Skp1 (S-phase kinase-associated protein 1)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Skp1 (S-phase kinase-associated protein 1) Rattus norvegicus

Analyze

Symbol:

Skp1

Name:

S-phase kinase-associated protein 1

RGD ID:

1359648

Description:

Predicted to enable several functions, including F-box domain binding activity; beta-catenin binding activity; and cullin family protein binding activity. Predicted to be involved in several processes, including SCF-dependent proteasomal ubiquitin-dependent protein catabolic process; maintenance of protein location in nucleus; and protein ubiquitination. Located in gap junction. Orthologous to human SKP1 (S-phase kinase associated protein 1); PARTICIPATES IN Notch signaling pathway; nuclear factor kappa B signaling pathway; nuclear factor, erythroid 2 like 2 signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; acrylamide; Brodifacoum.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

cyclin A/CDK2-associated p19; cyclin A/CDK2-associated protein p19; cyclin-A/CDK2-associated protein p19; organ of Corti protein 2; p19A; p19skp1; RNA polymerase II elongation factor-like protein OCP2; S-phase kinase-associated protein 1A; Skp1a; transcription elongation factor B (SIII), polypeptide 1-like

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SKP1 (S-phase kinase associated protein 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Skp1 (S-phase kinase-associated protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Skp1 (S-phase kinase associated protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SKP1 (S-phase kinase associated protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SKP1 (S-phase kinase associated protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Skp1 (S-phase kinase associated protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SKP1 (S-phase kinase associated protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SKP1 (S-phase kinase associated protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Skp1 (S-phase kinase associated protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	LIG3 (DNA ligase 3)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	SKP1 (S-phase kinase associated protein 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Skp1 (S-phase kinase-associated protein 1)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	skp1 (S-phase kinase-associated protein 1)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	skr-10	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	skr-13	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	skr-14	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	skr-15	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	skr-16	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	skr-17	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	skr-18	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	skr-19	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	skr-20	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	skr-21	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	skr-7	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	skr-8	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	skr-9	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	skr-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	SKP1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	SkpA	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	SkpB	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	SkpC	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	SkpE	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	SkpF	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	skr-12	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	skr-2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	skr-3	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	skr-4	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	SkpD	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	skr-5	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	skr-6	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	skp1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	10	36,401,987 - 36,417,066 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	36,402,153 - 36,417,388 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	41,096,029 - 41,110,942 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	40,585,994 - 40,600,907 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	36,089,722 - 36,104,635 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	37,594,578 - 37,609,498 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	37,594,578 - 37,609,498 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	37,368,051 - 37,383,130 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	37,665,417 - 37,680,338 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	37,671,846 - 37,686,768 (+)	NCBI
Celera	10	35,756,586 - 35,771,498 (+)	NCBI		Celera
Cytogenetic Map	10	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

familial adenomatous polyposis 1 (ISO)

genetic disease (ISO)

Hereditary Neoplastic Syndromes (ISO)

Keratoconus 1 (ISO)

Neurodevelopmental Disorders (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

17alpha-ethynylestradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-tribromophenol (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

5-aza-2'-deoxycytidine (ISO)

acrylamide (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

bisphenol A (ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

Brodifacoum (EXP)

calycosin (ISO)

cannabidiol (ISO)

carbamazepine (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

clofibrate (ISO)

clozapine (ISO)

coumarin (ISO)

Cuprizon (ISO)

cyclosporin A (ISO)

decabromodiphenyl ether (ISO)

deguelin (ISO)

dexamethasone (ISO)

dicrotophos (ISO)

dimethylarsinous acid (ISO)

disodium selenite (ISO)

endosulfan (EXP)

ethanol (ISO)

fipronil (EXP)

flutamide (EXP)

folpet (ISO)

fulvestrant (ISO)

graphite (ISO)

indometacin (ISO)

inulin (ISO)

ivermectin (ISO)

methidathion (ISO)

methylisothiazolinone (ISO)

methylmercury chloride (ISO)

