Advanced Search (OLGA)

Gene: SLC44A4 (solute carrier family 44 member 4) Homo sapiens

Analyze

Symbol:

SLC44A4

Name:

solute carrier family 44 member 4

RGD ID:

1349303

HGNC Page

HGNC:13941

Description:

Enables choline transmembrane transporter activity and thiamine pyrophosphate transmembrane transporter activity. Involved in several processes, including acetylcholine biosynthetic process; acetylcholine secretion; and choline transport. Located in apical plasma membrane. Implicated in autosomal dominant nonsyndromic deafness 72.

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

C6orf29; choline transporter-like protein 4; chromosome 6 open reading frame 29; CTL4; DFNA72; FLJ14491; hTPPT1; NG22; solute carrier family 44, member 4; testicular tissue protein Li 48; thiamine pyrophosphate transporter; thiamine pyrophosphate transporter 1; TPPT

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Allele / Splice:

See ClinVar data

Latest Assembly:

GRCh38 - Human Genome Assembly GRCh38

Position:

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	31,863,192 - 31,878,997 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	31,863,192 - 31,879,046 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	31,830,969 - 31,846,774 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	31,938,948 - 31,954,802 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	6	31,938,953 - 31,954,753	NCBI
Celera	6	33,429,555 - 33,445,404 (-)	NCBI		Celera
Cytogenetic Map	6	p21.33	NCBI
HuRef	6	31,616,782 - 31,632,627 (-)	NCBI		HuRef
CHM1_1	6	31,833,110 - 31,848,964 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	6	31,716,432 - 31,732,232 (-)	NCBI		T2T-CHM13v2.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autosomal dominant nonsyndromic deafness 72 (IAGP)

proteasome-associated autoinflammatory syndrome 1 (IAGP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (ISO)

1,1-dichloroethene (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,3,7,8-Tetrachlorodibenzofuran (ISO)

2,4-dinitrotoluene (ISO)

2,6-dinitrotoluene (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (ISO)

amiodarone (ISO)

aristolochic acid A (EXP)

asbestos (EXP)

Azoxymethane (ISO)

Benzo[ghi]perylene (ISO)

beta-lapachone (EXP)

beta-naphthoflavone (ISO)

bis(2-chloroethyl) sulfide (EXP)

bisphenol A (EXP,ISO)

butan-1-ol (EXP)

cadmium atom (EXP)

cadmium dichloride (EXP,ISO)

calcitriol (EXP)

CGP 52608 (EXP)

chlordecone (ISO)

chloropicrin (EXP)

choline (ISO)

Cuprizon (ISO)

cyclosporin A (EXP)

desferrioxamine B (EXP)

dextran sulfate (ISO)

diethyl maleate (ISO)

diethyl phthalate (ISO)

diethylstilbestrol (ISO)

dioxygen (EXP)

elemental selenium (EXP)

endosulfan (ISO)

folic acid (ISO)

fonofos (EXP)

furan (ISO)

genistein (ISO)

glyphosate (ISO)

hydrogen peroxide (EXP)

indole-3-methanol (ISO)

L-methionine (ISO)

Licochalcone B (EXP)

menadione (EXP)

N(4)-hydroxycytidine (ISO)

N-nitrosodiethylamine (ISO)

p-toluidine (ISO)

parathion (EXP)

pirinixic acid (ISO)

potassium dichromate (ISO)

resveratrol (EXP)

selenium atom (EXP)

sodium arsenite (ISO)

sulforaphane (ISO)

terbufos (EXP)

tert-butyl hydroperoxide (EXP)

testosterone (EXP,ISO)

tetrachloromethane (ISO)

thioacetamide (ISO)

titanium dioxide (ISO)

trichloroethene (ISO)

triptonide (ISO)

urethane (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

acetylcholine biosynthetic process (IMP)

acetylcholine secretion (IMP)

choline transport (IBA,IDA,IEA,IMP)

neuromast hair cell development (ISS)

otolith formation (ISS)

phosphatidylcholine biosynthetic process (IEA,TAS)

positive regulation of cell growth (IMP)

thiamine pyrophosphate transmembrane transport (IBA,IDA,IEA,IMP)

transmembrane transport (IEA,TAS)

Cellular Component

apical plasma membrane (IDA,IEA)

extracellular exosome (HDA)

membrane (IEA)

plasma membrane (IBA,IDA,IEA,TAS)

Molecular Function

antiporter activity (IEA)

choline transmembrane transporter activity (IDA,IEA,IMP,TAS)

thiamine pyrophosphate transmembrane transporter activity (IBA,IEA,IMP)

transmembrane transporter activity (IEA)

Phenotype Annotations Click to see Annotation Detail View

Human Phenotype

Autosomal dominant inheritance (IAGP)

Progressive (IAGP)

Sensorineural hearing impairment (IAGP)

Tinnitus (IAGP)

Young adult onset (IAGP)

References

References - curated

#	Reference Title	Reference Citation
1.	An electric lobe suppressor for a yeast choline transport mutation belongs to a new family of transporter-like proteins.	O'Regan S, etal., Proc Natl Acad Sci U S A 2000 Feb 15;97(4):1835-40.
2.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:8125298	PMID:12067718	PMID:12477932	PMID:12975309	PMID:14574404	PMID:14656967	PMID:14702039	PMID:15489334	PMID:15715662	PMID:16344560	PMID:19056867	PMID:19448619
PMID:19851445	PMID:20421499	PMID:20466734	PMID:20526339	PMID:21873635	PMID:22789125	PMID:23376485	PMID:23533145	PMID:23651124	PMID:24379411	PMID:24837172	PMID:25715703
PMID:26741288	PMID:26828122	PMID:26901654	PMID:27759029	PMID:28013291	PMID:28753073	PMID:30021884	PMID:32513696	PMID:38713615

Genomics

Comparative Map Data

SLC44A4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	31,863,192 - 31,878,997 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	31,863,192 - 31,879,046 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	31,830,969 - 31,846,774 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	31,938,948 - 31,954,802 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	6	31,938,953 - 31,954,753	NCBI
Celera	6	33,429,555 - 33,445,404 (-)	NCBI		Celera
Cytogenetic Map	6	p21.33	NCBI
HuRef	6	31,616,782 - 31,632,627 (-)	NCBI		HuRef
CHM1_1	6	31,833,110 - 31,848,964 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	6	31,716,432 - 31,732,232 (-)	NCBI		T2T-CHM13v2.0

Slc44a4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	35,133,200 - 35,149,412 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	17	35,133,442 - 35,149,412 (+)	Ensembl		GRCm39 Ensembl
GRCm38	17	34,914,224 - 34,930,436 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	34,914,466 - 34,930,436 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	17	35,051,411 - 35,067,381 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	17	34,522,536 - 34,538,412 (+)	NCBI		MGSCv36	mm8
Celera	17	38,010,698 - 38,026,669 (+)	NCBI		Celera
Cytogenetic Map	17	B1	NCBI
cM Map	17	18.46	NCBI

Slc44a4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	20	3,907,737 - 3,923,911 (-)	NCBI		GRCr8
mRatBN7.2	20	3,903,099 - 3,919,215 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	3,903,099 - 3,919,215 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	20	4,603,033 - 4,619,120 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	3,964,775 - 3,980,862 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	4,501,983 - 4,518,066 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	4,593,389 - 4,609,641 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	4,593,389 - 4,609,631 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	20	6,673,376 - 6,689,628 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	20	4,005,154 - 4,021,270 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	20	4,005,380 - 4,021,497 (-)	NCBI
Celera	20	4,110,301 - 4,126,373 (+)	NCBI		Celera
Cytogenetic Map	20	p12	NCBI

Slc44a4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955437	383,271 - 397,217 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955437	383,523 - 396,456 (-)	NCBI	ChiLan1.0	ChiLan1.0

SLC44A4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	46,342,553 - 46,354,982 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	42,303,767 - 42,316,468 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	31,526,660 - 31,542,165 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	32,413,441 - 32,428,550 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	32,413,441 - 32,428,550 (-)	Ensembl	panpan1.1		panPan2

SLC44A4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	12	1,328,276 - 1,340,752 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	12	1,328,399 - 1,340,778 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	12	1,463,542 - 1,476,028 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	12	1,470,452 - 1,482,939 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	12	1,466,890 - 1,483,011 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	12	1,328,172 - 1,340,646 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	12	1,396,104 - 1,408,588 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	12	1,461,326 - 1,474,043 (-)	NCBI		UU_Cfam_GSD_1.0

Slc44a4
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	35,878,349 - 35,897,867 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936727	1,663,747 - 1,682,941 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936727	1,663,593 - 1,683,061 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SLC44A4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	23,958,942 - 23,977,482 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	7	23,958,935 - 23,977,466 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	27,834,744 - 27,853,364 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SLC44A4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	17	40,142,349 - 40,158,024 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	17	40,142,730 - 40,157,858 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666044	31,777,498 - 31,794,091 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Slc44a4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624754	24,368,716 - 24,382,397 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624754	24,368,697 - 24,381,959 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in SLC44A4
242 total Variants

