Advanced Search (OLGA)

Gene: Kyat3 (kynurenine aminotransferase 3) Rattus norvegicus

Analyze

Symbol:

Kyat3

Name:

kynurenine aminotransferase 3

RGD ID:

1359262

Description:

Predicted to enable kynurenine-glyoxylate transaminase activity; kynurenine-oxoglutarate transaminase activity; and protein homodimerization activity. Predicted to be involved in 2-oxoglutarate metabolic process and kynurenine metabolic process. Predicted to be active in mitochondrion. Orthologous to human KYAT3 (kynurenine aminotransferase 3); PARTICIPATES IN kynurenine metabolic pathway; selenoamino acid metabolic pathway; tryptophan metabolic pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Ccbl2; cysteine conjugate-beta lyase 2; cysteine-S-conjugate beta-lyase 2; Kat3; KATIII; kynurenine aminotransferase III; kynurenine aminotransferase III-like; kynurenine--glyoxylate transaminase; kynurenine--oxoglutarate transaminase 3; kynurenine--oxoglutarate transaminase III; LOC100361841

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	KYAT3 (kynurenine aminotransferase 3)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):	Kyat3 (kynurenine aminotransferase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Kyat3 (kynurenine aminotransferase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	KYAT3 (kynurenine aminotransferase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	KYAT3 (kynurenine aminotransferase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Kyat3 (kynurenine aminotransferase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	KYAT3 (kynurenine aminotransferase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	KYAT3 (kynurenine aminotransferase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Kyat3 (kynurenine aminotransferase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Kyat3 (kynurenine aminotransferase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	KYAT3 (kynurenine aminotransferase 3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Kyat3 (kynurenine aminotransferase 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	si:ch73-97h19.2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	BNA3	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG6950	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG6950	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	kyat3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	kyat3	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	nkat-1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	nkat-1	Alliance	DIOPT (InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	nkat-3	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	nkat-3	Alliance	DIOPT (InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	kyat3	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	kyat3	Alliance	DIOPT (PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	234,362,306 - 234,407,646 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	234,362,322 - 234,407,878 (+)	Ensembl				GRCr8
mRatBN7.2	2	231,701,881 - 231,747,462 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	231,701,963 - 231,747,227 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	239,481,372 - 239,526,444 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	237,375,666 - 237,420,734 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	232,239,045 - 232,284,099 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	248,644,473 - 248,690,289 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	248,649,441 - 248,690,089 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	267,169,695 - 267,220,549 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	240,849,349 - 240,857,337 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	223,713,699 - 223,757,924 (+)	NCBI		Celera
RGSC_v3.1	2	240,829,675 - 240,844,071 (+)	NCBI
Cytogenetic Map	2	q44	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (ISO)

1-naphthyl isothiocyanate (EXP)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-hydroxypropanoic acid (ISO)

4,4'-diaminodiphenylmethane (EXP)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

acetamide (EXP)

aflatoxin B1 (EXP,ISO)

aflatoxin M1 (ISO)

antimycin A (ISO)

aristolochic acid A (ISO)

Benoxacor (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

beta-lapachone (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

Bufotalin (ISO)

buspirone (EXP)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

chlordecone (ISO)

chlorpyrifos (ISO)

dibutyl phthalate (ISO)

dicrotophos (ISO)

dioxygen (ISO)

doxorubicin (ISO)

fenpyroximate (ISO)

fluoranthene (ISO)

flutamide (EXP)

folic acid (ISO)

formaldehyde (ISO)

FR900359 (ISO)

fulvestrant (ISO)

gentamycin (EXP)

glafenine (EXP)

indometacin (EXP)

inulin (ISO)

ivermectin (ISO)

lead(0) (ISO)

methoxychlor (EXP)

mitomycin C (ISO)

N-nitrosodiethylamine (EXP)

okadaic acid (ISO)

paracetamol (EXP,ISO)

perfluorooctane-1-sulfonic acid (ISO)

PhIP (EXP)

picoxystrobin (ISO)

pirinixic acid (ISO)

quercetin (ISO)

rac-lactic acid (ISO)

SB 431542 (ISO)

sodium arsenite (EXP,ISO)

sodium fluoride (ISO)

