JUN (Jun proto-oncogene, AP-1 transcription factor subunit)

Advanced Search (OLGA)

Gene: JUN (Jun proto-oncogene, AP-1 transcription factor subunit) Sus scrofa

Analyze

Symbol:

JUN

Name:

Jun proto-oncogene, AP-1 transcription factor subunit

RGD ID:

14217642

Description:

ENCODES a protein that exhibits DNA binding; chromatin binding (ortholog); DNA-binding transcription activator activity, RNA polymerase II-specific (ortholog); INVOLVED IN cellular response to lipopolysaccharide; immune response; positive regulation of DNA-binding transcription factor activity; PARTICIPATES IN adenosine signaling pathway; endothelin signaling pathway; fibroblast growth factor signaling pathway; ASSOCIATED WITH Alcohol-Related Disorders (ortholog); angiosarcoma (ortholog); Asphyxia (ortholog); FOUND IN nucleus; chromatin (ortholog); protein-containing complex (ortholog); INTERACTS WITH cadmium atom; cadmium dichloride; clofibrate

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

activator protein 1; AP1; C-JUN; proto-oncogene c-jun; transcription factor AP-1; transcription factor AP-1 subunit Jun; transcription factor Jun; V-jun avian sarcoma virus 17 oncogene homolog

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

Sscrofa11.1 - Pig Sscrofa11.1 Assembly

NCBI Annotation Information:

Annotation category: partial on reference assembly

Position:

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	153,685,682 - 153,687,636 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	153,686,425 - 153,687,635 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	141,231,122 - 141,232,332 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Alcohol-Related Disorders (ISO)

angiosarcoma (ISO)

Asphyxia (ISO)

basal cell carcinoma (ISO)

Brain Injuries (ISO)

brain ischemia (ISO)

breast cancer (ISO)

Breast Neoplasms (ISO)

chronic obstructive pulmonary disease (ISO)

Colonic Neoplasms (ISO)

colorectal adenocarcinoma (ISO)

colorectal adenoma (ISO)

COVID-19 (ISO)

depressive disorder (ISO)

endometrial adenocarcinoma (ISO)

endometrial carcinoma (ISO)

extrahepatic cholestasis (ISO)

glaucoma (ISO)

Heat Stroke (ISO)

hepatocellular carcinoma (ISO)

Hodgkin's lymphoma (ISO)

hypertension (ISO)

Intestinal Polyps (ISO)

juvenile rheumatoid arthritis (ISO)

Liver Neoplasms (ISO)

Lung Neoplasms (ISO)

Mercury Poisoning, Nervous System (ISO)

Nasal Polyps (ISO)

Neoplastic Cell Transformation (ISO)

Optic Nerve Injuries (ISO)

oral squamous cell carcinoma (ISO)

osteopetrosis (ISO)

osteosarcoma (ISO)

peripheral nervous system disease (ISO)

prostate adenocarcinoma (ISO)

prostate carcinoma (ISO)

Prostatic Neoplasms (ISO)

pulmonary emphysema (ISO)

pulmonary tuberculosis (ISO)

renal carcinoma (ISO)

renal cell carcinoma (ISO)

Reperfusion Injury (ISO)

silicosis (ISO)

Spinal Cord Injuries (ISO)

status epilepticus (ISO)

Stomach Neoplasms (ISO)

tongue squamous cell carcinoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

cadmium atom (EXP)

cadmium dichloride (EXP)

clofibrate (EXP)

deoxynivalenol (EXP)

hydrogen peroxide (EXP)

mercury dichloride (EXP)

oleanolic acid (EXP)

sarpogrelate (EXP)

serotonin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

angiogenesis (ISO)

apoptotic process (ISO)

axon regeneration (ISO)

cell population proliferation (ISO)

cellular response to anisomycin (ISO)

cellular response to calcium ion (ISO)

cellular response to hypoxia (ISO)

cellular response to lipopolysaccharide (IDA)

cellular response to potassium ion starvation (ISO)

cellular response to prolactin (ISO)

cellular response to zinc ion starvation (ISO)

circadian rhythm (ISO)