Clinical Variants

Name	Type	Condition(s)	Position(s)	Clinical significance
NM_025257.2(SLC44A4):c.1583G>A (p.Gly528Glu)	single nucleotide variant	Malignant melanoma [RCV000067292]	Chr6:31865601 [GRCh38] Chr6:31833378 [GRCh37] Chr6:31941357 [NCBI36] Chr6:6p21.33	not provided
NM_025257.2(SLC44A4):c.1250C>T (p.Ser417Phe)	single nucleotide variant	Malignant melanoma [RCV000067293]	Chr6:31866110 [GRCh38] Chr6:31833887 [GRCh37] Chr6:31941866 [NCBI36] Chr6:6p21.33	not provided
NM_025257.3(SLC44A4):c.1763_1764del (p.Val588fs)	deletion	Deafness, autosomal dominant 72 [RCV001333261]	Chr6:31865077..31865078 [GRCh38] Chr6:31832854..31832855 [GRCh37] Chr6:6p21.33	pathogenic
GRCh38/hg38 6p25.3-12.3(chr6:156974-46789291)x3	copy number gain	See cases [RCV000143497]	Chr6:156974..46789291 [GRCh38] Chr6:156974..46757028 [GRCh37] Chr6:101974..46864987 [NCBI36] Chr6:6p25.3-12.3	pathogenic
NM_025257.3(SLC44A4):c.33G>T (p.Glu11Asp)	single nucleotide variant	not specified [RCV004319457]	Chr6:31878948 [GRCh38] Chr6:31846725 [GRCh37] Chr6:6p21.33	uncertain significance
GRCh37/hg19 6p21.33(chr6:31777500-31831302)x1	copy number loss	See cases [RCV000449096]	Chr6:31777500..31831302 [GRCh37] Chr6:6p21.33	likely benign
GRCh37/hg19 6p21.33(chr6:31384577-31902308)x3	copy number gain	See cases [RCV000448679]	Chr6:31384577..31902308 [GRCh37] Chr6:6p21.33	uncertain significance
GRCh37/hg19 6p25.3-q27(chr6:156975-170919482)x3	copy number gain	See cases [RCV000512067]	Chr6:156975..170919482 [GRCh37] Chr6:6p25.3-q27	pathogenic
NM_025257.3(SLC44A4):c.466A>G (p.Met156Val)	single nucleotide variant	Hearing loss, autosomal dominant 72 [RCV000496999]	Chr6:31874723 [GRCh38] Chr6:31842500 [GRCh37] Chr6:6p21.33	pathogenic\|no classifications from unflagged records
GRCh37/hg19 6p25.3-q27(chr6:156975-170919482)	copy number gain	See cases [RCV000510595]	Chr6:156975..170919482 [GRCh37] Chr6:6p25.3-q27	pathogenic
NM_025257.3(SLC44A4):c.344T>C (p.Val115Ala)	single nucleotide variant	not specified [RCV004683767]	Chr6:31874845 [GRCh38] Chr6:31842622 [GRCh37] Chr6:6p21.33	uncertain significance
GRCh37/hg19 6p25.3-q27(chr6:60107-171054786)x3	copy number gain	not provided [RCV000745400]	Chr6:60107..171054786 [GRCh37] Chr6:6p25.3-q27	pathogenic
GRCh37/hg19 6p25.3-q27(chr6:165632-170919470)x3	copy number gain	not provided [RCV000745404]	Chr6:165632..170919470 [GRCh37] Chr6:6p25.3-q27	pathogenic
GRCh37/hg19 6p25.3-q27(chr6:108666-170980171)x3	copy number gain	not provided [RCV000745403]	Chr6:108666..170980171 [GRCh37] Chr6:6p25.3-q27	pathogenic
GRCh37/hg19 6p22.1-21.32(chr6:28130359-32108367)x3	copy number gain	not provided [RCV000745592]	Chr6:28130359..32108367 [GRCh37] Chr6:6p22.1-21.32	uncertain significance
NM_025257.3(SLC44A4):c.1038-48A>G	single nucleotide variant	not provided [RCV001644422]	Chr6:31869685 [GRCh38] Chr6:31837462 [GRCh37] Chr6:6p21.33	benign
NM_025257.3(SLC44A4):c.530-156G>A	single nucleotide variant	not provided [RCV001667270]	Chr6:31871717 [GRCh38] Chr6:31839494 [GRCh37] Chr6:6p21.33	benign
NM_025257.3(SLC44A4):c.1130+72C>T	single nucleotide variant	not provided [RCV001691277]	Chr6:31869473 [GRCh38] Chr6:31837250 [GRCh37] Chr6:6p21.33	benign
NM_025257.3(SLC44A4):c.813C>T (p.Tyr271=)	single nucleotide variant	Hearing loss, autosomal dominant 72 [RCV001810254]\|not provided [RCV001693306]	Chr6:31870936 [GRCh38] Chr6:31838713 [GRCh37] Chr6:6p21.33	benign
NC_000006.12:g.31879235C>A	single nucleotide variant	not provided [RCV001691765]	Chr6:31879235 [GRCh38] Chr6:31847012 [GRCh37] Chr6:6p21.33	benign
NM_025257.3(SLC44A4):c.90-18G>A	single nucleotide variant	not provided [RCV001665088]	Chr6:31876147 [GRCh38] Chr6:31843924 [GRCh37] Chr6:6p21.33	benign
NM_025257.3(SLC44A4):c.243-54C>G	single nucleotide variant	not provided [RCV001668722]	Chr6:31875082 [GRCh38] Chr6:31842859 [GRCh37] Chr6:6p21.33	benign
NM_025257.3(SLC44A4):c.1156C>G (p.Gln386Glu)	single nucleotide variant	not provided [RCV000965206]	Chr6:31869232 [GRCh38] Chr6:31837009 [GRCh37] Chr6:6p21.33	benign
NM_025257.3(SLC44A4):c.1487+8T>C	single nucleotide variant	not provided [RCV000922438]	Chr6:31865865 [GRCh38] Chr6:31833642 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.435G>C (p.Arg145Ser)	single nucleotide variant	not provided [RCV000949291]	Chr6:31874754 [GRCh38] Chr6:31842531 [GRCh37] Chr6:6p21.33	benign
NM_025257.3(SLC44A4):c.431A>G (p.Asn144Ser)	single nucleotide variant	not provided [RCV000949292]	Chr6:31874758 [GRCh38] Chr6:31842535 [GRCh37] Chr6:6p21.33	benign
GRCh37/hg19 6p21.33(chr6:31824828-31834398)	copy number loss	Sialidosis type 2 [RCV001089960]	Chr6:31824828..31834398 [GRCh37] Chr6:6p21.33	pathogenic
GRCh37/hg19 6p22.1-q14.1(chr6:29455465-81447367)	copy number gain	not provided [RCV000767714]	Chr6:29455465..81447367 [GRCh37] Chr6:6p22.1-q14.1	pathogenic
NM_025257.3(SLC44A4):c.523G>A (p.Ala175Thr)	single nucleotide variant	not provided [RCV003104973]\|not specified [RCV004673832]	Chr6:31874466 [GRCh38] Chr6:31842243 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.644G>A (p.Arg215Gln)	single nucleotide variant	SLC44A4-related disorder [RCV004756489]\|not provided [RCV003104405]\|not specified [RCV004857957]	Chr6:31871371 [GRCh38] Chr6:31839148 [GRCh37] Chr6:6p21.33	uncertain significance
NC_000006.11:g.(?_30695893)_(31937492_?)dup	duplication	not provided [RCV003107453]	Chr6:30695893..31937492 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.451G>A (p.Gly151Arg)	single nucleotide variant	not specified [RCV004324675]	Chr6:31874738 [GRCh38] Chr6:31842515 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1189C>T (p.Pro397Ser)	single nucleotide variant	not provided [RCV001597797]	Chr6:31869199 [GRCh38] Chr6:31836976 [GRCh37] Chr6:6p21.33	benign
NM_025257.3(SLC44A4):c.41-139C>T	single nucleotide variant	not provided [RCV001654662]	Chr6:31877221 [GRCh38] Chr6:31844998 [GRCh37] Chr6:6p21.33	benign
NM_025257.3(SLC44A4):c.89+127T>C	single nucleotide variant	not provided [RCV001594610]	Chr6:31876907 [GRCh38] Chr6:31844684 [GRCh37] Chr6:6p21.33	benign
NM_025257.3(SLC44A4):c.2011+58dup	duplication	not provided [RCV001684107]	Chr6:31864579..31864580 [GRCh38] Chr6:31832356..31832357 [GRCh37] Chr6:6p21.33	benign
NM_025257.3(SLC44A4):c.1785A>G (p.Thr595=)	single nucleotide variant	not provided [RCV000978369]	Chr6:31865056 [GRCh38] Chr6:31832833 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.937+1G>A	single nucleotide variant	not provided [RCV000907500]	Chr6:31870811 [GRCh38] Chr6:31838588 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.1131-32G>A	single nucleotide variant	not provided [RCV001656750]	Chr6:31869289 [GRCh38] Chr6:31837066 [GRCh37] Chr6:6p21.33	benign
NM_025257.3(SLC44A4):c.90-92C>T	single nucleotide variant	not provided [RCV001682074]	Chr6:31876221 [GRCh38] Chr6:31843998 [GRCh37] Chr6:6p21.33	benign
NM_025257.3(SLC44A4):c.368A>T (p.Asp123Val)	single nucleotide variant	not provided [RCV001676462]	Chr6:31874821 [GRCh38] Chr6:31842598 [GRCh37] Chr6:6p21.33	benign
GRCh37/hg19 6p21.33-21.31(chr6:31036397-34088832)x3	copy number gain	not provided [RCV001005791]	Chr6:31036397..34088832 [GRCh37] Chr6:6p21.33-21.31	likely pathogenic
NM_025257.3(SLC44A4):c.2011+115C>T	single nucleotide variant	not provided [RCV001615652]	Chr6:31864537 [GRCh38] Chr6:31832314 [GRCh37] Chr6:6p21.33	benign
NM_025257.3(SLC44A4):c.559G>A (p.Val187Ile)	single nucleotide variant	Hearing loss, autosomal dominant 72 [RCV001810117]\|not provided [RCV001608352]	Chr6:31871532 [GRCh38] Chr6:31839309 [GRCh37] Chr6:6p21.33	benign
NM_025257.3(SLC44A4):c.1130+45G>T	single nucleotide variant	Hearing loss, autosomal dominant 72 [RCV001810160]\|not provided [RCV001637322]	Chr6:31869500 [GRCh38] Chr6:31837277 [GRCh37] Chr6:6p21.33	benign
NM_025257.3(SLC44A4):c.937+44C>T	single nucleotide variant	Hearing loss, autosomal dominant 72 [RCV001810174]\|not provided [RCV001641338]	Chr6:31870768 [GRCh38] Chr6:31838545 [GRCh37] Chr6:6p21.33	benign
NM_025257.3(SLC44A4):c.976A>G (p.Met326Val)	single nucleotide variant	Hearing loss, autosomal dominant 72 [RCV001810136]\|not provided [RCV001616767]	Chr6:31870664 [GRCh38] Chr6:31838441 [GRCh37] Chr6:6p21.33	benign
NM_025257.3(SLC44A4):c.1038-77T>C	single nucleotide variant	not provided [RCV001658419]	Chr6:31869714 [GRCh38] Chr6:31837491 [GRCh37] Chr6:6p21.33	benign
NM_025257.3(SLC44A4):c.1233+105A>C	single nucleotide variant	not provided [RCV001658449]	Chr6:31869050 [GRCh38] Chr6:31836827 [GRCh37] Chr6:6p21.33	benign
NM_025257.3(SLC44A4):c.702-116G>A	single nucleotide variant	not provided [RCV001620419]	Chr6:31871163 [GRCh38] Chr6:31838940 [GRCh37] Chr6:6p21.33	benign
NM_025257.3(SLC44A4):c.537G>A (p.Gly179=)	single nucleotide variant	Hearing loss, autosomal dominant 72 [RCV001810289]\|not provided [RCV001716526]	Chr6:31871554 [GRCh38] Chr6:31839331 [GRCh37] Chr6:6p21.33	benign
NM_025257.3(SLC44A4):c.2011+72del	deletion	not provided [RCV001645745]	Chr6:31864580 [GRCh38] Chr6:31832357 [GRCh37] Chr6:6p21.33	benign
NM_025257.3(SLC44A4):c.90-20C>T	single nucleotide variant	not provided [RCV001669502]	Chr6:31876149 [GRCh38] Chr6:31843926 [GRCh37] Chr6:6p21.33	benign
NM_025257.3(SLC44A4):c.997C>T (p.Arg333Trp)	single nucleotide variant	Hearing loss, autosomal dominant 72 [RCV001329415]\|not provided [RCV003770816]\|not specified [RCV004035673]	Chr6:31870643 [GRCh38] Chr6:31838420 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1038-89G>C	single nucleotide variant	not provided [RCV001694793]	Chr6:31869726 [GRCh38] Chr6:31837503 [GRCh37] Chr6:6p21.33	benign
NC_000006.12:g.31879123G>A	single nucleotide variant	not provided [RCV001683798]	Chr6:31879123 [GRCh38] Chr6:31846900 [GRCh37] Chr6:6p21.33	benign
NM_025257.3(SLC44A4):c.938-11G>A	single nucleotide variant	Hearing loss, autosomal dominant 72 [RCV001810206]\|not provided [RCV001671018]	Chr6:31870713 [GRCh38] Chr6:31838490 [GRCh37] Chr6:6p21.33	benign
NM_025257.3(SLC44A4):c.17G>T (p.Arg6Leu)	single nucleotide variant	not provided [RCV001696650]	Chr6:31878964 [GRCh38] Chr6:31846741 [GRCh37] Chr6:6p21.33	benign
NM_025257.3(SLC44A4):c.309T>G (p.Val103=)	single nucleotide variant	not provided [RCV003104974]	Chr6:31874962 [GRCh38] Chr6:31842739 [GRCh37] Chr6:6p21.33	benign
NM_025257.3(SLC44A4):c.1004G>A (p.Arg335His)	single nucleotide variant	not provided [RCV003108809]\|not specified [RCV004244568]	Chr6:31870636 [GRCh38] Chr6:31838413 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.702-17C>A	single nucleotide variant	not specified [RCV004800792]	Chr6:31871064 [GRCh38] Chr6:31838841 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.37T>C (p.Tyr13His)	single nucleotide variant	not provided [RCV001814906]	Chr6:31878944 [GRCh38] Chr6:31846721 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1927-16G>A	single nucleotide variant	not provided [RCV002045741]	Chr6:31864752 [GRCh38] Chr6:31832529 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1972G>A (p.Val658Ile)	single nucleotide variant	not provided [RCV001896935]	Chr6:31864691 [GRCh38] Chr6:31832468 [GRCh37] Chr6:6p21.33	uncertain significance
GRCh37/hg19 6p21.33(chr6:31384577-31902308)	copy number gain	not specified [RCV002053564]	Chr6:31384577..31902308 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1513G>A (p.Gly505Arg)	single nucleotide variant	not provided [RCV001988465]	Chr6:31865759 [GRCh38] Chr6:31833536 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1852T>C (p.Phe618Leu)	single nucleotide variant	not provided [RCV001864194]\|not specified [RCV004857820]	Chr6:31864890 [GRCh38] Chr6:31832667 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1411_1412delinsGT (p.Ser471Val)	indel	not provided [RCV001874429]	Chr6:31865948..31865949 [GRCh38] Chr6:31833725..31833726 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1487G>A (p.Arg496His)	single nucleotide variant	not provided [RCV001872530]	Chr6:31865873 [GRCh38] Chr6:31833650 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.158T>C (p.Ile53Thr)	single nucleotide variant	not provided [RCV002021956]	Chr6:31876061 [GRCh38] Chr6:31843838 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.471G>A (p.Thr157=)	single nucleotide variant	not provided [RCV001909465]	Chr6:31874518 [GRCh38] Chr6:31842295 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.936C>T (p.Ala312=)	single nucleotide variant	not provided [RCV002049019]	Chr6:31870813 [GRCh38] Chr6:31838590 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1690G>A (p.Ala564Thr)	single nucleotide variant	not provided [RCV001878672]	Chr6:31865385 [GRCh38] Chr6:31833162 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1649A>C (p.Lys550Thr)	single nucleotide variant	not provided [RCV001933911]	Chr6:31865535 [GRCh38] Chr6:31833312 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1390G>A (p.Val464Ile)	single nucleotide variant	not provided [RCV001936268]	Chr6:31865970 [GRCh38] Chr6:31833747 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.526C>T (p.Pro176Ser)	single nucleotide variant	not provided [RCV002010825]	Chr6:31874463 [GRCh38] Chr6:31842240 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.617+1G>A	single nucleotide variant	not provided [RCV001923089]	Chr6:31871473 [GRCh38] Chr6:31839250 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.553A>G (p.Thr185Ala)	single nucleotide variant	not provided [RCV001867726]	Chr6:31871538 [GRCh38] Chr6:31839315 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.22G>A (p.Glu8Lys)	single nucleotide variant	not provided [RCV001867728]\|not specified [RCV003987922]	Chr6:31878959 [GRCh38] Chr6:31846736 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.676G>A (p.Ala226Thr)	single nucleotide variant	not provided [RCV002033972]	Chr6:31871339 [GRCh38] Chr6:31839116 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.908A>T (p.Gln303Leu)	single nucleotide variant	not provided [RCV001973011]	Chr6:31870841 [GRCh38] Chr6:31838618 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.380T>C (p.Val127Ala)	single nucleotide variant	not provided [RCV002029744]	Chr6:31874809 [GRCh38] Chr6:31842586 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.40+10G>C	single nucleotide variant	not provided [RCV002146486]	Chr6:31878931 [GRCh38] Chr6:31846708 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.1582+14C>T	single nucleotide variant	not provided [RCV002129817]	Chr6:31865676 [GRCh38] Chr6:31833453 [GRCh37] Chr6:6p21.33	benign
NM_025257.3(SLC44A4):c.1545C>T (p.Ala515=)	single nucleotide variant	not provided [RCV002209152]	Chr6:31865727 [GRCh38] Chr6:31833504 [GRCh37] Chr6:6p21.33	benign\|likely benign
NM_025257.3(SLC44A4):c.164-4G>A	single nucleotide variant	not provided [RCV002144814]	Chr6:31875934 [GRCh38] Chr6:31843711 [GRCh37] Chr6:6p21.33	benign
NM_025257.3(SLC44A4):c.606G>A (p.Gln202=)	single nucleotide variant	not provided [RCV002169842]	Chr6:31871485 [GRCh38] Chr6:31839262 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.1130+16G>A	single nucleotide variant	not provided [RCV002191734]	Chr6:31869529 [GRCh38] Chr6:31837306 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.937+9C>T	single nucleotide variant	SLC44A4-related disorder [RCV003923713]\|not provided [RCV002091651]	Chr6:31870803 [GRCh38] Chr6:31838580 [GRCh37] Chr6:6p21.33	benign
NM_025257.3(SLC44A4):c.822C>T (p.Tyr274=)	single nucleotide variant	not provided [RCV002174786]	Chr6:31870927 [GRCh38] Chr6:31838704 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.1842CTT[1] (p.Phe618del)	microsatellite	not provided [RCV002117240]	Chr6:31864895..31864897 [GRCh38] Chr6:31832672..31832674 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.766C>A (p.Pro256Thr)	single nucleotide variant	not provided [RCV002149175]	Chr6:31870983 [GRCh38] Chr6:31838760 [GRCh37] Chr6:6p21.33	benign