Soman (EXP)

sunitinib (ISO)

tamoxifen (ISO)

tebufenpyrad (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

thiram (ISO)

titanium dioxide (ISO)

triphenyl phosphate (ISO)

Triptolide (ISO)

urethane (ISO)

vancomycin (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

2-oxoglutarate metabolic process (ISO)

amino acid metabolic process (ISO,ISS)

biological_process (ND)

kynurenine metabolic process (IEA,ISO,ISS)

L-kynurenine catabolic process (IEA)

Cellular Component

cytoplasm (IBA)

mitochondrion (IBA,ISO)

Molecular Function

cysteine-S-conjugate beta-lyase activity (IEA)

kynurenine-glyoxylate transaminase activity (IEA,ISO,ISS)

kynurenine-oxoglutarate transaminase activity (IBA,IEA,ISO,ISS)

lyase activity (IEA)

protein homodimerization activity (ISO)

pyridoxal phosphate binding (IEA)

transaminase activity (IEA)

transferase activity (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

kynurenine metabolic pathway (TAS)

selenoamino acid metabolic pathway (IEA)

tryptophan metabolic pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Structure, expression, and function of kynurenine aminotransferases in human and rodent brains.	Han Q, etal., Cell Mol Life Sci. 2010 Feb;67(3):353-68. doi: 10.1007/s00018-009-0166-4. Epub 2009 Oct 15.
3.	The kynurenine pathway and neurodegenerative disease.	Maddison DC and Giorgini F, Semin Cell Dev Biol. 2015 Apr;40:134-41. doi: 10.1016/j.semcdb.2015.03.002. Epub 2015 Mar 12.
4.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
5.	GOA pipeline	RGD automated data pipeline
6.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	Comprehensive gene review and curation	RGD comprehensive gene curation

Additional References at PubMed

PMID:16376499	PMID:18614015	PMID:19029248	PMID:22681889	PMID:34800366

Genomics

Comparative Map Data

Kyat3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	234,362,306 - 234,407,646 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	234,362,322 - 234,407,878 (+)	Ensembl				GRCr8
mRatBN7.2	2	231,701,881 - 231,747,462 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	231,701,963 - 231,747,227 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	239,481,372 - 239,526,444 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	237,375,666 - 237,420,734 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	232,239,045 - 232,284,099 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	248,644,473 - 248,690,289 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	248,649,441 - 248,690,089 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	267,169,695 - 267,220,549 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	240,849,349 - 240,857,337 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	223,713,699 - 223,757,924 (+)	NCBI		Celera
RGSC_v3.1	2	240,829,675 - 240,844,071 (+)	NCBI
Cytogenetic Map	2	q44	NCBI

KYAT3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	88,921,044 - 88,992,960 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	88,935,773 - 88,992,953 (-)	Ensembl			hg38	GRCh38
GRCh37	1	89,386,727 - 89,458,643 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	89,174,044 - 89,231,104 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	1	87,647,258 - 87,704,434 (-)	NCBI		Celera
Cytogenetic Map	1	p22.2	NCBI
HuRef	1	87,518,867 - 87,576,019 (-)	NCBI		HuRef
CHM1_1	1	89,516,514 - 89,573,685 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	88,764,436 - 88,836,357 (-)	NCBI		T2T-CHM13v2.0

Kyat3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	142,406,780 - 142,450,672 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	142,406,812 - 142,452,631 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	3	142,701,019 - 142,744,911 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	142,701,051 - 142,746,870 (+)	Ensembl			mm10	GRCm38
MGSCv37	3	142,364,044 - 142,407,874 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	3	142,638,466 - 142,682,296 (+)	NCBI		MGSCv36	mm8
Celera	3	149,133,370 - 149,177,239 (+)	NCBI		Celera
Cytogenetic Map	3	H1	NCBI
cM Map	3	66.69	NCBI

Kyat3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955423	5,344,562 - 5,391,518 (+)	Ensembl
ChiLan1.0	NW_004955423	5,340,863 - 5,388,460 (+)	NCBI	ChiLan1.0	ChiLan1.0

KYAT3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	137,971,448 - 138,049,428 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	137,132,877 - 137,205,094 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	91,636,681 - 91,708,859 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	90,403,072 - 90,460,426 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	90,403,072 - 90,460,426 (-)	Ensembl			panPan2	panpan1.1