N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO)

nefazodone (EXP)

nimesulide (EXP)

paracetamol (ISO)

pentachlorophenol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

pirinixic acid (ISO)

piroxicam (ISO)

sertraline (ISO)

sodium arsenite (EXP,ISO)

sodium fluoride (ISO)

T-2 toxin (EXP)

thapsigargin (EXP)

trichloroethene (EXP)

triptonide (ISO)

urethane (ISO)

valproic acid (ISO)

vitamin E (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

chromatin remodeling (IEA,ISO)

maintenance of protein location in nucleus (IEA,ISO)

proteasome-mediated ubiquitin-dependent protein catabolic process (ISO)

protein K48-linked ubiquitination (IEA,ISO)

protein monoubiquitination (IEA,ISO)

protein polyubiquitination (ISO)

protein ubiquitination (IEA,ISO)

SCF-dependent proteasomal ubiquitin-dependent protein catabolic process (IBA,IEA,ISO,ISS)

ubiquitin-dependent protein catabolic process (IEA)

Cellular Component

centrosome (IEA,ISO)

Cul7-RING ubiquitin ligase complex (IEA,ISO,ISS)

cytoplasm (IBA,ISO)

cytosol (IEA,ISO,ISS)

gap junction (IDA)

nucleus (IBA,ISO)

PcG protein complex (IEA,ISO)

SCF ubiquitin ligase complex (IEA,ISO,ISS)

Molecular Function

beta-catenin binding (IEA,ISO)

cullin family protein binding (IBA,IEA,ISO)

F-box domain binding (IEA,ISO)

molecular function activator activity (IEA,ISO)

protein binding (IPI,ISO)

protein domain specific binding (ISO)

ubiquitin ligase complex scaffold activity (IEA,ISO)

ubiquitin ligase-substrate adaptor activity (IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

cell cycle pathway, mitotic (IEA)

Endoplasmic Reticulum-associated degradation pathway (IEA)

Notch signaling pathway (ISO)

nuclear factor kappa B signaling pathway (ISO)

nuclear factor, erythroid 2 like 2 signaling pathway (ISO)

transforming growth factor-beta superfamily mediated signaling pathway (IEA)

ubiquitin/proteasome degradation pathway (IEA)

Wnt signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	The Nrf2 regulatory network provides an interface between redox and intermediary metabolism.	Hayes JD and Dinkova-Kostova AT, Trends Biochem Sci. 2014 Apr;39(4):199-218. doi: 10.1016/j.tibs.2014.02.002. Epub 2014 Mar 16.
3.	OCP2 immunoreactivity in the human fetal cochlea at weeks 11, 17, 20, and 28, and the human adult cochlea.	Kammen-Jolly K, etal., Hear Res. 2002 May;167(1-2):102-9. doi: 10.1016/s0378-5955(02)00354-4.
4.	ATP-dependent activation of p21WAF1/CIP1-associated Cdk2 by Cdc6.	Kan Q, etal., Proc Natl Acad Sci U S A. 2008 Mar 25;105(12):4757-62. doi: 10.1073/pnas.0706392105. Epub 2008 Mar 20.
5.	Expanding role of ubiquitination in NF-kappaB signaling.	Liu S and Chen ZJ, Cell Res. 2011 Jan;21(1):6-21. Epub 2010 Dec 7.
6.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
7.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
8.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
9.	GOA pipeline	RGD automated data pipeline
10.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
11.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
12.	A family of mammalian F-box proteins.	Winston JT, etal., Curr Biol 1999 Oct 21;9(20):1180-2.

Additional References at PubMed

PMID:10485847	PMID:11158290	PMID:11956208	PMID:12140560	PMID:12665572	PMID:12820959	PMID:14673179	PMID:15103331	PMID:15145941	PMID:15489334	PMID:15996101	PMID:16880511
PMID:16943429	PMID:18498745	PMID:18929646	PMID:19028597	PMID:20347421	PMID:20596027	PMID:21378169	PMID:21572392	PMID:21572988	PMID:21725316	PMID:22258892	PMID:22871113
PMID:22972877	PMID:23263282	PMID:23376485	PMID:23452856	PMID:25585578	PMID:28007894	PMID:29593216