NM_025257.3(SLC44A4):c.1760+19dup	duplication	not provided [RCV002097456]	Chr6:31865295..31865296 [GRCh38] Chr6:31833072..31833073 [GRCh37] Chr6:6p21.33	benign
NM_025257.3(SLC44A4):c.2011+11C>A	single nucleotide variant	not provided [RCV002116575]	Chr6:31864641 [GRCh38] Chr6:31832418 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.942C>T (p.Ile314=)	single nucleotide variant	not provided [RCV002096368]	Chr6:31870698 [GRCh38] Chr6:31838475 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.555C>A (p.Thr185=)	single nucleotide variant	not provided [RCV002195225]	Chr6:31871536 [GRCh38] Chr6:31839313 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.1760+19C>T	single nucleotide variant	not provided [RCV002171959]	Chr6:31865296 [GRCh38] Chr6:31833073 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.252G>A (p.Pro84=)	single nucleotide variant	not provided [RCV002149218]	Chr6:31875019 [GRCh38] Chr6:31842796 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.1760+19C>G	single nucleotide variant	not provided [RCV002076538]	Chr6:31865296 [GRCh38] Chr6:31833073 [GRCh37] Chr6:6p21.33	benign
NM_025257.3(SLC44A4):c.618-6C>A	single nucleotide variant	not provided [RCV002131261]	Chr6:31871403 [GRCh38] Chr6:31839180 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.1926+13C>G	single nucleotide variant	not provided [RCV002079246]	Chr6:31864803 [GRCh38] Chr6:31832580 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.1760+16C>G	single nucleotide variant	not provided [RCV002212020]	Chr6:31865299 [GRCh38] Chr6:31833076 [GRCh37] Chr6:6p21.33	benign
NM_025257.3(SLC44A4):c.1477C>T (p.Arg493Cys)	single nucleotide variant	not provided [RCV002136810]	Chr6:31865883 [GRCh38] Chr6:31833660 [GRCh37] Chr6:6p21.33	benign
NM_025257.3(SLC44A4):c.937C>G (p.Leu313Val)	single nucleotide variant	SLC44A4-related disorder [RCV003951004]\|not provided [RCV002083779]	Chr6:31870812 [GRCh38] Chr6:31838589 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.1131-15T>G	single nucleotide variant	not provided [RCV002163790]	Chr6:31869272 [GRCh38] Chr6:31837049 [GRCh37] Chr6:6p21.33	benign
NM_025257.3(SLC44A4):c.573G>A (p.Ala191=)	single nucleotide variant	not provided [RCV002122776]	Chr6:31871518 [GRCh38] Chr6:31839295 [GRCh37] Chr6:6p21.33	benign
NM_025257.3(SLC44A4):c.111C>T (p.Cys37=)	single nucleotide variant	not provided [RCV002120923]	Chr6:31876108 [GRCh38] Chr6:31843885 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.1926+5G>T	single nucleotide variant	not provided [RCV002117528]	Chr6:31864811 [GRCh38] Chr6:31832588 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.1254G>A (p.Ser418=)	single nucleotide variant	not provided [RCV002159321]	Chr6:31866106 [GRCh38] Chr6:31833883 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.90-13G>A	single nucleotide variant	not provided [RCV002143257]	Chr6:31876142 [GRCh38] Chr6:31843919 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.1986T>C (p.Cys662=)	single nucleotide variant	not provided [RCV002176104]	Chr6:31864677 [GRCh38] Chr6:31832454 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.899G>C (p.Ser300Thr)	single nucleotide variant	not provided [RCV002155021]	Chr6:31870850 [GRCh38] Chr6:31838627 [GRCh37] Chr6:6p21.33	benign
NC_000006.11:g.(?_30695893)_(36953949_?)dup	duplication	Proteasome-associated autoinflammatory syndrome 1 [RCV003113679]	Chr6:30695893..36953949 [GRCh37] Chr6:6p21.33-21.2	uncertain significance
NM_025257.3(SLC44A4):c.256C>A (p.Leu86Ile)	single nucleotide variant	not provided [RCV003117236]\|not specified [RCV004676176]	Chr6:31875015 [GRCh38] Chr6:31842792 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.363G>A (p.Pro121=)	single nucleotide variant	not provided [RCV003121951]	Chr6:31874826 [GRCh38] Chr6:31842603 [GRCh37] Chr6:6p21.33	likely benign\|uncertain significance
NM_025257.3(SLC44A4):c.1752C>T (p.Asn584=)	single nucleotide variant	not provided [RCV003104972]	Chr6:31865323 [GRCh38] Chr6:31833100 [GRCh37] Chr6:6p21.33	benign
NM_025257.3(SLC44A4):c.207C>T (p.Asn69=)	single nucleotide variant	SLC44A4-related disorder [RCV003954043]\|not provided [RCV003104975]	Chr6:31875887 [GRCh38] Chr6:31843664 [GRCh37] Chr6:6p21.33	benign\|likely benign
NM_025257.3(SLC44A4):c.1673A>G (p.Asn558Ser)	single nucleotide variant	not provided [RCV002276144]	Chr6:31865511 [GRCh38] Chr6:31833288 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.599C>T (p.Thr200Ile)	single nucleotide variant	not provided [RCV002971623]\|not specified [RCV004068260]	Chr6:31871492 [GRCh38] Chr6:31839269 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.457C>T (p.Pro153Ser)	single nucleotide variant	not provided [RCV002904463]	Chr6:31874732 [GRCh38] Chr6:31842509 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.40_40+7del	deletion	not provided [RCV002512295]	Chr6:31878934..31878941 [GRCh38] Chr6:31846711..31846718 [GRCh37] Chr6:6p21.33	benign\|likely benign
NM_025257.3(SLC44A4):c.698T>C (p.Leu233Pro)	single nucleotide variant	not provided [RCV002908895]	Chr6:31871317 [GRCh38] Chr6:31839094 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.2104C>T (p.Pro702Ser)	single nucleotide variant	not provided [RCV002617221]	Chr6:31863656 [GRCh38] Chr6:31831433 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1760+18C>G	single nucleotide variant	not provided [RCV002771350]	Chr6:31865297 [GRCh38] Chr6:31833074 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.40+8T>C	single nucleotide variant	SLC44A4-related disorder [RCV004756431]\|not provided [RCV002914269]	Chr6:31878933 [GRCh38] Chr6:31846710 [GRCh37] Chr6:6p21.33	benign\|likely benign
NM_025257.3(SLC44A4):c.447G>T (p.Leu149=)	single nucleotide variant	not provided [RCV003039158]	Chr6:31874742 [GRCh38] Chr6:31842519 [GRCh37] Chr6:6p21.33	benign
NM_025257.3(SLC44A4):c.327G>C (p.Gln109His)	single nucleotide variant	not specified [RCV004098591]	Chr6:31874944 [GRCh38] Chr6:31842721 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1016C>T (p.Ala339Val)	single nucleotide variant	not provided [RCV002846970]	Chr6:31870624 [GRCh38] Chr6:31838401 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.751C>T (p.Arg251Cys)	single nucleotide variant	not provided [RCV002795278]	Chr6:31870998 [GRCh38] Chr6:31838775 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.75C>A (p.Gly25=)	single nucleotide variant	not provided [RCV002795554]	Chr6:31877048 [GRCh38] Chr6:31844825 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.1103G>A (p.Cys368Tyr)	single nucleotide variant	not specified [RCV004104942]	Chr6:31869572 [GRCh38] Chr6:31837349 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.877C>G (p.Leu293Val)	single nucleotide variant	not provided [RCV003053872]	Chr6:31870872 [GRCh38] Chr6:31838649 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.243-14C>T	single nucleotide variant	not provided [RCV002820979]	Chr6:31875042 [GRCh38] Chr6:31842819 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.834G>T (p.Glu278Asp)	single nucleotide variant	not specified [RCV004125435]	Chr6:31870915 [GRCh38] Chr6:31838692 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.991C>T (p.Arg331Trp)	single nucleotide variant	not specified [RCV004105218]	Chr6:31870649 [GRCh38] Chr6:31838426 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1761-19_1761-15dup	duplication	not provided [RCV002666983]	Chr6:31865094..31865095 [GRCh38] Chr6:31832871..31832872 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.64_78del (p.Ser22_Pro26del)	deletion	not provided [RCV002786481]	Chr6:31877045..31877059 [GRCh38] Chr6:31844822..31844836 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1234-15C>T	single nucleotide variant	not provided [RCV002576027]	Chr6:31866141 [GRCh38] Chr6:31833918 [GRCh37] Chr6:6p21.33	benign
NM_025257.3(SLC44A4):c.1228C>T (p.Pro410Ser)	single nucleotide variant	not provided [RCV002872316]	Chr6:31869160 [GRCh38] Chr6:31836937 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1234-15C>G	single nucleotide variant	not provided [RCV002572609]	Chr6:31866141 [GRCh38] Chr6:31833918 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.410G>C (p.Gly137Ala)	single nucleotide variant	not provided [RCV002801930]	Chr6:31874779 [GRCh38] Chr6:31842556 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1760+17C>T	single nucleotide variant	not provided [RCV002576118]	Chr6:31865298 [GRCh38] Chr6:31833075 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.849G>T (p.Leu283=)	single nucleotide variant	SLC44A4-related disorder [RCV003961341]\|not provided [RCV002985552]	Chr6:31870900 [GRCh38] Chr6:31838677 [GRCh37] Chr6:6p21.33	benign\|likely benign
NM_025257.3(SLC44A4):c.31G>A (p.Glu11Lys)	single nucleotide variant	not provided [RCV002596734]	Chr6:31878950 [GRCh38] Chr6:31846727 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1760+17C>G	single nucleotide variant	not provided [RCV002572214]	Chr6:31865298 [GRCh38] Chr6:31833075 [GRCh37] Chr6:6p21.33	benign
NM_025257.3(SLC44A4):c.685T>C (p.Trp229Arg)	single nucleotide variant	not specified [RCV004180874]	Chr6:31871330 [GRCh38] Chr6:31839107 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.913G>A (p.Val305Met)	single nucleotide variant	not specified [RCV004171190]	Chr6:31870836 [GRCh38] Chr6:31838613 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1171G>C (p.Ala391Pro)	single nucleotide variant	SLC44A4-related disorder [RCV003916598]\|not provided [RCV002900404]	Chr6:31869217 [GRCh38] Chr6:31836994 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.1459T>C (p.Leu487=)	single nucleotide variant	not provided [RCV003031312]	Chr6:31865901 [GRCh38] Chr6:31833678 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.1761-5C>G	single nucleotide variant	not provided [RCV002900627]	Chr6:31865085 [GRCh38] Chr6:31832862 [GRCh37] Chr6:6p21.33	likely benign\|uncertain significance
NM_025257.3(SLC44A4):c.1233+20A>G	single nucleotide variant	not provided [RCV002577520]	Chr6:31869135 [GRCh38] Chr6:31836912 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.145A>G (p.Ile49Val)	single nucleotide variant	not provided [RCV002832896]	Chr6:31876074 [GRCh38] Chr6:31843851 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1462A>T (p.Ile488Phe)	single nucleotide variant	not provided [RCV002602458]\|not specified [RCV004068754]	Chr6:31865898 [GRCh38] Chr6:31833675 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.40+14G>A	single nucleotide variant	not provided [RCV002934069]	Chr6:31878927 [GRCh38] Chr6:31846704 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.1683C>T (p.Ile561=)	single nucleotide variant	not provided [RCV002922115]	Chr6:31865501 [GRCh38] Chr6:31833278 [GRCh37] Chr6:6p21.33	benign
NM_025257.3(SLC44A4):c.1601C>T (p.Ala534Val)	single nucleotide variant	not provided [RCV002714805]	Chr6:31865583 [GRCh38] Chr6:31833360 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.938-12C>T	single nucleotide variant	not provided [RCV002717408]	Chr6:31870714 [GRCh38] Chr6:31838491 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.1960G>A (p.Gly654Ser)	single nucleotide variant	not provided [RCV002627975]	Chr6:31864703 [GRCh38] Chr6:31832480 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1982T>C (p.Met661Thr)	single nucleotide variant	not provided [RCV002629181]\|not specified [RCV004070814]	Chr6:31864681 [GRCh38] Chr6:31832458 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1488-8C>T	single nucleotide variant	not provided [RCV002720828]	Chr6:31865792 [GRCh38] Chr6:31833569 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.1868C>T (p.Pro623Leu)	single nucleotide variant	not provided [RCV002628405]\|not specified [RCV004070581]	Chr6:31864874 [GRCh38] Chr6:31832651 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1853T>C (p.Phe618Ser)	single nucleotide variant	not provided [RCV005099845]\|not specified [RCV004166941]	Chr6:31864889 [GRCh38] Chr6:31832666 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.2098G>C (p.Glu700Gln)	single nucleotide variant	not provided [RCV002600319]	Chr6:31863662 [GRCh38] Chr6:31831439 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.943G>A (p.Val315Met)	single nucleotide variant	not provided [RCV002604757]	Chr6:31870697 [GRCh38] Chr6:31838474 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1861C>T (p.Arg621Cys)	single nucleotide variant	not provided [RCV003068509]	Chr6:31864881 [GRCh38] Chr6:31832658 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.2059A>G (p.Met687Val)	single nucleotide variant	not provided [RCV003574982]\|not specified [RCV004075345]	Chr6:31863701 [GRCh38] Chr6:31831478 [GRCh37] Chr6:6p21.33	likely benign\|uncertain significance
NM_025257.3(SLC44A4):c.1038-14T>C	single nucleotide variant	not provided [RCV002587212]	Chr6:31869651 [GRCh38] Chr6:31837428 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.491A>G (p.Gln164Arg)	single nucleotide variant	not provided [RCV002943988]	Chr6:31874498 [GRCh38] Chr6:31842275 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.89+5del	deletion	not provided [RCV002942292]	Chr6:31877029 [GRCh38] Chr6:31844806 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1777A>G (p.Lys593Glu)	single nucleotide variant	not specified [RCV004285050]	Chr6:31865064 [GRCh38] Chr6:31832841 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.851G>A (p.Arg284Gln)	single nucleotide variant	not specified [RCV004270136]	Chr6:31870898 [GRCh38] Chr6:31838675 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.133A>G (p.Ile45Val)	single nucleotide variant	not provided [RCV003730452]\|not specified [RCV004259052]	Chr6:31876086 [GRCh38] Chr6:31843863 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.700G>T (p.Val234Phe)	single nucleotide variant	not specified [RCV003331705]	Chr6:31871315 [GRCh38] Chr6:31839092 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.256C>T (p.Leu86Phe)	single nucleotide variant	not specified [RCV004346937]	Chr6:31875015 [GRCh38] Chr6:31842792 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1546C>T (p.Arg516Trp)	single nucleotide variant	not specified [RCV004356579]	Chr6:31865726 [GRCh38] Chr6:31833503 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1760+19del	deletion	not provided [RCV003880266]	Chr6:31865296 [GRCh38] Chr6:31833073 [GRCh37] Chr6:6p21.33	benign