KYAT3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	59,409,715 - 59,473,238 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	59,416,191 - 59,473,232 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	62,118,320 - 62,181,537 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	59,920,984 - 59,984,529 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	59,921,026 - 59,984,531 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	59,486,769 - 59,550,195 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	59,441,849 - 59,505,435 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	59,927,659 - 59,991,112 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Kyat3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	99,313,496 - 99,361,813 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936732	77,351 - 125,654 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936732	77,427 - 125,816 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

KYAT3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	127,451,516 - 127,507,759 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	4	127,451,475 - 127,507,766 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	139,676,619 - 139,732,902 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

KYAT3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	44,416,179 - 44,488,388 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	44,419,712 - 44,488,491 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666033	73,428,283 - 73,491,315 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Kyat3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624742	8,599,862 - 8,659,110 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Kyat3
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	3	17,993,806 - 18,032,716 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Kyat3
315 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	41
Count of miRNA genes:	39
Interacting mature miRNAs:	40
Transcripts:	ENSRNOT00000067165
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331734	Bp204	Blood pressure QTL 204	3.61192		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	170656145	239614549	Rat
631501	Bp101	Blood pressure QTL 101	2.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	205135267	250135267	Rat
2307174	Activ3	Activity QTL 3	4.83	0.000058	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	2	210956252	251712708	Rat
1598813	Memor9	Memory QTL 9	2.7		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	2	202029709	236904960	Rat
8693697	Alc36	Alcohol consumption QTL 36	2	0.592	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	2	219814164	239320906	Rat
1331794	Bp202	Blood pressure QTL 202	3.66819		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	143344967	251712708	Rat
1298075	Scl17	Serum cholesterol level QTL 17	3.4		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	2	214404877	251712708	Rat
1331805	Cm29	Cardiac mass QTL 29	3.50746		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	2	143344967	251712708	Rat
1300126	Bp175	Blood pressure QTL 175	3.46		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	204795005	249795005	Rat
7207484	Bss108	Bone structure and strength QTL 108	5.3		femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	2	214404877	251712708	Rat
2313073	Bmd75	Bone mineral density QTL 75	4.1	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	2	218051934	251712708	Rat
61398	Bp50	Blood pressure QTL 50	4.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	192287802	237287802	Rat
7207482	Bss107	Bone structure and strength QTL 107	7		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	2	214404877	251712708	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	205135267	250135267	Rat
1549836	Bss2	Bone structure and strength QTL 2	7.5		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	2	214404877	251712708	Rat
2317752	Glom23	Glomerulus QTL 23	3.6		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	2	196140964	251540988	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	2	205135267	250135267	Rat
1331767	Hrtrt12	Heart rate QTL 12	3.373		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	2	221088977	243501206	Rat
2293833	Kiddil8	Kidney dilation QTL 8	2.9		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	220274283	249795005	Rat
1598835	Anxrr18	Anxiety related response QTL 18	2.98		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	2	203664411	248664411	Rat
7207490	Bss111	Bone structure and strength QTL 111	6.4		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	2	214404877	251712708	Rat
8693622	Alc26	Alcohol consumption QTL 26	2.4	0.667	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	2	223810546	243965570	Rat
61366	Iddm3	Insulin dependent diabetes mellitus QTL 3	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	192287802	237287802	Rat
2293844	Kiddil7	Kidney dilation QTL 7	3.5		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	220274283	249795005	Rat
1641891	Alcrsp17	Alcohol response QTL 17			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	151869660	251712708	Rat

Markers in Region

D2Rat151

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	231,745,742 - 231,745,867 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	248,688,805 - 248,688,929	NCBI	Rnor6.0
Rnor_5.0	2	267,219,065 - 267,219,189	UniSTS	Rnor5.0
RGSC_v3.4	2	240,855,846 - 240,855,971	RGD	RGSC3.4
RGSC_v3.4	2	240,855,847 - 240,855,971	UniSTS	RGSC3.4
Celera	2	223,756,440 - 223,756,564	UniSTS
RGSC_v3.1	2	240,842,586 - 240,842,711	RGD
FHH x ACI Map	2	112.8599	RGD
FHH x ACI Map	2	112.8599	UniSTS
Cytogenetic Map	2	q44	UniSTS