Genomics

Comparative Map Data

Skp1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	10	36,401,987 - 36,417,066 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	36,402,153 - 36,417,388 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	41,096,029 - 41,110,942 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	40,585,994 - 40,600,907 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	36,089,722 - 36,104,635 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	37,594,578 - 37,609,498 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	37,594,578 - 37,609,498 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	37,368,051 - 37,383,130 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	37,665,417 - 37,680,338 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	37,671,846 - 37,686,768 (+)	NCBI
Celera	10	35,756,586 - 35,771,498 (+)	NCBI		Celera
Cytogenetic Map	10	q22	NCBI

SKP1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	134,148,935 - 134,176,950 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	134,148,935 - 134,176,964 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	5	133,484,626 - 133,512,641 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	133,520,468 - 133,540,583 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	5	133,520,467 - 133,540,583	NCBI
Celera	5	129,615,775 - 129,636,409 (-)	NCBI		Celera
Cytogenetic Map	5	q31.1	NCBI
HuRef	5	128,677,052 - 128,697,683 (-)	NCBI		HuRef
CHM1_1	5	132,924,656 - 132,945,272 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	5	134,672,565 - 134,700,570 (-)	NCBI		T2T-CHM13v2.0

Skp1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	52,121,349 - 52,137,685 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	52,122,822 - 52,137,685 (+)	Ensembl		GRCm39 Ensembl
GRCm38	11	52,230,522 - 52,246,858 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	52,231,995 - 52,246,858 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	52,045,497 - 52,060,360 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	52,075,432 - 52,090,281 (+)	NCBI		MGSCv36	mm8
Celera	11	56,801,165 - 56,816,028 (+)	NCBI		Celera
Cytogenetic Map	11	B1.3	NCBI
cM Map	11	31.86	NCBI

Skp1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955408	5,392,839 - 5,412,644 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955408	5,393,851 - 5,412,644 (-)	NCBI	ChiLan1.0	ChiLan1.0

SKP1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	5	127,595,401 - 127,617,859 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	129,560,086 - 129,580,188 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	135,713,085 - 135,732,665 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	135,713,085 - 135,729,653 (-)	Ensembl	panpan1.1		panPan2

SKP1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	11	22,352,735 - 22,366,599 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	11	22,352,439 - 22,364,024 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	11	21,098,642 - 21,112,489 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	11	23,152,831 - 23,168,252 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	11	23,152,162 - 23,164,892 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	11	21,853,772 - 21,867,627 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	11	21,718,806 - 21,732,658 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	11	22,361,395 - 22,375,242 (-)	NCBI		UU_Cfam_GSD_1.0

Skp1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	114,070,872 - 114,088,084 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936647	1,072,855 - 1,094,139 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936647	1,073,647 - 1,090,841 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SKP1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	136,458,949 - 136,476,005 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	136,458,772 - 136,476,364 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