NM_025257.3(SLC44A4):c.3G>A (p.Met1Ile)	single nucleotide variant	not provided [RCV003543463]	Chr6:31878978 [GRCh38] Chr6:31846755 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1978G>A (p.Gly660Ser)	single nucleotide variant	not provided [RCV003872603]	Chr6:31864685 [GRCh38] Chr6:31832462 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1582+7C>G	single nucleotide variant	not provided [RCV003825540]	Chr6:31865683 [GRCh38] Chr6:31833460 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.383dup (p.Asn130fs)	duplication	SLC44A4-related disorder [RCV003400324]	Chr6:31874805..31874806 [GRCh38] Chr6:31842582..31842583 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1866C>T (p.Ile622=)	single nucleotide variant	not provided [RCV003826819]	Chr6:31864876 [GRCh38] Chr6:31832653 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.1760+20G>A	single nucleotide variant	not provided [RCV003830387]	Chr6:31865295 [GRCh38] Chr6:31833072 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.41-1G>A	single nucleotide variant	not provided [RCV003572859]	Chr6:31877083 [GRCh38] Chr6:31844860 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1822G>A (p.Gly608Arg)	single nucleotide variant	not provided [RCV003740146]	Chr6:31865019 [GRCh38] Chr6:31832796 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.570G>A (p.Pro190=)	single nucleotide variant	not provided [RCV003828683]	Chr6:31871521 [GRCh38] Chr6:31839298 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.530-15G>A	single nucleotide variant	not provided [RCV003880325]	Chr6:31871576 [GRCh38] Chr6:31839353 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.1160A>T (p.Tyr387Phe)	single nucleotide variant	not provided [RCV003829655]	Chr6:31869228 [GRCh38] Chr6:31837005 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1977C>T (p.Phe659=)	single nucleotide variant	not provided [RCV003577985]	Chr6:31864686 [GRCh38] Chr6:31832463 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.837G>A (p.Glu279=)	single nucleotide variant	not provided [RCV003572963]	Chr6:31870912 [GRCh38] Chr6:31838689 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.359G>T (p.Cys120Phe)	single nucleotide variant	not provided [RCV003876899]	Chr6:31874830 [GRCh38] Chr6:31842607 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1995G>A (p.Thr665=)	single nucleotide variant	not provided [RCV003826223]	Chr6:31864668 [GRCh38] Chr6:31832445 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.674T>C (p.Phe225Ser)	single nucleotide variant	not provided [RCV003880636]	Chr6:31871341 [GRCh38] Chr6:31839118 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.2011+10A>G	single nucleotide variant	not provided [RCV003880861]	Chr6:31864642 [GRCh38] Chr6:31832419 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.866C>G (p.Ser289Cys)	single nucleotide variant	not provided [RCV003880863]	Chr6:31870883 [GRCh38] Chr6:31838660 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1191C>T (p.Pro397=)	single nucleotide variant	not provided [RCV003833719]	Chr6:31869197 [GRCh38] Chr6:31836974 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.40G>A (p.Gly14Arg)	single nucleotide variant	not provided [RCV003834082]	Chr6:31878941 [GRCh38] Chr6:31846718 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1927-10T>C	single nucleotide variant	not provided [RCV003666244]	Chr6:31864746 [GRCh38] Chr6:31832523 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.243-11C>G	single nucleotide variant	not provided [RCV003851667]	Chr6:31875039 [GRCh38] Chr6:31842816 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.1768G>A (p.Val590Ile)	single nucleotide variant	not provided [RCV003667959]	Chr6:31865073 [GRCh38] Chr6:31832850 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.469-6C>A	single nucleotide variant	not provided [RCV003817149]	Chr6:31874526 [GRCh38] Chr6:31842303 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.832G>C (p.Glu278Gln)	single nucleotide variant	not provided [RCV003561368]	Chr6:31870917 [GRCh38] Chr6:31838694 [GRCh37] Chr6:6p21.33	benign
NM_025257.3(SLC44A4):c.1603C>T (p.Arg535Cys)	single nucleotide variant	not provided [RCV003724960]	Chr6:31865581 [GRCh38] Chr6:31833358 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1905C>T (p.Asn635=)	single nucleotide variant	not provided [RCV003671711]	Chr6:31864837 [GRCh38] Chr6:31832614 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.1583-16C>G	single nucleotide variant	not provided [RCV003861407]	Chr6:31865617 [GRCh38] Chr6:31833394 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.1583-9C>T	single nucleotide variant	not provided [RCV003844465]	Chr6:31865610 [GRCh38] Chr6:31833387 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.1037+11G>A	single nucleotide variant	not provided [RCV003679800]	Chr6:31870592 [GRCh38] Chr6:31838369 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.804G>T (p.Val268=)	single nucleotide variant	not provided [RCV003846950]	Chr6:31870945 [GRCh38] Chr6:31838722 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.1037+7G>C	single nucleotide variant	not provided [RCV003732633]	Chr6:31870596 [GRCh38] Chr6:31838373 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.1694T>C (p.Ile565Thr)	single nucleotide variant	not provided [RCV003734936]	Chr6:31865381 [GRCh38] Chr6:31833158 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1699G>A (p.Gly567Arg)	single nucleotide variant	not provided [RCV003847241]	Chr6:31865376 [GRCh38] Chr6:31833153 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.71G>A (p.Arg24Gln)	single nucleotide variant	not provided [RCV003732135]	Chr6:31877052 [GRCh38] Chr6:31844829 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1131-18T>C	single nucleotide variant	not provided [RCV003822585]	Chr6:31869275 [GRCh38] Chr6:31837052 [GRCh37] Chr6:6p21.33	benign
NM_025257.3(SLC44A4):c.568C>T (p.Pro190Ser)	single nucleotide variant	not provided [RCV003682726]	Chr6:31871523 [GRCh38] Chr6:31839300 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.660G>A (p.Lys220=)	single nucleotide variant	not provided [RCV003719372]	Chr6:31871355 [GRCh38] Chr6:31839132 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.653G>C (p.Ser218Thr)	single nucleotide variant	not provided [RCV003867644]	Chr6:31871362 [GRCh38] Chr6:31839139 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1038-6C>G	single nucleotide variant	SLC44A4-related disorder [RCV004756523]\|not provided [RCV003567914]	Chr6:31869643 [GRCh38] Chr6:31837420 [GRCh37] Chr6:6p21.33	likely benign\|uncertain significance
NM_025257.3(SLC44A4):c.1685T>C (p.Met562Thr)	single nucleotide variant	not provided [RCV003712262]	Chr6:31865499 [GRCh38] Chr6:31833276 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.285C>G (p.Ile95Met)	single nucleotide variant	not provided [RCV003729331]	Chr6:31874986 [GRCh38] Chr6:31842763 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1232C>T (p.Thr411Met)	single nucleotide variant	not provided [RCV003728422]\|not specified [RCV004867906]	Chr6:31869156 [GRCh38] Chr6:31836933 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.40+3G>A	single nucleotide variant	not provided [RCV003842050]	Chr6:31878938 [GRCh38] Chr6:31846715 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1927-17C>T	single nucleotide variant	not provided [RCV003821172]	Chr6:31864753 [GRCh38] Chr6:31832530 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.1284C>T (p.Gly428=)	single nucleotide variant	not provided [RCV003731503]	Chr6:31866076 [GRCh38] Chr6:31833853 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.951G>A (p.Ala317=)	single nucleotide variant	SLC44A4-related disorder [RCV003904466]	Chr6:31870689 [GRCh38] Chr6:31838466 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.978G>A (p.Met326Ile)	single nucleotide variant	SLC44A4-related disorder [RCV003951893]	Chr6:31870662 [GRCh38] Chr6:31838439 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.242+14C>T	single nucleotide variant	not specified [RCV003988220]	Chr6:31875838 [GRCh38] Chr6:31843615 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.117_125del (p.Leu42_Phe44del)	deletion	SLC44A4-related disorder [RCV003901594]	Chr6:31876094..31876102 [GRCh38] Chr6:31843871..31843879 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.479C>T (p.Thr160Ile)	single nucleotide variant	not specified [RCV004461720]	Chr6:31874510 [GRCh38] Chr6:31842287 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.572C>T (p.Ala191Val)	single nucleotide variant	not specified [RCV004461722]	Chr6:31871519 [GRCh38] Chr6:31839296 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.707T>C (p.Leu236Pro)	single nucleotide variant	not specified [RCV004461724]	Chr6:31871042 [GRCh38] Chr6:31838819 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.362C>T (p.Pro121Leu)	single nucleotide variant	not specified [RCV004461719]	Chr6:31874827 [GRCh38] Chr6:31842604 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.538C>T (p.Arg180Cys)	single nucleotide variant	not specified [RCV004461721]	Chr6:31871553 [GRCh38] Chr6:31839330 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.163+6T>C	single nucleotide variant	SLC44A4-related disorder [RCV003914590]\|not provided [RCV005101734]	Chr6:31876050 [GRCh38] Chr6:31843827 [GRCh37] Chr6:6p21.33	likely benign
NC_000006.11:g.(?_31631971)_(31895135_?)del	deletion	not provided [RCV004578802]	Chr6:31631971..31895135 [GRCh37] Chr6:6p21.33	pathogenic
NC_000006.11:g.(?_31620520)_(31937492_?)del	deletion	not provided [RCV004578883]	Chr6:31620520..31937492 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1834G>A (p.Val612Ile)	single nucleotide variant	not specified [RCV004586187]	Chr6:31864908 [GRCh38] Chr6:31832685 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1657A>G (p.Lys553Glu)	single nucleotide variant	not specified [RCV004674756]	Chr6:31865527 [GRCh38] Chr6:31833304 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1313C>T (p.Ser438Phe)	single nucleotide variant	not specified [RCV004674758]	Chr6:31866047 [GRCh38] Chr6:31833824 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.272T>A (p.Ile91Asn)	single nucleotide variant	SLC44A4-related disorder [RCV004756748]	Chr6:31874999 [GRCh38] Chr6:31842776 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.959A>C (p.Glu320Ala)	single nucleotide variant	not specified [RCV004862233]	Chr6:31870681 [GRCh38] Chr6:31838458 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1534G>C (p.Val512Leu)	single nucleotide variant	not specified [RCV004862235]	Chr6:31865738 [GRCh38] Chr6:31833515 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1669C>T (p.Arg557Cys)	single nucleotide variant	not specified [RCV004862234]	Chr6:31865515 [GRCh38] Chr6:31833292 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1922T>A (p.Ile641Asn)	single nucleotide variant	not specified [RCV004870600]	Chr6:31864820 [GRCh38] Chr6:31832597 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.596C>A (p.Thr199Asn)	single nucleotide variant	not provided [RCV005144940]	Chr6:31871495 [GRCh38] Chr6:31839272 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1386A>G (p.Gln462=)	single nucleotide variant	not provided [RCV005066751]	Chr6:31865974 [GRCh38] Chr6:31833751 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.1760+16C>A	single nucleotide variant	not provided [RCV005086592]	Chr6:31865299 [GRCh38] Chr6:31833076 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.1266_1285del (p.Met423fs)	deletion	not provided [RCV005087522]	Chr6:31866075..31866094 [GRCh38] Chr6:31833852..31833871 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.689A>T (p.Tyr230Phe)	single nucleotide variant	not specified [RCV004870594]	Chr6:31871326 [GRCh38] Chr6:31839103 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1612A>T (p.Met538Leu)	single nucleotide variant	not specified [RCV004870595]	Chr6:31865572 [GRCh38] Chr6:31833349 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.2017G>C (p.Asp673His)	single nucleotide variant	not specified [RCV004870596]	Chr6:31863743 [GRCh38] Chr6:31831520 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1273G>A (p.Val425Ile)	single nucleotide variant	not specified [RCV004870597]	Chr6:31866087 [GRCh38] Chr6:31833864 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1966T>C (p.Phe656Leu)	single nucleotide variant	not specified [RCV004870598]	Chr6:31864697 [GRCh38] Chr6:31832474 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1760+14C>T	single nucleotide variant	not provided [RCV005064541]	Chr6:31865301 [GRCh38] Chr6:31833078 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.2032_2052dup (p.Pro684_Tyr685insAsnGlySerLeuAspArgPro)	duplication	not provided [RCV005085968]	Chr6:31863707..31863708 [GRCh38] Chr6:31831484..31831485 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.2012-20C>T	single nucleotide variant	not provided [RCV005062168]	Chr6:31863768 [GRCh38] Chr6:31831545 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.1337G>A (p.Gly446Glu)	single nucleotide variant	not provided [RCV005085591]	Chr6:31866023 [GRCh38] Chr6:31833800 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.2096A>G (p.Asn699Ser)	single nucleotide variant	not specified [RCV004870599]	Chr6:31863664 [GRCh38] Chr6:31831441 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.34G>A (p.Ala12Thr)	single nucleotide variant	not provided [RCV005132598]	Chr6:31878947 [GRCh38] Chr6:31846724 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1981A>C (p.Met661Leu)	single nucleotide variant	not provided [RCV005135661]	Chr6:31864682 [GRCh38] Chr6:31832459 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1987G>A (p.Val663Met)	single nucleotide variant	not provided [RCV005070281]	Chr6:31864676 [GRCh38] Chr6:31832453 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1858G>A (p.Gly620Ser)	single nucleotide variant	not provided [RCV005110685]	Chr6:31864884 [GRCh38] Chr6:31832661 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.174T>G (p.Tyr58Ter)	single nucleotide variant	not provided [RCV005149367]	Chr6:31875920 [GRCh38] Chr6:31843697 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1698C>T (p.Tyr566=)	single nucleotide variant	not provided [RCV005192811]	Chr6:31865377 [GRCh38] Chr6:31833154 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.1486C>T (p.Arg496Cys)	single nucleotide variant	not provided [RCV005186519]	Chr6:31865874 [GRCh38] Chr6:31833651 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1165C>T (p.Leu389Phe)	single nucleotide variant	not provided [RCV005128432]	Chr6:31869223 [GRCh38] Chr6:31837000 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1455C>T (p.Phe485=)	single nucleotide variant	not provided [RCV005117926]	Chr6:31865905 [GRCh38] Chr6:31833682 [GRCh37] Chr6:6p21.33	benign
NM_025257.3(SLC44A4):c.339C>A (p.Pro113=)	single nucleotide variant	not provided [RCV005144105]	Chr6:31874932 [GRCh38] Chr6:31842709 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.342+3C>T	single nucleotide variant	not provided [RCV005161812]	Chr6:31874926 [GRCh38] Chr6:31842703 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1759A>C (p.Arg587=)	single nucleotide variant	not provided [RCV005115678]	Chr6:31865316 [GRCh38] Chr6:31833093 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1530C>G (p.Thr510=)	single nucleotide variant	not provided [RCV005194644]	Chr6:31865742 [GRCh38] Chr6:31833519 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.1514G>A (p.Gly505Glu)	single nucleotide variant	not provided [RCV005117478]	Chr6:31865758 [GRCh38] Chr6:31833535 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.61C>A (p.Pro21Thr)	single nucleotide variant	not provided [RCV005116898]	Chr6:31877062 [GRCh38] Chr6:31844839 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.172T>C (p.Tyr58His)	single nucleotide variant	not provided [RCV005155179]	Chr6:31875922 [GRCh38] Chr6:31843699 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1760+17_1760+18insG	insertion	not provided [RCV005160152]	Chr6:31865297..31865298 [GRCh38] Chr6:31833074..31833075 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.22G>T (p.Glu8Ter)	single nucleotide variant	not provided [RCV005180035]	Chr6:31878959 [GRCh38] Chr6:31846736 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.559_560inv (p.Val187Thr)	inversion	not provided [RCV005118532]	Chr6:31871531..31871532 [GRCh38] Chr6:31839308..31839309 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.369C>T (p.Asp123=)	single nucleotide variant	not provided [RCV005083811]	Chr6:31874820 [GRCh38] Chr6:31842597 [GRCh37] Chr6:6p21.33	likely benign
NM_025257.3(SLC44A4):c.425C>T (p.Thr142Ile)	single nucleotide variant	not provided [RCV005123846]	Chr6:31874764 [GRCh38] Chr6:31842541 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1192G>A (p.Gly398Ser)	single nucleotide variant	not provided [RCV005177295]	Chr6:31869196 [GRCh38] Chr6:31836973 [GRCh37] Chr6:6p21.33	uncertain significance
NM_025257.3(SLC44A4):c.1892G>T (p.Ser631Ile)	single nucleotide variant	not provided [RCV005071900]	Chr6:31864850 [GRCh38] Chr6:31832627 [GRCh37] Chr6:6p21.33	uncertain significance