RH140542

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	231,747,212 - 231,747,385 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	248,690,275 - 248,690,447	NCBI	Rnor6.0
Rnor_5.0	2	267,220,535 - 267,220,707	UniSTS	Rnor5.0
RGSC_v3.4	2	240,857,317 - 240,857,489	UniSTS	RGSC3.4
Celera	2	223,757,910 - 223,758,082	UniSTS
RH 3.4 Map	2	1580.0	UniSTS
Cytogenetic Map	2	q44	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	163	91	90	59	91	59	6	355	191	11	142	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001015037	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039102971	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039102972	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039102974	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039102975	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039102976	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039102977	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282417	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AY955395	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473952	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218600	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000067165 ⟹ ENSRNOP00000059667

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	234,362,322 - 234,407,878 (+)	Ensembl
mRatBN7.2 Ensembl	2	231,701,963 - 231,747,227 (+)	Ensembl
Rnor_6.0 Ensembl	2	248,649,441 - 248,690,089 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000101068 ⟹ ENSRNOP00000083094

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	234,362,365 - 234,407,583 (+)	Ensembl
mRatBN7.2 Ensembl	2	231,701,963 - 231,747,227 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000149481 ⟹ ENSRNOP00000108974

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	234,362,365 - 234,407,583 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000153006 ⟹ ENSRNOP00000103048

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	234,362,322 - 234,407,878 (+)	Ensembl

RefSeq Acc Id:

NM_001015037 ⟹ NP_001015037

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	234,362,356 - 234,407,646 (+)	NCBI
mRatBN7.2	2	231,701,934 - 231,747,227 (+)	NCBI
Rnor_6.0	2	248,644,473 - 248,690,289 (+)	NCBI
Rnor_5.0	2	267,169,695 - 267,220,549 (+)	NCBI
Celera	2	223,713,699 - 223,757,924 (+)	RGD

Sequence:

show sequence

TGGGTCTCGTGTGTTTCATCAGGACCCTGCGACACTAGCGATCTCCGGACTAAAGCCAGGCTGA
TTCAAACCAGGAGAACGACCATGCTTTTGGCCCAGAGGAGACTCTTCTCCCTTGGCTGCAGAGC
AAAGCCCATAAAGACAATTTACTCTTCGAAAGTTCTCGGACTCTCCACTTCTGCCAAAATGGCT
TTGAGATTCAAAAATGCCAAACGAATCGAAGGCCTGGACCAAAACGTGTGGGTTGAATTTACCA
AGTTGGCCGCGGATCCTTCTGTGGTGAATCTTGGACAAGGTTTTCCTGATATAACCCTTCCTTC
ATATGTACAAGAAGAATTGTCAAAGGCGGCATTTATTGATAACCTGAATCAATACACAAGGGGC
TTTGGTCATCCATCACTTGTGAAAGCGCTATCCTGCTTATACGGAAAGATTTATCAAAAGCAAA
TTGATCCAAATGAAGAAATTCTTGTGACGGTGGGGGGATATGGATCGCTCTTTAATGCCATCCA
AGGCTTGGTGGACCCAGGAGATGAAGTGATAATTATGGTGCCTTTTTACGACTGTTATGAGCCC
ATGGTGAAAATGGCTGGAGCAGTGCCTGTGTTTATTCCCCTGAGATCTAAACGTACTGACGGGA
TGAAGTGGACTAGCTCTGATTGGACATTCAATCCTCAAGAACTGGAAAGTAAATTCAGTTCCAA
AACGAAAGCCATTATATTAAATACTCCACATAACCCCATCGGCAAGGTGTATACCAGAGAGGAG
CTGCAAGTCATTGCTGACCTTTGCATCAAACATGACACTTTGTGCATCAGCGATGAGGTTTATG
AATGGCTTGTCTATACTGGACATAAGCACATAAAAGTAGCCAGCCTCCCTGGCATGTGGGATCG
GACCCTGACCATCGGCAGTGCAGGCAAGACATTCAGTGTGACCGGCTGGAAGCTCGGCTGGAGC
ATTGGCCCTGGTCACCTGATAAAACATTTGCGGACTGTTCAGCAAACCAGTGTATACACGTGTG
CAACTCCTTTACAGGCAGCCTTGGCCGAGGCTTTTTGGATCGATATCAAGCGCATGGATGACCC
AGAGTGTTACTTCAATTCTCTGCCAAAGGAATTAGAAGTTAAGAGAGATCGGATGGCCTGTTTA
CTTAACAGCGTTGGCCTGAAACCCATCATCCCTGACGGGGGCTACTTCATCATTGCCGATGTGT
CTTCATTAGGTGTTGACCTCTCGGATGTGAAGAGCGATGAGCCTTATGACTATAAGTTTGTGAA
GTGGATGACGAAAAATAAGAAATTGTCAGCCATTCCTGTATCCGCGTTCTGCGACTCCGAGTCT
AAACCTCACTTTGAGAAGTTGGTGCGGTTTTGCTTTATCAAAAAAGACAGCACTCTGGATGCTG
CGGAAGAAATCTTCAGGACGTGGAACAGCCGGAAGTCTTGACTTGTGCGGGTGTGAGGGTTCCA
TCTTCTTGCAAGGACTTTGCTACTCGGTGCTGCCACCTCGTGGGCACTAAAAGGAAAAGCCGTT
TCAGGACAAACATTTAAATAAACATTTCCACTGTCTCCGAAGTTAACCCCATTCCTAACAGTGT
TCAGTACATTATGGTTTGACTCGTTCGGAATATATTAAGGCACCTTCCGAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039102971 ⟹ XP_038958899