SKP1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	23	36,961,572 - 36,978,849 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	23	36,962,328 - 36,978,757 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666034	40,956,691 - 40,974,891 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Skp1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624733	38,051,280 - 38,069,648 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Skp1
46 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	539
Count of miRNA genes:	265
Interacting mature miRNAs:	326
Transcripts:	ENSRNOT00000007676
Prediction methods:	Microtar, Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
634327	Hc4	Hypercalciuria QTL 4	2.4		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	10	1	38328221	Rat
7411611	Foco17	Food consumption QTL 17	18.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	10	1	42315980	Rat
70223	Bp57	Blood pressure QTL 57	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	1	80676123	Rat
10401803	Kidm50	Kidney mass QTL 50			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	10	418344	45418344	Rat
631554	Bp133	Blood pressure QTL 133		0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	743364	63851208	Rat
2313064	Bmd71	Bone mineral density QTL 71	0.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	10	5387014	50387014	Rat
2313066	Bss63	Bone structure and strength QTL 63	1.4	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	10	5387014	50387014	Rat
2313081	Bss64	Bone structure and strength QTL 64	1.3	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	10	5387014	50387014	Rat
2313095	Bss62	Bone structure and strength QTL 62	1.5	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	5387014	50387014	Rat
2313104	Bss61	Bone structure and strength QTL 61	0.9	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	10	5387014	50387014	Rat
2298544	Neuinf9	Neuroinflammation QTL 9	4.6		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	10	5801990	62146030	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6154182	73453136	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6357896	96121100	Rat
1578761	Stresp21	Stress response QTL 21	3.3		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	6375746	51375746	Rat
2303118	Mamtr7	Mammary tumor resistance QTL 7		0.003	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	9658275	104670812	Rat
9590310	Scort19	Serum corticosterone level QTL 19	6.3	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
9590268	Scort13	Serum corticosterone level QTL 13	3.26	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
9589136	Insul27	Insulin level QTL 27	10.46	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	10	11474010	56474010	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14487011	89062041	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14487011	104060283	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14487011	107057807	Rat
1354587	Kidm21	Kidney mass QTL 21	3.3		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	10	15028513	60430477	Rat
631564	Apr3	Acute phase response QTL 3	3.9		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	10	15275955	60275955	Rat
6893350	Bw99	Body weight QTL 99	0.87	0.16	body mass (VT:0001259)	body weight (CMO:0000012)	1	15906665	60906665	Rat
6893352	Bw100	Body weight QTL 100	0.33	0.6	body mass (VT:0001259)	body weight (CMO:0000012)	1	15906665	60906665	Rat
631532	Cm50	Cardiac mass QTL 50	6.6		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	10	17907113	51786432	Rat
1598852	Anxrr19	Anxiety related response QTL 19	5.07		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	10	18167841	63167841	Rat
2313055	Bw96	Body weight QTL 96	3.6	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	10	19606483	64606483	Rat
2313087	Bmd80	Bone mineral density QTL 80	3.2	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	10	19606483	64606483	Rat
1554317	Bmd4	Bone mineral density QTL 4	9.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	19816042	99406971	Rat
1581497	Esta1	Estrogen-induced thymic atrophy QTL 1			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	21329805	61345413	Rat
724556	Pur2	Proteinuria QTL 2	5.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	22427500	90627625	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
70224	Eae3	Experimental allergic encephalomyelitis QTL 3	4.1		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	10	26521957	61345413	Rat
1298069	Bp168	Blood pressure QTL 168	5.5		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	10	26521957	98003205	Rat
631542	Bp82	Blood pressure QTL 82	6.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	26521957	98952741	Rat
2300171	Bmd58	Bone mineral density QTL 58	4.9	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	26944628	71944628	Rat
10402859	Bp381	Blood pressure QTL 381		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
2292441	Bp308	Blood pressure QTL 308			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
724527	Bp148	Blood pressure QTL 148		0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	28453136	73453136	Rat
1600371	Mcs21	Mammary carcinoma susceptibility QTL 21	3		mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	28875650	52200160	Rat
1331762	Rf40	Renal function QTL 40	3.873		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	10	29299504	64155584	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29299504	107211142	Rat
631557	Bp136	Blood pressure QTL 136		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	30632053	75632053	Rat
1576311	Pia26	Pristane induced arthritis QTL 26			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	31224026	75632053	Rat
1578779	Tcas10	Tongue tumor susceptibility QTL 10	3.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	10	31297439	76297439	Rat
1576319	Cia29	Collagen induced arthritis QTL 29			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	33973921	78973921	Rat
61332	Eau3	Experimental allergic uveoretinitis QTL 3		0.004	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	10	34490559	45579777	Rat
1354614	Hpcl1	Hepatic cholesterol level QTL 1	3.3		liver cholesterol amount (VT:0010498)	liver cholesterol level (CMO:0001597)	10	35392267	51793994	Rat
1358897	Stresp6	Stress response QTL 6	4.17	0.022	blood norepinephrine amount (VT:0005663)	plasma norepinephrine level (CMO:0001010)	10	35392267	64155584	Rat
61441	Btemp1	Thermal response to stress QTL 1	4		body temperature trait (VT:0005535)	core body temperature (CMO:0001036)	10	35392457	63642539	Rat