DNA-templated transcription (ISO)

eyelid development in camera-type eye (ISO)

immune response (IDA)

leading edge cell differentiation (ISO)

learning (ISO)

liver development (ISO)

membrane depolarization (ISO)

microglial cell activation (ISO)

monocyte differentiation (ISO)

negative regulation by host of viral transcription (IEA)

negative regulation of apoptotic process (ISO)

negative regulation of cell population proliferation (ISO)

negative regulation of DNA-templated transcription (IEA)

negative regulation of neuron apoptotic process (ISO)

negative regulation of protein autophosphorylation (ISO)

negative regulation of transcription by RNA polymerase II (IEA)

outflow tract morphogenesis (ISO)

positive regulation by host of viral transcription (IEA)

positive regulation of apoptotic process (IEA,ISO)

positive regulation of apoptotic signaling pathway (ISO)

positive regulation of cell population proliferation (ISO)

positive regulation of DNA replication (ISO)

positive regulation of DNA-binding transcription factor activity (IMP)

positive regulation of DNA-templated transcription (IEA,IMP,ISS)

positive regulation of DNA-templated transcription initiation (IEA)

positive regulation of endothelial cell proliferation (ISO)

positive regulation of epithelial cell migration (ISO)

positive regulation of ERK1 and ERK2 cascade (ISO)

positive regulation of fibroblast proliferation (ISO)

positive regulation of miRNA transcription (IEA)

positive regulation of monocyte differentiation (ISO)

positive regulation of neuron apoptotic process (ISO)

positive regulation of smooth muscle cell proliferation (ISO)

positive regulation of transcription by RNA polymerase II (IBA,IEA,ISO,ISS)

positive regulation of vascular associated smooth muscle cell proliferation (IEA)

regulation of cell cycle (IBA,ISO)

regulation of cell population proliferation (IBA)

regulation of DNA-templated transcription (IEA,ISO)

regulation of transcription by RNA polymerase II (IEA)

release from viral latency (IEA)

release of cytochrome c from mitochondria (ISO)

response to cAMP (ISO)

response to cytokine (ISO)

response to endoplasmic reticulum stress (IEA)

response to ethanol (ISO)

response to forskolin (ISO)

response to hydrogen peroxide (ISO)

response to insulin (ISO)

response to lipopolysaccharide (ISO)

response to mechanical stimulus (ISO)

response to muscle stretch (ISO)

response to steroid hormone (IBA,ISO)

response to xenobiotic stimulus (ISO)

SMAD protein signal transduction (IEA)

transcription by RNA polymerase II (ISO)

transforming growth factor beta receptor signaling pathway (IEA)

Cellular Component

chromatin (IEA,ISO)

euchromatin (IEA)

nucleoplasm (IEA)

nucleus (IDA,IEA,ISO)

protein-containing complex (ISO)

RNA polymerase II transcription regulator complex (IEA)

transcription factor AP-1 complex (IEA)

transcription regulator complex (IBA)

transcription repressor complex (ISO)

Molecular Function

cAMP response element binding (IEA)

chromatin binding (ISO)

DNA binding (IEA,IMP)

DNA-binding transcription activator activity, RNA polymerase II-specific (IEA,ISO)

DNA-binding transcription factor activity (IEA,ISO)

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA,IEA)

DNA-binding transcription repressor activity, RNA polymerase II-specific (IEA)

double-stranded DNA binding (ISO)

enzyme binding (IEA)

general transcription initiation factor binding (IEA)

GTPase activator activity (IEA)

HMG box domain binding (ISO)

identical protein binding (IEA,ISO)

protein binding (ISO)

protein-containing complex binding (ISO)

R-SMAD binding (IEA)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA,IEA)

RNA polymerase II-specific DNA-binding transcription factor binding (IEA)

sequence-specific DNA binding (ISO)

sequence-specific double-stranded DNA binding (IEA)

transcription cis-regulatory region binding (IEA,ISS)

transcription factor binding (ISO)

ubiquitin protein ligase binding (IEA)

ubiquitin-like protein ligase binding (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

adenosine signaling pathway (ISO)

endothelin signaling pathway (ISO)

fibroblast growth factor signaling pathway (ISO)

forkhead class A signaling pathway (ISO)

hypoxia inducible factor pathway (ISO)

interleukin-1 signaling pathway (ISO)

interleukin-2 signaling pathway (ISO)

interleukin-6 signaling pathway (ISO)

platelet-derived growth factor signaling pathway (ISO)

Rho/Rac/Cdc42 mediated signaling pathway (ISO)

sphingosine 1-phosphate signaling pathway (ISO)

References

Additional References at PubMed

PMID:8793856	PMID:8898353	PMID:14681463	PMID:22083952	PMID:23089279	PMID:25110868	PMID:28347884	PMID:28931675	PMID:30032202	PMID:32772776	PMID:33930700