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	2373
Count of miRNA genes:	842
Interacting mature miRNAs:	1019
Transcripts:	ENST00000229729, ENST00000375562, ENST00000414427, ENST00000462671, ENST00000465707, ENST00000475563, ENST00000479777, ENST00000487680, ENST00000544672
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCh38)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
597021073	GWAS1117147_H	total iron binding capacity QTL GWAS1117147 (human)		0.0000008	total iron binding capacity		6	31872244	31872245	Human
597301917	GWAS1397991_H	level of tapasin in blood serum QTL GWAS1397991 (human)		1e-13	level of tapasin in blood serum		6	31875082	31875083	Human
597350290	GWAS1446364_H	lean body mass QTL GWAS1446364 (human)		3e-46	body lean mass (VT:0010483)	total body lean mass (CMO:0003950)	6	31872244	31872245	Human
1298458	BW9_H	Body weight QTL 9 (human)	2.7	0.0002	Body fat amount		6	6911960	32911960	Human
597220242	GWAS1316316_H	BMI-adjusted waist-hip ratio QTL GWAS1316316 (human)		4e-10	body size trait (VT:0100005)		6	31870936	31870937	Human
597220244	GWAS1316318_H	BMI-adjusted waist-hip ratio QTL GWAS1316318 (human)		9e-19	body size trait (VT:0100005)		6	31869050	31869051	Human
597069958	GWAS1166032_H	mosquito bite reaction itch intensity measurement, mosquito bite reaction size measurement QTL GWAS1166032 (human)		0.0000009	mosquito bite reaction itch intensity measurement, mosquito bite reaction size measurement		6	31869050	31869051	Human
407005267	GWAS654243_H	age at menopause QTL GWAS654243 (human)		0.0000005	age at menopause		6	31870936	31870937	Human
597340043	GWAS1436117_H	sarcoidosis QTL GWAS1436117 (human)		0.0000002	sarcoidosis		6	31873278	31873279	Human
1358854	MULTSCL4_H	Multiple sclerosis susceptibility QTL 4 (human)			Multiple sclerosis susceptibility		6	6911960	32911960	Human
597349256	GWAS1445330_H	body fat percentage QTL GWAS1445330 (human)		3e-15	body fat mass (VT:0010482)	body fat percentage (CMO:0000302)	6	31876907	31876908	Human
597302924	GWAS1398998_H	level of folate receptor alpha in blood serum QTL GWAS1398998 (human)		2e-14	level of folate receptor alpha in blood serum		6	31875082	31875083	Human
597049473	GWAS1145547_H	hypertension QTL GWAS1145547 (human)		1e-10	hypertension		6	31872005	31872006	Human
597051020	GWAS1147094_H	Parkinson disease QTL GWAS1147094 (human)		4e-11	Parkinson disease		6	31878457	31878458	Human
1358857	MULTSCL19_H	Multiple sclerosis susceptibility QTL 19 (human)			Multiple sclerosis susceptibility		6	19584311	45584311	Human
597271942	GWAS1368016_H	MHC class I polypeptide-related sequence A measurement QTL GWAS1368016 (human)		9e-13	MHC class I polypeptide-related sequence A measurement		6	31863382	31863383	Human
597304250	GWAS1400324_H	BMI-adjusted waist-hip ratio QTL GWAS1400324 (human)		6e-13	body size trait (VT:0100005)		6	31870936	31870937	Human
597304251	GWAS1400325_H	BMI-adjusted waist-hip ratio QTL GWAS1400325 (human)		3e-25	body size trait (VT:0100005)		6	31872244	31872245	Human
597249725	GWAS1345799_H	staphylococcus seropositivity QTL GWAS1345799 (human)		1e-11	staphylococcus seropositivity		6	31872700	31872701	Human
597249980	GWAS1346054_H	streptococcus seropositivity QTL GWAS1346054 (human)		1e-13	streptococcus seropositivity		6	31872700	31872701	Human
597305023	GWAS1401097_H	level of ferritin, mitochondrial in blood serum QTL GWAS1401097 (human)		7e-33	level of ferritin, mitochondrial in blood serum		6	31875082	31875083	Human
597304252	GWAS1400326_H	BMI-adjusted waist-hip ratio QTL GWAS1400326 (human)		6e-21	body size trait (VT:0100005)		6	31870713	31870714	Human
597250495	GWAS1346569_H	streptococcus seropositivity QTL GWAS1346569 (human)		6e-09	streptococcus seropositivity		6	31872700	31872701	Human
597304253	GWAS1400327_H	BMI-adjusted waist-hip ratio QTL GWAS1400327 (human)		1e-08	body size trait (VT:0100005)		6	31872638	31872639	Human
1643569	GLUCO21_H	Glucose level QTL 21 (human)		0.021	Glucose level	non-insulin-dependent	6	6911960	32911960	Human
597025981	GWAS1122055_H	triglyceride measurement QTL GWAS1122055 (human)		6e-14	triglyceride measurement	blood triglyceride level (CMO:0000118)	6	31872244	31872245	Human
597249970	GWAS1346044_H	blautia seropositivity QTL GWAS1346044 (human)		9e-10	blautia seropositivity		6	31872700	31872701	Human
597069496	GWAS1165570_H	susceptibility to scarlet fever measurement QTL GWAS1165570 (human)		0.000007	susceptibility to scarlet fever measurement		6	31867387	31867388	Human
597189293	GWAS1285367_H	metabolite measurement, diet measurement QTL GWAS1285367 (human)		2e-12	eating behavior trait (VT:0001431)	food intake measurement (CMO:0000772)	6	31864261	31864262	Human
597063891	GWAS1159965_H	lung carcinoma QTL GWAS1159965 (human)		8e-19	lung carcinoma		6	31872700	31872701	Human
597323472	GWAS1419546_H	interleukin-36 alpha measurement QTL GWAS1419546 (human)		8e-12	interleukin-36 alpha measurement		6	31875082	31875083	Human
597303761	GWAS1399835_H	BMI-adjusted hip circumference QTL GWAS1399835 (human)		4e-10	BMI-adjusted hip circumference	hip circumference (CMO:0000014)	6	31873232	31873233	Human
597303764	GWAS1399838_H	BMI-adjusted hip circumference QTL GWAS1399838 (human)		2e-20	BMI-adjusted hip circumference	hip circumference (CMO:0000014)	6	31874113	31874114	Human
597303765	GWAS1399839_H	BMI-adjusted hip circumference QTL GWAS1399839 (human)		2e-13	BMI-adjusted hip circumference	hip circumference (CMO:0000014)	6	31870713	31870714	Human
597303756	GWAS1399830_H	level of calsequestrin-1 in blood serum QTL GWAS1399830 (human)		5e-14	level of calsequestrin-1 in blood serum		6	31875082	31875083	Human
597203651	GWAS1299725_H	upper aerodigestive tract neoplasm QTL GWAS1299725 (human)		3e-19	upper aerodigestive tract neoplasm		6	31872700	31872701	Human
597251271	GWAS1347345_H	streptococcus seropositivity QTL GWAS1347345 (human)		3e-08	streptococcus seropositivity		6	31872700	31872701	Human
597447416	GWAS1543490_H	clostridium difficile infection QTL GWAS1543490 (human)		0.000004	clostridium difficile infection		6	31873121	31873122	Human
597270527	GWAS1366601_H	BMI-adjusted hip circumference QTL GWAS1366601 (human)		2e-27	BMI-adjusted hip circumference	hip circumference (CMO:0000014)	6	31872244	31872245	Human
597110513	GWAS1206587_H	Calcium channel blocker use measurement QTL GWAS1206587 (human)		2e-10	Calcium channel blocker use measurement		6	31872678	31872679	Human
1643377	BW325_H	Body weight QTL 325 (human)	2.32	0.0005	Body fat amount		6	6911960	32911960	Human
597251056	GWAS1347130_H	staphylococcus seropositivity QTL GWAS1347130 (human)		4e-08	staphylococcus seropositivity		6	31872700	31872701	Human
597066726	GWAS1162800_H	susceptibility to cold sores measurement QTL GWAS1162800 (human)		0.000003	susceptibility to cold sores measurement		6	31868665	31868666	Human
406987827	GWAS636803_H	low density lipoprotein cholesterol measurement, alcohol drinking QTL GWAS636803 (human)		7e-12	low density lipoprotein cholesterol measurement, alcohol drinking	blood low density lipoprotein cholesterol level (CMO:0000053)	6	31872244	31872245	Human
597302499	GWAS1398573_H	level of sialidase-1 in blood serum QTL GWAS1398573 (human)		1e-24	level of sialidase-1 in blood serum		6	31875082	31875083	Human
597027055	GWAS1123129_H	low density lipoprotein cholesterol measurement QTL GWAS1123129 (human)		6e-09	low density lipoprotein cholesterol measurement	blood low density lipoprotein cholesterol level (CMO:0000053)	6	31872244	31872245	Human
597069290	GWAS1165364_H	lung carcinoma QTL GWAS1165364 (human)		3e-14	lung carcinoma		6	31872700	31872701	Human
597253656	GWAS1349730_H	BMI-adjusted waist-hip ratio QTL GWAS1349730 (human)		3e-16	body size trait (VT:0100005)		6	31869050	31869051	Human
597062162	GWAS1158236_H	systemic lupus erythematosus QTL GWAS1158236 (human)		1e-12	systemic lupus erythematosus		6	31867385	31867386	Human
597244447	GWAS1340521_H	BMI-adjusted waist circumference QTL GWAS1340521 (human)		1e-21	body size trait (VT:0100005)		6	31870186	31870187	Human
597454618	GWAS1550692_H	plant allergen seropositivity QTL GWAS1550692 (human)		8e-09	plant allergen seropositivity		6	31878208	31878209	Human
597267985	GWAS1364059_H	BMI-adjusted waist circumference QTL GWAS1364059 (human)		1e-09	body size trait (VT:0100005)		6	31874113	31874114	Human
597345808	GWAS1441882_H	immature granulocyte count QTL GWAS1441882 (human)		1e-17	immature granulocyte count		6	31864261	31864262	Human
597253654	GWAS1349728_H	BMI-adjusted waist-hip ratio QTL GWAS1349728 (human)		6e-09	body size trait (VT:0100005)		6	31870936	31870937	Human
597240840	GWAS1336914_H	BMI-adjusted waist-hip ratio QTL GWAS1336914 (human)		9e-09	body size trait (VT:0100005)		6	31872638	31872639	Human
597250312	GWAS1346386_H	streptococcus seropositivity QTL GWAS1346386 (human)		9e-28	streptococcus seropositivity		6	31872700	31872701	Human
597261067	GWAS1357141_H	Inguinal hernia QTL GWAS1357141 (human)		3e-09	Inguinal hernia		6	31872700	31872701	Human
597261066	GWAS1357140_H	Inguinal hernia QTL GWAS1357140 (human)		4e-09	Inguinal hernia		6	31864261	31864262	Human
597249290	GWAS1345364_H	animal allergen seropositivity QTL GWAS1345364 (human)		1e-12	animal allergen seropositivity		6	31873232	31873233	Human
406985942	GWAS634918_H	triglyceride measurement QTL GWAS634918 (human)		0.000004	triglyceride measurement	blood triglyceride level (CMO:0000118)	6	31872244	31872245	Human
597043971	GWAS1140045_H	forced expiratory volume QTL GWAS1140045 (human)		4e-09	forced expiratory volume	forced expiratory volume (CMO:0000254)	6	31872638	31872639	Human
597249281	GWAS1345355_H	streptococcus seropositivity QTL GWAS1345355 (human)		2e-10	streptococcus seropositivity		6	31872700	31872701	Human
597019148	GWAS1115222_H	wet macular degeneration QTL GWAS1115222 (human)		1e-11	wet macular degeneration		6	31874821	31874822	Human
597063948	GWAS1160022_H	perceived unattractiveness to mosquitos measurement QTL GWAS1160022 (human)		0.0000004	perceived unattractiveness to mosquitos measurement		6	31869050	31869051	Human
597240834	GWAS1336908_H	BMI-adjusted waist-hip ratio QTL GWAS1336908 (human)		2e-12	body size trait (VT:0100005)		6	31873232	31873233	Human
597240837	GWAS1336911_H	BMI-adjusted waist-hip ratio QTL GWAS1336911 (human)		1e-13	body size trait (VT:0100005)		6	31870936	31870937	Human
597249540	GWAS1345614_H	streptococcus seropositivity QTL GWAS1345614 (human)		2e-19	streptococcus seropositivity		6	31872700	31872701	Human
1643399	BMD5_H	Bone mineral density QTL 5 (human)	2.32	0.0005	Bone mineral density		6	6911960	32911960	Human
407084765	GWAS733741_H	total cholesterol measurement, C-reactive protein measurement QTL GWAS733741 (human)		2e-08	total cholesterol measurement, C-reactive protein measurement	blood C-reactive protein level (CMO:0003160)	6	31870186	31870187	Human
597240839	GWAS1336913_H	BMI-adjusted waist-hip ratio QTL GWAS1336913 (human)		4e-22	body size trait (VT:0100005)		6	31870713	31870714	Human
597240838	GWAS1336912_H	BMI-adjusted waist-hip ratio QTL GWAS1336912 (human)		6e-27	body size trait (VT:0100005)		6	31872244	31872245	Human
597251129	GWAS1347203_H	streptococcus seropositivity QTL GWAS1347203 (human)		6e-11	streptococcus seropositivity		6	31872700	31872701	Human
597046069	GWAS1142143_H	atopic asthma QTL GWAS1142143 (human)		3e-08	atopic asthma		6	31868665	31868666	Human
407012591	GWAS661567_H	Vitiligo QTL GWAS661567 (human)		1e-48	Vitiligo		6	31869289	31869290	Human
406981106	GWAS630082_H	triglyceride measurement, alcohol drinking QTL GWAS630082 (human)		3e-19	triglyceride measurement, alcohol drinking	blood triglyceride level (CMO:0000118)	6	31872244	31872245	Human
597250861	GWAS1346935_H	animal allergen seropositivity QTL GWAS1346935 (human)		1e-11	animal allergen seropositivity		6	31878457	31878458	Human
597071151	GWAS1167225_H	mosquito bite reaction itch intensity measurement QTL GWAS1167225 (human)		4e-20	mosquito bite reaction itch intensity measurement		6	31869050	31869051	Human
406986491	GWAS635467_H	triglyceride measurement QTL GWAS635467 (human)		2e-08	triglyceride measurement	blood triglyceride level (CMO:0000118)	6	31872244	31872245	Human
597144915	GWAS1240989_H	coffee consumption measurement QTL GWAS1240989 (human)		2e-08	coffee consumption measurement		6	31869473	31869474	Human
597099858	GWAS1195932_H	cups of coffee per day measurement QTL GWAS1195932 (human)		8e-09	cups of coffee per day measurement		6	31869500	31869501	Human
406985604	GWAS634580_H	low density lipoprotein cholesterol measurement, alcohol drinking QTL GWAS634580 (human)		4e-12	low density lipoprotein cholesterol measurement, alcohol drinking	blood low density lipoprotein cholesterol level (CMO:0000053)	6	31872244	31872245	Human
597471316	GWAS1567390_H	self reported educational attainment QTL GWAS1567390 (human)		5e-12	self reported educational attainment		6	31878208	31878209	Human
597250135	GWAS1346209_H	streptococcus seropositivity QTL GWAS1346209 (human)		4e-11	streptococcus seropositivity		6	31872700	31872701	Human
406982034	GWAS631010_H	triglyceride measurement, alcohol drinking QTL GWAS631010 (human)		1e-14	triglyceride measurement, alcohol drinking	blood triglyceride level (CMO:0000118)	6	31872244	31872245	Human
597025861	GWAS1121935_H	triglyceride measurement QTL GWAS1121935 (human)		1e-10	triglyceride measurement	blood triglyceride level (CMO:0000118)	6	31872244	31872245	Human
597041478	GWAS1137552_H	appendicular lean mass QTL GWAS1137552 (human)		2e-12	appendicular lean mass		6	31874113	31874114	Human
597249861	GWAS1345935_H	streptococcus seropositivity QTL GWAS1345935 (human)		7e-23	streptococcus seropositivity		6	31872700	31872701	Human
597051464	GWAS1147538_H	triglyceride measurement, physical activity QTL GWAS1147538 (human)		4e-14	triglyceride measurement, physical activity	blood triglyceride level (CMO:0000118)	6	31872244	31872245	Human
1358839	MULTSCL5_H	Multiple sclerosis susceptibility QTL 5 (human)			Multiple sclerosis susceptibility		6	19584311	45584311	Human
597027185	GWAS1123259_H	low density lipoprotein cholesterol measurement QTL GWAS1123259 (human)		3e-09	low density lipoprotein cholesterol measurement	blood low density lipoprotein cholesterol level (CMO:0000053)	6	31872244	31872245	Human
597316478	GWAS1412552_H	BMI-adjusted waist circumference QTL GWAS1412552 (human)		3e-08	body size trait (VT:0100005)		6	31872244	31872245	Human
407135650	GWAS784626_H	chronotype measurement QTL GWAS784626 (human)		3e-08	sleep behavior trait (VT:0001501)		6	31872678	31872679	Human
597316477	GWAS1412551_H	BMI-adjusted waist circumference QTL GWAS1412551 (human)		6e-09	body size trait (VT:0100005)		6	31870186	31870187	Human
597244275	GWAS1340349_H	BMI-adjusted waist circumference QTL GWAS1340349 (human)		7e-16	body size trait (VT:0100005)		6	31870936	31870937	Human
1298431	RA11_H	Rheumatoid arthritis QTL 11 (human)		0.0000024	Joint/bone inflammation	rheumatoid arthritis	6	19911883	40191709	Human
597244276	GWAS1340350_H	BMI-adjusted waist circumference QTL GWAS1340350 (human)		1e-24	body size trait (VT:0100005)		6	31872244	31872245	Human
597298287	GWAS1394361_H	BMI-adjusted waist-hip ratio QTL GWAS1394361 (human)		3e-12	body size trait (VT:0100005)		6	31873232	31873233	Human
597272174	GWAS1368248_H	MHC class I polypeptide-related sequence A measurement QTL GWAS1368248 (human)		7e-22	MHC class I polypeptide-related sequence A measurement		6	31868665	31868666	Human

