSDLPIASDPSQPPLSPIVNNFPNPAPQENPLRQLLAEEQWEFEVTAFYRGRQV
FQQTLFCPGGLRLVGSTSDNGTLPWQPVTLPDPEEFLTDRLVREYVRQVLKGLGKGLVLWRAGQ
CLWAQRLGHSHSFWALGEELLPDSGRGPDGEVPKDKNGVVFDLRPFVADLIAFMEGSRHSPRYT
LWFCVGESWPQDQPWVKRLVMVKVVPTCLKELLEMAREGGASSLKTVDLHISNSQPISLTSDQY
KACLQDLVEDMDFQATGET

hide sequence

Ensembl Acc Id:

ENSRNOP00000027786 ⟸ ENSRNOT00000027786

Protein Domains

Interferon regulatory factor-3 IRF tryptophan pentad repeat

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5XIB0-F1-model_v2	AlphaFold	Q5XIB0	1-421	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1549774	AgrOrtholog
BioCyc Gene	G2FUF-59735	BioCyc
Ensembl Genes	ENSRNOG00000043388	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000027786	ENTREZGENE
	ENSRNOT00000027786.7	UniProtKB/TrEMBL
Gene3D-CATH	1.10.10.10	UniProtKB/TrEMBL
	2.60.200.10	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7193483	IMAGE-MGC_LOAD
InterPro	Interferon_regulatory_fac_CS	UniProtKB/TrEMBL
	Interferon_regulatory_factor	UniProtKB/TrEMBL
	Interferon_regulatory_factor-3	UniProtKB/TrEMBL
	SMAD_dom-like	UniProtKB/TrEMBL
	SMAD_FHA_domain	UniProtKB/TrEMBL
	WH-like_DNA-bd_sf	UniProtKB/TrEMBL
	WH_DNA-bd_sf	UniProtKB/TrEMBL
KEGG Report	rno:292892	UniProtKB/TrEMBL
MGC_CLONE	MGC:94729	IMAGE-MGC_LOAD
NCBI Gene	292892	ENTREZGENE
PANTHER	INTERFERON REGULATORY FACTOR	UniProtKB/TrEMBL
	INTERFERON REGULATORY FACTOR 3	UniProtKB/TrEMBL
Pfam	IRF	UniProtKB/TrEMBL
	IRF-3	UniProtKB/TrEMBL
PhenoGen	Irf3	PhenoGen
PRINTS	INTFRNREGFCT	UniProtKB/TrEMBL
PROSITE	IRF	UniProtKB/TrEMBL
	IRF_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000043388	RatGTEx
SMART	IRF	UniProtKB/TrEMBL
	IRF-3	UniProtKB/TrEMBL
Superfamily-SCOP	SMAD_FHA	UniProtKB/TrEMBL
	SSF46785	UniProtKB/TrEMBL
UniProt	A6JAV4_RAT	UniProtKB/TrEMBL
	A6JAV5_RAT	UniProtKB/TrEMBL
	F7EXX5	ENTREZGENE, UniProtKB/TrEMBL
	Q5XIB0	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2006-03-30	Irf3	interferon regulatory factor 3			Symbol and Name status set to approved	1299863	APPROVED
2005-09-15	Irf3	interferon regulatory factor 3			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)