Genomics

Comparative Map Data

JUN
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	153,685,682 - 153,687,636 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	153,686,425 - 153,687,635 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	141,231,122 - 141,232,332 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

JUN
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	58,780,791 - 58,784,047 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	58,776,845 - 58,784,048 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	59,246,463 - 59,249,719 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	59,019,051 - 59,022,373 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	58,958,483 - 58,961,806	NCBI
Celera	1	57,530,296 - 57,533,618 (-)	NCBI		Celera
Cytogenetic Map	1	p32.1	NCBI
HuRef	1	57,356,787 - 57,360,109 (-)	NCBI		HuRef
CHM1_1	1	59,361,828 - 59,365,150 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	58,659,236 - 58,662,492 (-)	NCBI		T2T-CHM13v2.0

Jun
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	94,937,273 - 94,940,459 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	94,937,271 - 94,940,459 (-)	Ensembl		GRCm39 Ensembl
GRCm38	4	95,049,036 - 95,052,222 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	95,049,034 - 95,052,222 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	94,715,727 - 94,718,913 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	94,541,073 - 94,544,205 (-)	NCBI		MGSCv36	mm8
Celera	4	93,436,543 - 93,439,728 (-)	NCBI		Celera
Cytogenetic Map	4	C5	NCBI
cM Map	4	43.34	NCBI

Jun
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	115,009,900 - 115,012,993 (-)	NCBI		GRCr8
mRatBN7.2	5	109,894,175 - 109,897,268 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	109,893,145 - 109,897,656 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	112,464,752 - 112,467,841 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	114,190,270 - 114,193,359 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	114,252,804 - 114,255,893 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	114,011,184 - 114,014,277 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	114,011,189 - 114,014,277 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	117,957,730 - 117,960,823 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	115,358,166 - 115,361,259 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	115,363,396 - 115,365,980 (-)	NCBI
Celera	5	108,510,040 - 108,513,133 (-)	NCBI		Celera
Cytogenetic Map	5	q33	NCBI

Jun
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955464	1,107,598 - 1,110,326 (+)	NCBI	ChiLan1.0	ChiLan1.0

JUN
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	168,063,962 - 168,067,574 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	167,218,036 - 167,219,853 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	58,042,794 - 58,045,536 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	59,747,129 - 59,750,446 (-)	NCBI	panpan1.1	PanPan1.1	panPan2

JUN
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	50,966,698 - 50,968,939 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	51,033,459 - 51,034,786 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	51,147,773 - 51,149,113 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	51,148,001 - 51,149,014 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	51,098,106 - 51,099,438 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	51,043,349 - 51,044,688 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	51,326,980 - 51,328,311 (+)	NCBI		UU_Cfam_GSD_1.0

Jun
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	72,379,192 - 72,381,903 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936522	3,035,346 - 3,036,350 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936522	3,034,364 - 3,037,632 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

JUN
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	74,204,481 - 74,207,835 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	74,205,542 - 74,206,546 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666033	43,155,224 - 43,158,790 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Jun
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624862	1,538,455 - 1,539,426 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624862	1,537,886 - 1,540,633 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in JUN
44 total Variants

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_213880	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AEMK02000048	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK239057	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK240428	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK395746	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK396312	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK396996	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK400672	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CU695066	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GFLN01132368	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	S83515	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSSSCT00000057200 ⟹ ENSSSCP00000078233

Type:

CODING

Position:

Pig Assembly	Chr	Position (strand)	Source
Sscrofa11.1 Ensembl	6	153,685,682 - 153,687,636 (+)	Ensembl

RefSeq Acc Id:

NM_213880 ⟹ NP_999045

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Pig Assembly	Chr	Position (strand)	Source
Sscrofa11.1	6	153,686,425 - 153,687,635 (+)	NCBI

Sequence:

show sequence

GAATTCGCGGTCGCTGGTGAGGAGGGCGCAGTGGGGAGGCCAGCCGGCGGCGGTGCGCGCTCTT
AGAGAAACTTTCCTCCTTCACGGTCCCGGGAAGCGCGGGTGTCCCCCGTTTGCCAGCGCGCTGT
TGCGGCCCCGAAACTTCTGCGCGCAACCCAAACTCACCCCACGTGAAGTGACGGACTGTTCTAT
GACTGCAAAGATGGAAACGACCTTCTACGACGATGCCCTCAACGCCTCGTTCCTCCAGTCCGAG
AGCGGTGCCTACGGCTACAGTAACCCCAAGATCCTGAAGCAGAGCATGACCCTGAACCTGGCTG
ACCCGGTGGGCAACCTGAAGCCGCACCTACGGGCCCAGGACTCGGACCTCCTCACCTCGCCCGA
CGTGGGGTTGCTCAAGCTGGCGTCGCCCGAACTCGAGCGCCTGATAATCCAGTCCAGTAACGGG
CACATCACCACCACGCCGACCCCTACCCAGTTCCTATGCCCCAAGAACGTGACTGACGAGCAGG
AGGGCTTCGCCGAGGGGTTCGTGCGCGCGCTGGCCGAACTGCACAGCCAGAACACTCTGCCCAG
CGTCACGTCGGCGGCGCAGCCGGTCAGCGGGGCGGGCCTGGTGGCTCCGGCGGTAGCTTCAGTG
GCGGGCGGCAGCGGCAGCGGCGGCTTCAGCGCCAGCCTACACAGCGAGCCGCCAGTCTACGCTA
ATCTCAGCAACTTCAACCCCGGCGCGCTGAGCAGCGGCGGCGGGGCGCCCTCCTACGGCGCGGC
GGGCCTGGCCTTTCCCGCTCAGCCCCAGCAGCAGCAACAGCAACCACCGCAGCCGCCGCACCAC
CTGCCCGTGCAGCACCCCCGTCTGCAGGCCCTGAAGGAGGAGCCGCAGACGGTGCCCGAGATGC
CCGGGGAAACACCGCCCCTGTCTCCCATCGACATGGAGTCGCAGGAGCGGATCAAGGCGGAGAG
GAAGCGTATGAGGAACCGCATCGCTGCCTCCAAGTGCCGGAAAAGGAAGCTGGAGAGGATCGCC
CGGCTGGAGGAAAAAGTGAAAACCTTGAAAGCGCAGAACTCGGAGCTGGCGTCCACCGCCAACA
TGCTCAGGGAACAGGTGGCCCAGCTTAAACAAAAAGTCATGAACCACGTTAACAGTGGGTGCCA
ACTCATGCTAACGCAGCAGTTGCAAACGTTTTGAGGCGAGACTGTTGGGGGCTGAGGGGGCGAC
CGGGAATTC

hide sequence

Protein Sequences


Protein RefSeqs	NP_999045	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB50808	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSSSCP00000078233
	ENSSSCP00000078233.1
	ENSSSCP00070051691.1
GenBank Protein	P56432	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_999045 ⟸ NM_213880

- UniProtKB:

P56432 (UniProtKB/Swiss-Prot), A0A4X1WB31 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGNLKPHLRAQDSDLLTSP
DVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLP
SVTSAAQPVSGAGLVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGA
AGLAFPAQPQQQQQQPPQPPHHLPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAE
RKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGC
QLMLTQQLQTF

hide sequence

Ensembl Acc Id:

ENSSSCP00000078233 ⟸ ENSSSCT00000057200

Protein Domains

bZIP

Additional Information

External Database Links

Database	Acc Id	Source(s)
Ensembl Genes	ENSSSCG00000031912	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
	ENSSSCG00070030158	UniProtKB/TrEMBL
Ensembl Transcript	ENSSSCT00000057200	ENTREZGENE
	ENSSSCT00000057200.3	UniProtKB/TrEMBL
	ENSSSCT00070060650.1	UniProtKB/TrEMBL
Gene3D-CATH	1.20.5.170	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	AP-1_TF_bZIP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	bZIP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	bZIP_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	JNK	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Leuzip_Jun	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TF_DNA-bd_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	ssc:396913	UniProtKB/Swiss-Prot
NCBI Gene	JUN	ENTREZGENE
PANTHER	JUN TRANSCRIPTION FACTOR-RELATED	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR11462:SF8	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	bZIP_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Jun	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PRINTS	LEUZIPPRJUN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	BZIP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	BZIP_BASIC	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	BRLZ	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	A DNA-binding domain in eukaryotic transcription factors	UniProtKB/TrEMBL
	Leucine zipper domain	UniProtKB/TrEMBL
	SSF47454	UniProtKB/Swiss-Prot
	SSF57959	UniProtKB/Swiss-Prot
UniProt	A0A4X1WB31	ENTREZGENE, UniProtKB/TrEMBL
	A0A8W4FIU6_PIG	UniProtKB/TrEMBL
	JUN_PIG	UniProtKB/Swiss-Prot, ENTREZGENE

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - PID (archival)