Markers in Region

D15S948E

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	6	31,847,560 - 31,847,629	UniSTS	GRCh37
Build 36	6	31,955,539 - 31,955,608	RGD	NCBI36
Celera	6	33,446,141 - 33,446,210	RGD
Cytogenetic Map	6	p21.31	UniSTS
Cytogenetic Map	6	p21.3	UniSTS
HuRef	6	31,633,364 - 31,633,433	UniSTS

RH70238

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	6	31,847,577 - 31,847,737	UniSTS	GRCh37
Build 36	6	31,955,556 - 31,955,716	RGD	NCBI36
Celera	6	33,446,158 - 33,446,318	RGD
Cytogenetic Map	6	p21.31	UniSTS
Cytogenetic Map	6	p21.3	UniSTS
HuRef	6	31,633,381 - 31,633,541	UniSTS
GeneMap99-GB4 RH Map	6	119.82	UniSTS

RH46780

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	6	31,847,566 - 31,847,686	UniSTS	GRCh37
Build 36	6	31,955,545 - 31,955,665	RGD	NCBI36
Celera	6	33,446,147 - 33,446,267	RGD
Cytogenetic Map	6	p21.31	UniSTS
Cytogenetic Map	6	p21.3	UniSTS
HuRef	6	31,633,370 - 31,633,490	UniSTS
GeneMap99-GB4 RH Map	6	145.45	UniSTS
NCBI RH Map	6	509.1	UniSTS

WI-19170

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	6	31,847,566 - 31,847,846	UniSTS	GRCh37
Build 36	6	31,955,545 - 31,955,825	RGD	NCBI36
Celera	6	33,446,147 - 33,446,427	RGD
Cytogenetic Map	6	p21.31	UniSTS
Cytogenetic Map	6	p21.3	UniSTS
HuRef	6	31,633,370 - 31,633,650	UniSTS
GeneMap99-GB4 RH Map	6	146.3	UniSTS
Whitehead-RH Map	6	159.6	UniSTS
NCBI RH Map	6	509.1	UniSTS

D6S2924

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	6	31,836,518 - 31,836,670	UniSTS	GRCh37
Build 36	6	31,944,497 - 31,944,649	RGD	NCBI36
Celera	6	33,435,105 - 33,435,253	RGD
Cytogenetic Map	6	p21.3	UniSTS
HuRef	6	31,622,332 - 31,622,476	UniSTS

STS-X69838

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	6	31,847,588 - 31,847,741	UniSTS	GRCh37
Build 36	6	31,955,567 - 31,955,720	RGD	NCBI36
Celera	6	33,446,169 - 33,446,322	RGD
Cytogenetic Map	6	p21.31	UniSTS
Cytogenetic Map	6	p21.3	UniSTS
HuRef	6	31,633,392 - 31,633,545	UniSTS
GeneMap99-GB4 RH Map	6	119.82	UniSTS

D6S2052

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	6	31,847,561 - 31,847,686	UniSTS	GRCh37
Build 36	6	31,955,540 - 31,955,665	RGD	NCBI36
Celera	6	33,446,142 - 33,446,267	RGD
Cytogenetic Map	6	p21.31	UniSTS
Cytogenetic Map	6	p21.3	UniSTS
HuRef	6	31,633,365 - 31,633,490	UniSTS

UniSTS:237636

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	6	31,848,453 - 31,848,594	UniSTS	GRCh37
Build 36	6	31,956,432 - 31,956,573	RGD	NCBI36
Celera	6	33,447,034 - 33,447,175	RGD
HuRef	6	31,634,257 - 31,634,398	UniSTS

MARC_12895-12896:999881472:3

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	6	31,847,968 - 31,848,521	UniSTS	GRCh37
Build 36	6	31,955,947 - 31,956,500	RGD	NCBI36
Celera	6	33,446,549 - 33,447,102	RGD
HuRef	6	31,633,772 - 31,634,325	UniSTS

MN6S1424

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	6	31,836,552 - 31,836,671	UniSTS	GRCh37
Build 36	6	31,944,531 - 31,944,650	RGD	NCBI36
Celera	6	33,435,139 - 33,435,254	RGD
Cytogenetic Map	6	p21.3	UniSTS
HuRef	6	31,622,366 - 31,622,477	UniSTS

D15S1477

Human Assembly	Chr	Position (strand)	Source
Cytogenetic Map	4	q32-q35	UniSTS
Cytogenetic Map	5	q11	UniSTS
Cytogenetic Map	10	p12.1	UniSTS
Cytogenetic Map	10	p12.1-p11.2	UniSTS
Cytogenetic Map	15	q13	UniSTS
Cytogenetic Map	21	q21.3	UniSTS
Cytogenetic Map	12	p13.3	UniSTS
Cytogenetic Map	1	q25	UniSTS
Cytogenetic Map	20	q13.3	UniSTS
Cytogenetic Map	14	q11.2	UniSTS
Cytogenetic Map	11	p15.4	UniSTS
Cytogenetic Map	12	q12	UniSTS
Cytogenetic Map	3	p24.3	UniSTS
Cytogenetic Map	5	q14	UniSTS
Cytogenetic Map	3	q29	UniSTS
Cytogenetic Map	1	p36.13	UniSTS
Cytogenetic Map	7	q36.3	UniSTS
Cytogenetic Map	7	p21.3	UniSTS
Cytogenetic Map	1	q22	UniSTS
Cytogenetic Map	14	q32.33	UniSTS
Cytogenetic Map	14	q23.3	UniSTS
Cytogenetic Map	19	q13.4	UniSTS
Cytogenetic Map	2	q11.2	UniSTS
Cytogenetic Map	14	q31-q32	UniSTS
Cytogenetic Map	10	q25.2	UniSTS
Cytogenetic Map	16	p13.13-p13.12	UniSTS
Cytogenetic Map	3	q12.3	UniSTS
Cytogenetic Map	14	q24.3	UniSTS
Cytogenetic Map	10	p15.3	UniSTS
Cytogenetic Map	2	p22.1	UniSTS
Cytogenetic Map	13	q13.1	UniSTS
Cytogenetic Map	5	q23.3	UniSTS
Cytogenetic Map	15	q21.1	UniSTS
Cytogenetic Map	19	q13.42	UniSTS
Cytogenetic Map	17	q21	UniSTS
Cytogenetic Map	3	p21.3	UniSTS
Cytogenetic Map	12	q24.13	UniSTS
Cytogenetic Map	4	q21.1	UniSTS
Cytogenetic Map	19	q13.3	UniSTS
Cytogenetic Map	2	q37.3	UniSTS
Cytogenetic Map	2	p15	UniSTS
Cytogenetic Map	17	q25.3	UniSTS
Cytogenetic Map	19	p13	UniSTS
Cytogenetic Map	4	p16.3	UniSTS
Cytogenetic Map	1	p35.1	UniSTS
Cytogenetic Map	17	q11.2	UniSTS
Cytogenetic Map	1	p31.3	UniSTS
Cytogenetic Map	20	q13.31	UniSTS
Cytogenetic Map	10	q22	UniSTS
Cytogenetic Map	1	q41	UniSTS
Cytogenetic Map	9	q34.3	UniSTS
Cytogenetic Map	9	p13.3	UniSTS
Cytogenetic Map	12	q24.31	UniSTS
Cytogenetic Map	2	p13.1	UniSTS
Cytogenetic Map	19	q13.12	UniSTS
Cytogenetic Map	10	q24.2	UniSTS
Cytogenetic Map	1	q42.11	UniSTS
Cytogenetic Map	1	q32.1	UniSTS
Cytogenetic Map	2	p23.3	UniSTS
Cytogenetic Map	2	p13.3	UniSTS
Cytogenetic Map	7	p22.1	UniSTS
Cytogenetic Map	11	q24	UniSTS
Cytogenetic Map	6	q16.2	UniSTS
Cytogenetic Map	2	q14	UniSTS
Cytogenetic Map	19	q13.1	UniSTS
Cytogenetic Map	16	q24	UniSTS
Cytogenetic Map	X	q26.3	UniSTS
Cytogenetic Map	10	q23.1	UniSTS
Cytogenetic Map	3	p21.31	UniSTS
Cytogenetic Map	4	q12	UniSTS
Cytogenetic Map	19	p13.2	UniSTS
Cytogenetic Map	2	p11.2	UniSTS
Cytogenetic Map	7	q21.2	UniSTS
Cytogenetic Map	17	q22.2	UniSTS
Cytogenetic Map	8	q22.3	UniSTS
Cytogenetic Map	4	q25	UniSTS
Cytogenetic Map	11	q14.2	UniSTS
Cytogenetic Map	19	p13.3	UniSTS
Cytogenetic Map	5	q23	UniSTS
Cytogenetic Map	16	p13.3	UniSTS
Cytogenetic Map	16	q22.1	UniSTS
Cytogenetic Map	13	q12.1	UniSTS
Cytogenetic Map	6	p21.32	UniSTS
Cytogenetic Map	2	q31	UniSTS
Cytogenetic Map	10	p14	UniSTS
Cytogenetic Map	6	p21.3	UniSTS
Cytogenetic Map	3	p21.2	UniSTS
Cytogenetic Map	1	q21.3	UniSTS
Cytogenetic Map	19	p12	UniSTS
Cytogenetic Map	7	q22.1	UniSTS
Cytogenetic Map	14	q12	UniSTS
Cytogenetic Map	8	p11.22	UniSTS
Cytogenetic Map	19	q13.32	UniSTS
Cytogenetic Map	17	q21.31	UniSTS
Cytogenetic Map	4	q28.2	UniSTS
Cytogenetic Map	1	p13.2	UniSTS
Cytogenetic Map	22	q12.3	UniSTS
Cytogenetic Map	19	p13.11	UniSTS
Cytogenetic Map	16	p12.3	UniSTS
Cytogenetic Map	15	q22.31	UniSTS
Cytogenetic Map	2	q31.1	UniSTS
Cytogenetic Map	2	q33.2	UniSTS
Cytogenetic Map	1	p34.3	UniSTS
Cytogenetic Map	1	p36.31	UniSTS
Cytogenetic Map	3	q21.3	UniSTS
Cytogenetic Map	17	q25	UniSTS
Cytogenetic Map	11	p13	UniSTS
Cytogenetic Map	12	q13.3	UniSTS
Cytogenetic Map	1	p36.21	UniSTS
Cytogenetic Map	1	p35.3	UniSTS
Cytogenetic Map	19	q13.2	UniSTS
Cytogenetic Map	4	p14	UniSTS
Cytogenetic Map	15	q11-q13	UniSTS
Cytogenetic Map	19	p	UniSTS
Cytogenetic Map	7	q22	UniSTS
Cytogenetic Map	9	q22.3	UniSTS
Cytogenetic Map	3	p25.3	UniSTS
Cytogenetic Map	11	q13	UniSTS
Cytogenetic Map	8	q11.21	UniSTS
Cytogenetic Map	15	q15	UniSTS
Cytogenetic Map	15	q15.1	UniSTS
Cytogenetic Map	2	q22.3	UniSTS
Cytogenetic Map	1	p34.2	UniSTS
Cytogenetic Map	5	q13.2	UniSTS
Cytogenetic Map	10	q23.2	UniSTS
Cytogenetic Map	7	p22.3	UniSTS
Cytogenetic Map	9	q34.13	UniSTS
Cytogenetic Map	1	q32	UniSTS
Cytogenetic Map	1	q31.3	UniSTS
Cytogenetic Map	4	q35	UniSTS
Cytogenetic Map	9	p13	UniSTS
Cytogenetic Map	3	p24.2	UniSTS
Cytogenetic Map	3	q23	UniSTS
Cytogenetic Map	6	q25.2-q25.3	UniSTS
Cytogenetic Map	15	q21	UniSTS
Cytogenetic Map	16	p11.2	UniSTS
Cytogenetic Map	1	q42.3	UniSTS
Cytogenetic Map	7	q22.3	UniSTS
Cytogenetic Map	9	q34.2	UniSTS
Cytogenetic Map	17	q24	UniSTS
Cytogenetic Map	17	q25.1	UniSTS
Cytogenetic Map	19	q13.3-q13.4	UniSTS
Cytogenetic Map	22	q11.23	UniSTS
Cytogenetic Map	3	q21	UniSTS
Cytogenetic Map	20	q13	UniSTS
Cytogenetic Map	22	q12.2	UniSTS