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	234,362,352 - 234,407,584 (+)	NCBI
mRatBN7.2	2	231,702,018 - 231,747,462 (+)	NCBI

RefSeq Acc Id:

XM_039102972 ⟹ XP_038958900

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	234,362,306 - 234,407,584 (+)	NCBI
mRatBN7.2	2	231,701,881 - 231,747,462 (+)	NCBI

RefSeq Acc Id:

XM_039102974 ⟹ XP_038958902

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	234,366,896 - 234,407,584 (+)	NCBI
mRatBN7.2	2	231,706,477 - 231,747,462 (+)	NCBI

RefSeq Acc Id:

XM_039102975 ⟹ XP_038958903

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	234,366,918 - 234,407,584 (+)	NCBI
mRatBN7.2	2	231,706,477 - 231,747,462 (+)	NCBI

RefSeq Acc Id:

XM_039102976 ⟹ XP_038958904

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	234,379,321 - 234,407,584 (+)	NCBI
mRatBN7.2	2	231,718,932 - 231,747,462 (+)	NCBI

RefSeq Acc Id:

XM_039102977 ⟹ XP_038958905

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	234,362,327 - 234,407,584 (+)	NCBI
mRatBN7.2	2	231,701,905 - 231,747,462 (+)	NCBI

RefSeq Acc Id:

XM_063282417 ⟹ XP_063138487

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	234,362,374 - 234,407,584 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001015037	(Get FASTA)	NCBI Sequence Viewer
	XP_038958899	(Get FASTA)	NCBI Sequence Viewer
	XP_038958900	(Get FASTA)	NCBI Sequence Viewer
	XP_038958902	(Get FASTA)	NCBI Sequence Viewer
	XP_038958903	(Get FASTA)	NCBI Sequence Viewer
	XP_038958904	(Get FASTA)	NCBI Sequence Viewer
	XP_038958905	(Get FASTA)	NCBI Sequence Viewer
	XP_063138487	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAX55607	(Get FASTA)	NCBI Sequence Viewer
	EDL82356	(Get FASTA)	NCBI Sequence Viewer
	EDL82357	(Get FASTA)	NCBI Sequence Viewer
	EDL82358	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000083094
	ENSRNOP00000103048
	ENSRNOP00000108974
GenBank Protein	Q58FK9	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001015037 ⟸ NM_001015037

- UniProtKB:

Q58FK9 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MLLAQRRLFSLGCRAKPIKTIYSSKVLGLSTSAKMALRFKNAKRIEGLDQNVWVEFTKLAADPS
VVNLGQGFPDITLPSYVQEELSKAAFIDNLNQYTRGFGHPSLVKALSCLYGKIYQKQIDPNEEI
LVTVGGYGSLFNAIQGLVDPGDEVIIMVPFYDCYEPMVKMAGAVPVFIPLRSKRTDGMKWTSSD
WTFNPQELESKFSSKTKAIILNTPHNPIGKVYTREELQVIADLCIKHDTLCISDEVYEWLVYTG
HKHIKVASLPGMWDRTLTIGSAGKTFSVTGWKLGWSIGPGHLIKHLRTVQQTSVYTCATPLQAA
LAEAFWIDIKRMDDPECYFNSLPKELEVKRDRMACLLNSVGLKPIIPDGGYFIIADVSSLGVDL
SDVKSDEPYDYKFVKWMTKNKKLSAIPVSAFCDSESKPHFEKLVRFCFIKKDSTLDAAEEIFRT
WNSRKS

hide sequence

Ensembl Acc Id:

ENSRNOP00000059667 ⟸ ENSRNOT00000067165

RefSeq Acc Id:	XP_038958900 ⟸ XM_039102972
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_038958905 ⟸ XM_039102977
- Peptide Label:	isoform X4

RefSeq Acc Id:	XP_038958899 ⟸ XM_039102971
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I5ZUT0 (UniProtKB/TrEMBL), A6HW71 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038958902 ⟸ XM_039102974
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_038958903 ⟸ XM_039102975
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_038958904 ⟸ XM_039102976
- Peptide Label:	isoform X3

Ensembl Acc Id:

ENSRNOP00000083094 ⟸ ENSRNOT00000101068

RefSeq Acc Id:	XP_063138487 ⟸ XM_063282417
- Peptide Label:	isoform X2

Ensembl Acc Id:

ENSRNOP00000108974 ⟸ ENSRNOT00000149481

Ensembl Acc Id:

ENSRNOP00000103048 ⟸ ENSRNOT00000153006

Protein Domains

Aminotransferase class I/classII large

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q58FK9-F1-model_v2	AlphaFold	Q58FK9	1-454	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1359262	AgrOrtholog
BioCyc Gene	G2FUF-50985	BioCyc
Ensembl Genes	ENSRNOG00000043426	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000101068	ENTREZGENE
	ENSRNOT00000149481	ENTREZGENE
	ENSRNOT00000153006	ENTREZGENE
Gene3D-CATH	3.40.640.10	UniProtKB/Swiss-Prot
	3.90.1150.10	UniProtKB/Swiss-Prot
InterPro	Aminotransferase_I/II	UniProtKB/Swiss-Prot
	Kynurenine-oxoglutarate_AT	UniProtKB/Swiss-Prot
	PyrdxlP-dep_Trfase	UniProtKB/Swiss-Prot
	PyrdxlP-dep_Trfase_dom1	UniProtKB/Swiss-Prot
	PyrdxlP-dep_Trfase_major	UniProtKB/Swiss-Prot
KEGG Report	rno:541589	UniProtKB/Swiss-Prot
NCBI Gene	541589	ENTREZGENE
PANTHER	FI04487P	UniProtKB/Swiss-Prot
	PTHR43807:SF6	UniProtKB/Swiss-Prot
Pfam	Aminotran_1_2	UniProtKB/Swiss-Prot
PhenoGen	Kyat3	PhenoGen
RatGTEx	ENSRNOG00000043426	RatGTEx
Superfamily-SCOP	SSF53383	UniProtKB/Swiss-Prot
UniProt	A0A8I5ZUT0	ENTREZGENE, UniProtKB/TrEMBL
	A0ABK0LM67_RAT	UniProtKB/TrEMBL
	A0ABK0LUF7_RAT	UniProtKB/TrEMBL
	A6HW71	ENTREZGENE, UniProtKB/TrEMBL
	F1M572_RAT	UniProtKB/TrEMBL
	KAT3_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-05-04	Kyat3	kynurenine aminotransferase 3	Ccbl2	cysteine conjugate-beta lyase 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2015-07-29	Ccbl2	cysteine conjugate-beta lyase 2	LOC100361841	kynurenine aminotransferase III-like	Data merged from RGD:2319336	737654	PROVISIONAL
2014-07-23	Ccbl2	cysteine conjugate-beta lyase 2	Kat3	kynurenine aminotransferase III	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2010-05-05	LOC100361841	kynurenine aminotransferase III-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2005-07-29	Kat3	kynurenine aminotransferase III			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

RGD Manual Annotations

Imported Annotations - KEGG (archival)