Markers in Region

Tceb1l-rs1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Rnor_5.0	18	35,610,106 - 35,610,325	NCBI	Rnor5.0
Rnor_5.0	18	35,405,109 - 35,405,328	NCBI	Rnor5.0
Rnor_5.0	10	37,382,354 - 37,382,565	NCBI	Rnor5.0
RGSC_v3.4	10	37,679,722 - 37,679,932	UniSTS	RGSC3.4
RGSC_v3.4	18	38,158,463 - 38,158,681	UniSTS	RGSC3.4
Celera	10	35,770,882 - 35,771,092	UniSTS
Cytogenetic Map	18	q11	UniSTS
Cytogenetic Map	10	q22	UniSTS

RH137096

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	36,416,641 - 36,416,847 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	37,609,233 - 37,609,438	NCBI	Rnor6.0
Rnor_5.0	10	37,382,706 - 37,382,911	UniSTS	Rnor5.0
RGSC_v3.4	10	37,680,073 - 37,680,278	UniSTS	RGSC3.4
Celera	10	35,771,233 - 35,771,438	UniSTS
Cytogenetic Map	10	q22	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	43	57	41	19	41	8	11	74	35	41	11	8
Low
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001007608	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085386	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC130253	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC058152	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ210698	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212502	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212528	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212745	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212916	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213991	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214369	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214470	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214982	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215334	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215452	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216265	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219088	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219401	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ222532	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ224225	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ224935	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229076	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229788	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ230709	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ230985	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000219	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000007676 ⟹ ENSRNOP00000007676

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	36,407,035 - 36,417,388 (+)	Ensembl
Rnor_6.0 Ensembl	10	37,594,578 - 37,609,498 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000085463 ⟹ ENSRNOP00000073214

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	36,402,153 - 36,417,058 (+)	Ensembl
Rnor_6.0 Ensembl	10	37,594,824 - 37,609,498 (+)	Ensembl

RefSeq Acc Id:

NM_001007608 ⟹ NP_001007609

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	10	36,401,987 - 36,416,907 (+)	NCBI
Rnor_6.0	10	37,594,578 - 37,609,498 (+)	NCBI
Rnor_5.0	10	37,368,051 - 37,383,130 (+)	NCBI
RGSC_v3.4	10	37,665,417 - 37,680,338 (+)	RGD
Celera	10	35,756,586 - 35,771,498 (+)	RGD

Sequence:

show sequence

GTAGTGGCCTTGTTCTCGAGACTTCTATTCGGTTGTGAACTCTGTTCGGCAGCCTCAGGCCTGC
GGTCTTGAGACCGAGCACGATGCCTACGATAAAGTTGCAGAGTTCTGATGGAGAGATATTTGAA
GTTGATGTAGAAATTGCCAAACAATCTGTGACCATTAAGACCATGCTGGAAGATTTGGGAATGG
ATGATGAGGGAGATGATGATCCTGTTCCTTTACCAAATGTTAATGCAGCAATTCTAAAAAAGGT
CATTCAGTGGTGCACCCACCACAAGGATGACCCTCCTCCTCCTGAGGATGATGAGAACAAAGAG
AAGCGGACAGATGATATTCCTGTTTGGGACCAAGAATTCCTGAAAGTTGACCAAGGAACACTTT
TTGAACTTATTCTGGCTGCAAACTACTTAGACATCAAAGGTTTGCTTGATGTCACCTGCAAGAC
TGTGGCTAATATGATTAAGGGGAAAACGCCTGAGGAGATTCGTAAAACCTTCAATATCAAAAAT
GACTTTACTGAAGAGGAGGAGGCCCAGGTACGCAAAGAGAACCAGTGGTGTGAAGAGAAGTGAA
CTGTGCCTGTCACTGTAACACTAGAAGGGTTGTTCCAAATGCTAGTTGCACTGCTCTGTTTATA
ATTGTTAATATTAGAGATCAGTAGACAAACACAGCCTTGTCCTCACTGCATGTGTAGTTCCAGT
ACAGATCAGACCTGTGGCTGAGTTTCTTCTATGAGCAGAAGTTTCCTTTTTCCCCCCATTACTC
CGAATAAAACCGAACTATGGGTTCTCTGTGGAAAGTGGCATTTTGGGCTTTCCCTCTTTCTGTA
AAGTGATTTCTCCCTCTAGTTCATTGTCCAGTTAACTTCAGTGAGCCTTTCAAGGTTGGCATTG
TAAATAAAACAACTTAGGAGAGAAGTATGCAGAAATAAAATTAACAAAACATTTGTTCATGAAT
CGGAAACTGGAACAAGGCAACTTGAAGTTAACGGTGCGGATGTCTTCCGACCTCTATGCTGCTG
GTAAGCTCGTGTGCAGCTGGGCTCTCTTAATTGGATCTGAGGCCTTGTTTTGTCTTTTTGGTTT
TTTAATCTTCTCAGCTTTGAATACGTTGCCTAGAGACTTAGTTTACTACCCAGTTTGTGGTTTG
GGAGGGGGGACTGTAACTCAACAATTTGTTAGCTTTTCAATTAAAAAAGACACTTACTTCATAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039085386 ⟹ XP_038941314