Cytogenetic Map	19	p13.12	UniSTS
Cytogenetic Map	14	q22.1	UniSTS
Cytogenetic Map	11	q23.1	UniSTS
Cytogenetic Map	17	q22-q23	UniSTS
Cytogenetic Map	X	p22.33	UniSTS
Cytogenetic Map	Y	p11.3	UniSTS
Cytogenetic Map	6	p21.1	UniSTS
Cytogenetic Map	22	q13.1	UniSTS
Cytogenetic Map	7	p15.2	UniSTS
Cytogenetic Map	1	q21	UniSTS
Cytogenetic Map	12	q23.1	UniSTS
Cytogenetic Map	16	q12.2	UniSTS
Cytogenetic Map	13	q11	UniSTS
Cytogenetic Map	X	p22.3	UniSTS
Cytogenetic Map	3	p25-p24	UniSTS
Cytogenetic Map	22	q13.2	UniSTS
Cytogenetic Map	2	p21	UniSTS
Cytogenetic Map	X	q22.1	UniSTS
Cytogenetic Map	X	p11.3	UniSTS
Cytogenetic Map	3	p12	UniSTS
Cytogenetic Map	1	q25.1	UniSTS
Cytogenetic Map	17	p11.2	UniSTS
Cytogenetic Map	X	p11.2	UniSTS
Cytogenetic Map	11	q13.1-q13.2	UniSTS
Cytogenetic Map	8	q24.3	UniSTS
Cytogenetic Map	17	p13	UniSTS
Cytogenetic Map	5	p13.2	UniSTS
Cytogenetic Map	7	q21-q22	UniSTS
Cytogenetic Map	9	q34.11	UniSTS
Cytogenetic Map	3	q26.2	UniSTS
Cytogenetic Map	20	q11.22	UniSTS
Cytogenetic Map	8	p22	UniSTS
Cytogenetic Map	4	q35.1	UniSTS
Cytogenetic Map	10	q23.31	UniSTS
Cytogenetic Map	6	p21.1-p12.2	UniSTS
Cytogenetic Map	12	q14.1	UniSTS
Cytogenetic Map	7	p11.2	UniSTS
Cytogenetic Map	11	p15.5	UniSTS
Cytogenetic Map	1	p35	UniSTS
Cytogenetic Map	12	q	UniSTS
Cytogenetic Map	1	q21.2	UniSTS
Cytogenetic Map	8	q23.1	UniSTS
Cytogenetic Map	1	p13.3	UniSTS
Cytogenetic Map	14	q11.1	UniSTS
Cytogenetic Map	21	q22.11	UniSTS
Cytogenetic Map	3	p14.1	UniSTS
Cytogenetic Map	5	q31	UniSTS
Cytogenetic Map	19	p13.3-p13.2	UniSTS
Cytogenetic Map	1	p36.11-p34.2	UniSTS
Cytogenetic Map	9	p22	UniSTS
Cytogenetic Map	1	q42.12	UniSTS
Cytogenetic Map	2	q35	UniSTS
Cytogenetic Map	9	p22.1	UniSTS
Cytogenetic Map	11	q24.2	UniSTS
Cytogenetic Map	12	q15	UniSTS
Cytogenetic Map	17	p13.2	UniSTS
Cytogenetic Map	8	q22.1	UniSTS
Cytogenetic Map	9	q21.13	UniSTS
Cytogenetic Map	11	p15.1	UniSTS
Cytogenetic Map	1	p32.3	UniSTS
Cytogenetic Map	12	q21.1	UniSTS
Cytogenetic Map	20	q13.33	UniSTS
Cytogenetic Map	3	p21	UniSTS
Cytogenetic Map	20	p11.23	UniSTS
Cytogenetic Map	15	q15.2	UniSTS
Cytogenetic Map	8	p21.1	UniSTS
Cytogenetic Map	1	p36.33	UniSTS
Cytogenetic Map	18	q12.1	UniSTS
Cytogenetic Map	8	q12.1	UniSTS
Cytogenetic Map	14	q21.2	UniSTS
Cytogenetic Map	3	q27.1	UniSTS
Cytogenetic Map	3	p14.3	UniSTS
Cytogenetic Map	17	p13.1	UniSTS
Cytogenetic Map	6	p22.1	UniSTS
Cytogenetic Map	12	p13.2	UniSTS
Cytogenetic Map	12	q13.13	UniSTS
Cytogenetic Map	15	q21.3	UniSTS
Cytogenetic Map	X	p11.22	UniSTS
Cytogenetic Map	12	p12	UniSTS
Cytogenetic Map	15	q15.3	UniSTS
Cytogenetic Map	18	q12.3	UniSTS
Cytogenetic Map	21	q22.3	UniSTS
Cytogenetic Map	12	q11-q12	UniSTS
Cytogenetic Map	3	q13.33	UniSTS
Cytogenetic Map	11	q13.4	UniSTS
Cytogenetic Map	2	p24	UniSTS
Cytogenetic Map	8	q24.21	UniSTS
Cytogenetic Map	12	q22-q23.1	UniSTS
Cytogenetic Map	3	q26.33	UniSTS
Cytogenetic Map	5	q32	UniSTS
Cytogenetic Map	15	q21-q22	UniSTS
Cytogenetic Map	8	p21.2	UniSTS
Cytogenetic Map	10	q23	UniSTS
Cytogenetic Map	1	p22	UniSTS
Cytogenetic Map	16	p13.13	UniSTS
Cytogenetic Map	17	p13.3	UniSTS
Cytogenetic Map	10	q24	UniSTS
Cytogenetic Map	8	q11.2	UniSTS
Cytogenetic Map	7	p14-p13	UniSTS
Cytogenetic Map	11	q22-q23	UniSTS
Cytogenetic Map	6	q22-q23	UniSTS
Cytogenetic Map	2	p16.1	UniSTS
Cytogenetic Map	15	q26.3	UniSTS
Cytogenetic Map	7	p14.3	UniSTS
Cytogenetic Map	4	q21.22	UniSTS
Cytogenetic Map	1	q21.1	UniSTS
Cytogenetic Map	17	q21.33	UniSTS
Cytogenetic Map	17	q12	UniSTS
Cytogenetic Map	16	p12.1	UniSTS
Cytogenetic Map	14	q32.31	UniSTS
Cytogenetic Map	11	q24.3	UniSTS
Cytogenetic Map	11	q13.1-q13.3	UniSTS
Cytogenetic Map	14	q24.2	UniSTS
Cytogenetic Map	17	q23.3	UniSTS
Cytogenetic Map	2	q24	UniSTS
Cytogenetic Map	1	q23.3	UniSTS
Cytogenetic Map	10	q25	UniSTS
Cytogenetic Map	9	q32	UniSTS
Cytogenetic Map	3	q25.33	UniSTS
Cytogenetic Map	2	p14	UniSTS
Cytogenetic Map	15	q21-q23	UniSTS
Cytogenetic Map	7	q11.23	UniSTS
Cytogenetic Map	3	p22.1	UniSTS
Cytogenetic Map	19	q13.11	UniSTS
Cytogenetic Map	15	q25.2	UniSTS
Cytogenetic Map	10	q26.3	UniSTS
Cytogenetic Map	6	p21	UniSTS
Cytogenetic Map	2	p25.2	UniSTS
Cytogenetic Map	14	q23.1	UniSTS
Cytogenetic Map	1	p31.1	UniSTS
Cytogenetic Map	15	q14-q15	UniSTS
Cytogenetic Map	5	q31.1	UniSTS
Cytogenetic Map	1	p34	UniSTS
Cytogenetic Map	X	q22.3	UniSTS
Cytogenetic Map	7	p15.3	UniSTS
Cytogenetic Map	6	p25.2	UniSTS
Cytogenetic Map	6	q25.1	UniSTS
Cytogenetic Map	12	p12.1	UniSTS
Cytogenetic Map	X	q25	UniSTS
Cytogenetic Map	14	q23.2	UniSTS
Cytogenetic Map	11	q12	UniSTS
Cytogenetic Map	2	p25.1	UniSTS
Cytogenetic Map	5	q35	UniSTS
Cytogenetic Map	16	q21	UniSTS
Cytogenetic Map	6	p23	UniSTS
Cytogenetic Map	7	q34	UniSTS
Cytogenetic Map	4	p16.1	UniSTS
Cytogenetic Map	3	q25.31	UniSTS
Cytogenetic Map	2	q33.1	UniSTS
Cytogenetic Map	17	q21.2	UniSTS
Cytogenetic Map	19	q13.41	UniSTS
Cytogenetic Map	11	q12.3	UniSTS
Cytogenetic Map	11	q13.1	UniSTS
Cytogenetic Map	10	q24.31	UniSTS
Cytogenetic Map	20	q13.13	UniSTS
Cytogenetic Map	1	p22.1	UniSTS
Cytogenetic Map	10	q22.2	UniSTS
Cytogenetic Map	6	q13	UniSTS
Cytogenetic Map	10	q21.3	UniSTS
Cytogenetic Map	17	p12	UniSTS
Cytogenetic Map	11	q23.3	UniSTS
Cytogenetic Map	4	q31.1	UniSTS
Cytogenetic Map	19	q13.43	UniSTS
Cytogenetic Map	18	q21.3	UniSTS
Cytogenetic Map	11	q21	UniSTS
Cytogenetic Map	5	q13	UniSTS
Cytogenetic Map	11	q23.2	UniSTS
Cytogenetic Map	8	q12	UniSTS
Cytogenetic Map	4	q28-q32	UniSTS
Cytogenetic Map	19	q13.33	UniSTS
Cytogenetic Map	15	q21.2	UniSTS
Cytogenetic Map	16	q24.1	UniSTS
Cytogenetic Map	9	q34	UniSTS
Cytogenetic Map	5	q12.3	UniSTS
Cytogenetic Map	12	q24.11	UniSTS
Cytogenetic Map	9	q21.12	UniSTS
Cytogenetic Map	9	q33.3	UniSTS
Cytogenetic Map	11	q22.3	UniSTS
Cytogenetic Map	20	p11.22-p11.1	UniSTS
Cytogenetic Map	10	q24.32	UniSTS
Cytogenetic Map	20	p13	UniSTS
Cytogenetic Map	16	q23.1	UniSTS
Cytogenetic Map	13	q14.2	UniSTS
Cytogenetic Map	2	q24.3	UniSTS
Cytogenetic Map	8	p12	UniSTS
Cytogenetic Map	7	p13	UniSTS
Cytogenetic Map	9	q31-q33	UniSTS
Cytogenetic Map	6	p24.1	UniSTS
Cytogenetic Map	10	p11.23	UniSTS
Cytogenetic Map	6	q15	UniSTS
Cytogenetic Map	5	q35.2	UniSTS
Cytogenetic Map	14	q32	UniSTS
Cytogenetic Map	3	q26.1-q26.2	UniSTS
Cytogenetic Map	5	q11.2-q13.2	UniSTS
Cytogenetic Map	1	p36.11	UniSTS
Cytogenetic Map	1	q25.2	UniSTS
Cytogenetic Map	X	p11.4	UniSTS
Cytogenetic Map	X	q13.3	UniSTS
Cytogenetic Map	8	q22.2	UniSTS
Cytogenetic Map	7	q11.21	UniSTS
Cytogenetic Map	5	q35.1	UniSTS
Cytogenetic Map	5	q33.1	UniSTS
Cytogenetic Map	4	q21.21	UniSTS
Cytogenetic Map	2	q21.1	UniSTS
Cytogenetic Map	22	q11.21	UniSTS
Cytogenetic Map	18	p11.21	UniSTS
Cytogenetic Map	X	q13.1	UniSTS
Cytogenetic Map	X	q21.1	UniSTS
Cytogenetic Map	10	p11.21	UniSTS
Cytogenetic Map	12	q14.3	UniSTS
Cytogenetic Map	5	q34	UniSTS
Cytogenetic Map	2	q36.1	UniSTS
Cytogenetic Map	12	p11.21	UniSTS
Cytogenetic Map	5	q33.3	UniSTS
Cytogenetic Map	16	q23.2	UniSTS
Cytogenetic Map	9	q31.3	UniSTS
Cytogenetic Map	15	q24	UniSTS
Cytogenetic Map	11	q13.2	UniSTS
Cytogenetic Map	12	q21	UniSTS
Cytogenetic Map	8	p11.2	UniSTS
Cytogenetic Map	7	q22-q31	UniSTS
Cytogenetic Map	22	q12	UniSTS
Cytogenetic Map	4	q22	UniSTS
Cytogenetic Map	17	q21.32	UniSTS
Cytogenetic Map	12	q14	UniSTS
Cytogenetic Map	11	q23.1-q23.2	UniSTS
Cytogenetic Map	13	q14	UniSTS
Cytogenetic Map	13	q32.2	UniSTS
Cytogenetic Map	17	q	UniSTS
Cytogenetic Map	2	q33	UniSTS
Cytogenetic Map	7	q	UniSTS
Cytogenetic Map	16	p12.2	UniSTS
Cytogenetic Map	10	q11.23	UniSTS
Cytogenetic Map	20	q13.12	UniSTS
Cytogenetic Map	22	q13.33	UniSTS
Cytogenetic Map	13	q22.1	UniSTS
Cytogenetic Map	3	p25.2	UniSTS
Cytogenetic Map	5	q21.3	UniSTS
Cytogenetic Map	9	q22.2	UniSTS
Cytogenetic Map	3	p22.2	UniSTS
Cytogenetic Map	6	p24.2	UniSTS