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	10	36,402,173 - 36,417,066 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001007609	(Get FASTA)	NCBI Sequence Viewer
	XP_038941314	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH58152	(Get FASTA)	NCBI Sequence Viewer
	EDM04355	(Get FASTA)	NCBI Sequence Viewer
	EDM04356	(Get FASTA)	NCBI Sequence Viewer
	EDM04357	(Get FASTA)	NCBI Sequence Viewer
	Q6PEC4	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001007609 ⟸ NM_001007608
- UniProtKB:	Q6PEC4 (UniProtKB/Swiss-Prot), A6HEA2 (UniProtKB/TrEMBL), A0A8L2Q2U6 (UniProtKB/TrEMBL)
- Sequence:	show sequence MPTIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTH HKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIK GKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK hide sequence

RefSeq Acc Id:

ENSRNOP00000073214 ⟸ ENSRNOT00000085463

RefSeq Acc Id:

ENSRNOP00000007676 ⟸ ENSRNOT00000007676

RefSeq Acc Id:	XP_038941314 ⟸ XM_039085386
- Peptide Label:	isoform X1
- UniProtKB:	A0A0G2K4X8 (UniProtKB/TrEMBL), A0A8L2Q2U6 (UniProtKB/TrEMBL)

Protein Domains

SKP1 component dimerisation SKP1 component POZ

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6PEC4-F1-model_v2	AlphaFold	Q6PEC4	1-163	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1359648	AgrOrtholog
BioCyc Gene	G2FUF-25175	BioCyc
Ensembl Genes	ENSRNOG00000005828	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000007676	ENTREZGENE
	ENSRNOP00000007676.6	UniProtKB/TrEMBL
	ENSRNOP00000073214	ENTREZGENE
	ENSRNOP00000073214.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000007676	ENTREZGENE
	ENSRNOT00000007676.8	UniProtKB/TrEMBL
	ENSRNOT00000085463	ENTREZGENE
	ENSRNOT00000085463.2	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:6890712	IMAGE-MGC_LOAD
InterPro	SKP1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SKP1-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SKP1-like_dim_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SKP1/BTB/POZ_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Skp1_comp_dimer	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Skp1_comp_POZ	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:287280	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72936	IMAGE-MGC_LOAD
NCBI Gene	287280	ENTREZGENE
PANTHER	PTHR11165	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	S-PHASE KINASE-ASSOCIATED PROTEIN 1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Skp1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Skp1_POZ	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Skp1	PhenoGen
PIRSF	E3_ubiquit_lig_SCF_Skp	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	Skp1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF54695	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SSF81382	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A0G2K4X8	ENTREZGENE, UniProtKB/TrEMBL
	A0A8L2Q2U6	ENTREZGENE, UniProtKB/TrEMBL
	A6HEA2	ENTREZGENE, UniProtKB/TrEMBL
	Q6PEC4	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-09-19	Skp1	S-phase kinase-associated protein 1	Skp1a	S-phase kinase-associated protein 1A	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Skp1a	S-phase kinase-associated protein 1A			Symbol and Name status set to approved	1299863	APPROVED
2005-07-29	Skp1a	S-phase kinase-associated protein 1A			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)