ksks210

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	6	31,848,011 - 31,848,520	UniSTS	GRCh37
Celera	6	33,446,592 - 33,447,101	UniSTS
HuRef	6	31,633,815 - 31,634,324	UniSTS

D8S2279

Human Assembly	Chr	Position (strand)	Source
Cytogenetic Map	21	q22.12	UniSTS
Cytogenetic Map	15	q13	UniSTS
Cytogenetic Map	9	q32	UniSTS
Cytogenetic Map	15	q22.3	UniSTS
Cytogenetic Map	17	p12	UniSTS
Cytogenetic Map	21	q21.3	UniSTS
Cytogenetic Map	3	p22-p21.3	UniSTS
Cytogenetic Map	1	q21.1	UniSTS
Cytogenetic Map	2	q24.2	UniSTS
Cytogenetic Map	17	q24.2	UniSTS
Cytogenetic Map	1	q32	UniSTS
Cytogenetic Map	3	p25.3	UniSTS
Cytogenetic Map	20	q13.3	UniSTS
Cytogenetic Map	2	q31.1	UniSTS
Cytogenetic Map	1	q21	UniSTS
Cytogenetic Map	3	p14.1	UniSTS
Cytogenetic Map	2	q37.3	UniSTS
Cytogenetic Map	7	p14.1	UniSTS
Cytogenetic Map	2	q22.3	UniSTS
Cytogenetic Map	15	q13.2	UniSTS
Cytogenetic Map	12	q24.1	UniSTS
Cytogenetic Map	7	p15.2	UniSTS
Cytogenetic Map	5	q31.2	UniSTS
Cytogenetic Map	2	p25.2	UniSTS
Cytogenetic Map	3	p24.3	UniSTS
Cytogenetic Map	17	q25.3	UniSTS
Cytogenetic Map	15	q22.31	UniSTS
Cytogenetic Map	5	q14	UniSTS
Cytogenetic Map	5	q31	UniSTS
Cytogenetic Map	1	p36.32	UniSTS
Cytogenetic Map	1	q42.12	UniSTS
Cytogenetic Map	7	q21.11	UniSTS
Cytogenetic Map	9	q34.2	UniSTS
Cytogenetic Map	19	q13.3	UniSTS
Cytogenetic Map	22	q13.33	UniSTS
Cytogenetic Map	8	q22.3	UniSTS
Cytogenetic Map	6	p21.1-p12	UniSTS
Cytogenetic Map	1	p36.13	UniSTS
Cytogenetic Map	7	q36.3	UniSTS
Cytogenetic Map	2	p25.1	UniSTS
Cytogenetic Map	7	p21.3	UniSTS
Cytogenetic Map	4	q12	UniSTS
Cytogenetic Map	22	q11.22	UniSTS
Cytogenetic Map	11	p13	UniSTS
Cytogenetic Map	1	q12	UniSTS
Cytogenetic Map	8	p23	UniSTS
Cytogenetic Map	11	q13.2-q13.3	UniSTS
Cytogenetic Map	13	q14.1-q14.3	UniSTS
Cytogenetic Map	3	q22-q24	UniSTS
Cytogenetic Map	3	q13.1-q13.2	UniSTS
Cytogenetic Map	16	q24	UniSTS
Cytogenetic Map	5	q23.3-q31.1	UniSTS
Cytogenetic Map	8	p21.3	UniSTS
Cytogenetic Map	14	q32.3	UniSTS
Cytogenetic Map	7	q11.23	UniSTS
Cytogenetic Map	7	q32	UniSTS
Cytogenetic Map	14	q32.33	UniSTS
Cytogenetic Map	19	p13.2	UniSTS
Cytogenetic Map	9	q34.3	UniSTS
Cytogenetic Map	1	p32.3	UniSTS
Cytogenetic Map	17	q11	UniSTS
Cytogenetic Map	17	p13.1-p12	UniSTS
Cytogenetic Map	18	q21.33	UniSTS
Cytogenetic Map	19	p13.12	UniSTS
Cytogenetic Map	5	q14.1	UniSTS
Cytogenetic Map	14	q24.3	UniSTS
Cytogenetic Map	1	q21-q23	UniSTS
Cytogenetic Map	X	p11.23	UniSTS
Cytogenetic Map	4	q21.1	UniSTS
Cytogenetic Map	12	q13.13	UniSTS
Cytogenetic Map	14	q23.3	UniSTS
Cytogenetic Map	17	p12-p11.2	UniSTS
Cytogenetic Map	6	p21.1	UniSTS
Cytogenetic Map	1	q24	UniSTS
Cytogenetic Map	1	q43	UniSTS
Cytogenetic Map	9	q34.13	UniSTS
Cytogenetic Map	19	q13.4	UniSTS
Cytogenetic Map	2	q32	UniSTS
Cytogenetic Map	X	p22.2	UniSTS
Cytogenetic Map	19	p13.11	UniSTS
Cytogenetic Map	2	q33	UniSTS
Cytogenetic Map	10	p13	UniSTS
Cytogenetic Map	2	q11.2	UniSTS
Cytogenetic Map	3	q27	UniSTS
Cytogenetic Map	17	q25.1	UniSTS
Cytogenetic Map	4	p16.1	UniSTS
Cytogenetic Map	14	q22.3	UniSTS
Cytogenetic Map	10	q23-q24	UniSTS
Cytogenetic Map	2	q37.1	UniSTS
Cytogenetic Map	17	q12	UniSTS
Cytogenetic Map	14	q31-q32	UniSTS
Cytogenetic Map	5	p15.33	UniSTS
Cytogenetic Map	1	q23.2	UniSTS
Cytogenetic Map	16	q24.3	UniSTS
Cytogenetic Map	4	p14	UniSTS
Cytogenetic Map	2	q32.3	UniSTS
Cytogenetic Map	15	q21.1	UniSTS
Cytogenetic Map	4	q32.2	UniSTS
Cytogenetic Map	10	q23	UniSTS
Cytogenetic Map	5	q14.2	UniSTS
Cytogenetic Map	4	q32.1	UniSTS
Cytogenetic Map	1	q25.1	UniSTS
Cytogenetic Map	11	q14.1	UniSTS
Cytogenetic Map	4	p16.3	UniSTS
Cytogenetic Map	1	p34.2	UniSTS
Cytogenetic Map	11	q23.1	UniSTS
Cytogenetic Map	3	p21.1	UniSTS
Cytogenetic Map	16	q22.2	UniSTS
Cytogenetic Map	14	q32.31	UniSTS
Cytogenetic Map	16	q11.2	UniSTS
Cytogenetic Map	6	q22	UniSTS
Cytogenetic Map	10	p15.3	UniSTS
Cytogenetic Map	11	q23	UniSTS
Cytogenetic Map	22	q13.2	UniSTS
Cytogenetic Map	12	q12	UniSTS
Cytogenetic Map	19	q13.42	UniSTS
Cytogenetic Map	19	q13.11	UniSTS
Cytogenetic Map	12	q24.31	UniSTS
Cytogenetic Map	15	q15	UniSTS
Cytogenetic Map	2	q33.1	UniSTS
Cytogenetic Map	22	q12.3	UniSTS
Cytogenetic Map	20	q11	UniSTS
Cytogenetic Map	22	q11.23	UniSTS
Cytogenetic Map	17	q25	UniSTS
Cytogenetic Map	1	p13.3	UniSTS
Cytogenetic Map	3	p22.1	UniSTS
Cytogenetic Map	8	q22.1	UniSTS
Cytogenetic Map	16	q22.1	UniSTS
Cytogenetic Map	18	p11.31	UniSTS
Cytogenetic Map	19	p12	UniSTS
Cytogenetic Map	11	q13.1	UniSTS
Cytogenetic Map	19	p13.3	UniSTS
Cytogenetic Map	2	p22.1	UniSTS
Cytogenetic Map	16	p13.3	UniSTS
Cytogenetic Map	1	p35.2	UniSTS
Cytogenetic Map	Y	p11.2	UniSTS
Cytogenetic Map	13	q13.1	UniSTS
Cytogenetic Map	20	q11.22	UniSTS
Cytogenetic Map	19	q13.2	UniSTS
Cytogenetic Map	18	q12	UniSTS
Cytogenetic Map	17	q21.33	UniSTS
Cytogenetic Map	15	q15.1	UniSTS
Cytogenetic Map	3	q27.2	UniSTS
Cytogenetic Map	3	q21.3	UniSTS
Cytogenetic Map	5	p15.2	UniSTS
Cytogenetic Map	20	q13.12	UniSTS
Cytogenetic Map	17	q21	UniSTS
Cytogenetic Map	1	q42	UniSTS
Cytogenetic Map	14	q32.11	UniSTS
Cytogenetic Map	17	q21.2-q21.3	UniSTS
Cytogenetic Map	5	q32-q34	UniSTS
Cytogenetic Map	15	q14	UniSTS
Cytogenetic Map	16	q13	UniSTS
Cytogenetic Map	3	q21.2	UniSTS
Cytogenetic Map	3	p21.3	UniSTS
Cytogenetic Map	14	q24.2	UniSTS
Cytogenetic Map	12	q24.13	UniSTS
Cytogenetic Map	13	q14.11	UniSTS
Cytogenetic Map	3	q27.3	UniSTS
Cytogenetic Map	1	q32.3	UniSTS
Cytogenetic Map	6	p22.1	UniSTS
Cytogenetic Map	9	q34.11	UniSTS
Cytogenetic Map	6	q21	UniSTS
Cytogenetic Map	6	q25.3	UniSTS
Cytogenetic Map	2	p11.2	UniSTS
Cytogenetic Map	13	q14.3	UniSTS
Cytogenetic Map	17	q11.2	UniSTS
Cytogenetic Map	10	p12	UniSTS
Cytogenetic Map	2	q33.3	UniSTS
Cytogenetic Map	14	q21.3	UniSTS
Cytogenetic Map	8	p22-p21	UniSTS
Cytogenetic Map	18	q11.2	UniSTS
Cytogenetic Map	2	p15	UniSTS
Cytogenetic Map	17	q22	UniSTS
Cytogenetic Map	12	q21.33	UniSTS
Cytogenetic Map	20	q13.32	UniSTS
Cytogenetic Map	1	p34.1	UniSTS
Cytogenetic Map	10	q26	UniSTS
Cytogenetic Map	8	p23.1	UniSTS
Cytogenetic Map	19	p13	UniSTS
Cytogenetic Map	7	q21.13	UniSTS
Cytogenetic Map	7	q31.1	UniSTS
Cytogenetic Map	1	p33	UniSTS
Cytogenetic Map	21	q22.3	UniSTS
Cytogenetic Map	1	p35.1	UniSTS
Cytogenetic Map	22	q12.2	UniSTS
Cytogenetic Map	9	q22.3	UniSTS
Cytogenetic Map	8	q13.1	UniSTS
Cytogenetic Map	3	q25	UniSTS
Cytogenetic Map	1	p36.33	UniSTS
Cytogenetic Map	20	q13.33	UniSTS
Cytogenetic Map	1	p31.3	UniSTS
Cytogenetic Map	14	q31.1	UniSTS
Cytogenetic Map	22	q13.1	UniSTS
Cytogenetic Map	12	q13.2	UniSTS
Cytogenetic Map	22	q13.31-q13.33	UniSTS
Cytogenetic Map	20	q13.31	UniSTS
Cytogenetic Map	11	p11.2	UniSTS
Cytogenetic Map	1	q41	UniSTS
Cytogenetic Map	1	p36.11	UniSTS
Cytogenetic Map	15	q25.2	UniSTS
Cytogenetic Map	14	q11.2	UniSTS
Cytogenetic Map	17	q23.2	UniSTS
Cytogenetic Map	7	q32.2	UniSTS
Cytogenetic Map	19	q13.12	UniSTS
Cytogenetic Map	1	q32.1	UniSTS
Cytogenetic Map	6	q25.1	UniSTS
Cytogenetic Map	19	q13.43	UniSTS
Cytogenetic Map	9	p13.3	UniSTS
Cytogenetic Map	16	p11.2	UniSTS
Cytogenetic Map	2	p13.1	UniSTS
Cytogenetic Map	22	q11.21	UniSTS
Cytogenetic Map	3	q29	UniSTS
Cytogenetic Map	7	p13	UniSTS
Cytogenetic Map	11	q23.3	UniSTS
Cytogenetic Map	14	q31-q32.1	UniSTS
Cytogenetic Map	1	q42.11	UniSTS
Cytogenetic Map	4	q35.1	UniSTS
Cytogenetic Map	2	p23.3	UniSTS
Cytogenetic Map	2	p13.3	UniSTS
Cytogenetic Map	X	p11.3	UniSTS
Cytogenetic Map	2	q11.2-q12.1	UniSTS
Cytogenetic Map	20	q13.13	UniSTS
Cytogenetic Map	1	p22	UniSTS
Cytogenetic Map	6	q16.2	UniSTS
Cytogenetic Map	18	q23	UniSTS
Cytogenetic Map	2	q14	UniSTS
Cytogenetic Map	20	p11.23-p11.21	UniSTS
Cytogenetic Map	16	p12.2	UniSTS
Cytogenetic Map	8	p11.23	UniSTS
Cytogenetic Map	19	q13.1	UniSTS
Cytogenetic Map	19	q13	UniSTS
Cytogenetic Map	8	p11.21	UniSTS
Cytogenetic Map	12	q14.3	UniSTS
Cytogenetic Map	X	q26.3	UniSTS
Cytogenetic Map	8	q24.11	UniSTS
Cytogenetic Map	10	q23.1	UniSTS
Cytogenetic Map	1	q44	UniSTS
Cytogenetic Map	9	q22.33	UniSTS
Cytogenetic Map	3	p21.31	UniSTS
Cytogenetic Map	17	p13.2	UniSTS
Cytogenetic Map	9	q21.32	UniSTS
Cytogenetic Map	7	q34	UniSTS
Cytogenetic Map	9	q33.3	UniSTS
Cytogenetic Map	1	p36.1	UniSTS
Cytogenetic Map	20	q12	UniSTS
Cytogenetic Map	4	q21.23	UniSTS
Cytogenetic Map	5	q13.2	UniSTS
Cytogenetic Map	22	q12.1	UniSTS
Cytogenetic Map	5	q31.1	UniSTS
Cytogenetic Map	2	q21.3	UniSTS
Cytogenetic Map	7	q21.2	UniSTS
Cytogenetic Map	17	q22.2	UniSTS
Cytogenetic Map	17	p13	UniSTS
Cytogenetic Map	12	q24.11	UniSTS
Cytogenetic Map	18	q21	UniSTS
Cytogenetic Map	10	q11.1	UniSTS
Cytogenetic Map	22	q11.2	UniSTS
Cytogenetic Map	19	q12	UniSTS
Cytogenetic Map	7	q34-q35	UniSTS
Cytogenetic Map	15	q24.1	UniSTS
Cytogenetic Map	18	p11.21	UniSTS
Cytogenetic Map	1	q23.1	UniSTS
Cytogenetic Map	19	q13.41	UniSTS
Cytogenetic Map	6	p25.1-p23	UniSTS
Cytogenetic Map	11	p15.4	UniSTS
Cytogenetic Map	10	q22	UniSTS
Cytogenetic Map	5	q35.3	UniSTS
Cytogenetic Map	18	q12.1-q21.1	UniSTS
Cytogenetic Map	12	p13.1	UniSTS
Cytogenetic Map	13	q12.1	UniSTS
Cytogenetic Map	12	q15	UniSTS
Cytogenetic Map	6	p21.32	UniSTS
Cytogenetic Map	8	q24.3	UniSTS
Cytogenetic Map	10	p14	UniSTS
Cytogenetic Map	12	p13.1-p12.3	UniSTS
Cytogenetic Map	3	p25.2	UniSTS
Cytogenetic Map	6	p21.33	UniSTS
Cytogenetic Map	6	p21.3	UniSTS
Cytogenetic Map	3	p21.2	UniSTS
Cytogenetic Map	10	q26.3	UniSTS
Cytogenetic Map	1	q21.3	UniSTS
Cytogenetic Map	X	p21.2	UniSTS
Cytogenetic Map	7	q22.1	UniSTS
Cytogenetic Map	14	q12	UniSTS
Cytogenetic Map	8	p11.22	UniSTS
Cytogenetic Map	19	q13.32	UniSTS
Cytogenetic Map	2	q21.1	UniSTS
Cytogenetic Map	9	q21.12	UniSTS
Cytogenetic Map	15	q23	UniSTS
Cytogenetic Map	7	p22.2	UniSTS
Cytogenetic Map	8	p21.2	UniSTS
Cytogenetic Map	7	q33	UniSTS
Cytogenetic Map	15	q15.3	UniSTS
Cytogenetic Map	4	q21.22	UniSTS
Cytogenetic Map	12	q13.12	UniSTS
Cytogenetic Map	10	q24.31	UniSTS
Cytogenetic Map	12	p13.31	UniSTS
Cytogenetic Map	14	q32.12	UniSTS
Cytogenetic Map	10	q24.32	UniSTS
Cytogenetic Map	11	q12.3	UniSTS
Cytogenetic Map	16	p12.3	UniSTS
Cytogenetic Map	1	p34.3	UniSTS
Cytogenetic Map	1	p36.21	UniSTS
Cytogenetic Map	2	q24.3	UniSTS
Cytogenetic Map	2	q33.2	UniSTS
Cytogenetic Map	16	q24.1	UniSTS
Cytogenetic Map	1	p31.1	UniSTS
Cytogenetic Map	19	q13.33	UniSTS
Cytogenetic Map	1	p36.31	UniSTS
Cytogenetic Map	3	q13.31	UniSTS
Cytogenetic Map	15	q22.2	UniSTS
Cytogenetic Map	5	q32	UniSTS
Cytogenetic Map	6	q13	UniSTS
Cytogenetic Map	X	q24	UniSTS
Cytogenetic Map	6	q25	UniSTS
Cytogenetic Map	6	p21	UniSTS
Cytogenetic Map	2	q35	UniSTS
Cytogenetic Map	12	p13-p12	UniSTS
Cytogenetic Map	9	p13.2	UniSTS
Cytogenetic Map	6	p22	UniSTS
Cytogenetic Map	2	q12.1	UniSTS
Cytogenetic Map	17	p13.3	UniSTS
Cytogenetic Map	9	q22.2	UniSTS
Cytogenetic Map	1	q22	UniSTS
Cytogenetic Map	1	p22.1	UniSTS
Cytogenetic Map	1	p36	UniSTS
Cytogenetic Map	9	q13-q21	UniSTS
Cytogenetic Map	11	p15.5	UniSTS
Cytogenetic Map	X	p11.2	UniSTS
Cytogenetic Map	19	p	UniSTS
Cytogenetic Map	19	p13.1-p12	UniSTS
Cytogenetic Map	7	q22	UniSTS
Cytogenetic Map	12	q24.33	UniSTS
Cytogenetic Map	3	q21	UniSTS
Cytogenetic Map	8	q24	UniSTS
Cytogenetic Map	18	p11.31-p11.21	UniSTS
Cytogenetic Map	11	p15.3-p15.1	UniSTS
Cytogenetic Map	11	q13	UniSTS
Cytogenetic Map	8	q22	UniSTS
Cytogenetic Map	4	p15.1	UniSTS
Cytogenetic Map	1	q25.2	UniSTS
Cytogenetic Map	2	p16.3	UniSTS
Cytogenetic Map	16	p13.12	UniSTS
Cytogenetic Map	7	p21.2	UniSTS
Cytogenetic Map	12	q21.1	UniSTS
Cytogenetic Map	2	p14	UniSTS
Cytogenetic Map	6	q24.3	UniSTS
Cytogenetic Map	10	q22.2	UniSTS
Cytogenetic Map	5	q23.1	UniSTS
Cytogenetic Map	10	q23.2	UniSTS
Cytogenetic Map	7	p22.3	UniSTS
Cytogenetic Map	21	q22.2	UniSTS
Cytogenetic Map	6	q22.1	UniSTS
Cytogenetic Map	1	q42.1	UniSTS
Cytogenetic Map	1	q25	UniSTS
Cytogenetic Map	6	p22.3	UniSTS
Cytogenetic Map	1	q21.2	UniSTS
Cytogenetic Map	15	q22.1	UniSTS
Cytogenetic Map	12	p13.2	UniSTS
Cytogenetic Map	12	q22	UniSTS
Cytogenetic Map	3	p21-p12	UniSTS
Cytogenetic Map	4	q35	UniSTS
Cytogenetic Map	1	p34-p33	UniSTS
Cytogenetic Map	21	q22.11	UniSTS
Cytogenetic Map	3	p22-p21.33	UniSTS
Cytogenetic Map	3	q23	UniSTS
Cytogenetic Map	3	q22.1	UniSTS
Cytogenetic Map	8	q21.11	UniSTS
Cytogenetic Map	X	q22.3	UniSTS
Cytogenetic Map	7	p14	UniSTS
Cytogenetic Map	17	q21.1	UniSTS
Cytogenetic Map	15	q21	UniSTS
Cytogenetic Map	1	q42.3	UniSTS
Cytogenetic Map	9	q22	UniSTS
Cytogenetic Map	2	q12.3	UniSTS
Cytogenetic Map	20	q11.2-q13.2	UniSTS
Cytogenetic Map	17	q21.31	UniSTS
Cytogenetic Map	17	q24	UniSTS
Cytogenetic Map	3	q25.31	UniSTS
Cytogenetic Map	6	p24.3	UniSTS
Cytogenetic Map	2	q31.3	UniSTS
Cytogenetic Map	1	q31	UniSTS
Cytogenetic Map	7	q32-q33	UniSTS
Cytogenetic Map	7	q21.1	UniSTS
Cytogenetic Map	14	q23-q24.2	UniSTS
Cytogenetic Map	19	q13.3-q13.4	UniSTS
Cytogenetic Map	2	p24-p21	UniSTS
Cytogenetic Map	15	q11.2	UniSTS
Cytogenetic Map	15	q26.3	UniSTS
Cytogenetic Map	7	p22	UniSTS
Cytogenetic Map	12	p11	UniSTS
Cytogenetic Map	1	p35.3	UniSTS
Cytogenetic Map	1	p12	UniSTS
Cytogenetic Map	13	q32.3	UniSTS
Cytogenetic Map	5	q23.3	UniSTS
Cytogenetic Map	20	q13	UniSTS
Cytogenetic Map	17	q25.2	UniSTS
Cytogenetic Map	7	q36.1	UniSTS
Cytogenetic Map	10	p12.33	UniSTS
Cytogenetic Map	17	q21.32	UniSTS
Cytogenetic Map	X	p11.22	UniSTS
Cytogenetic Map	12	p13.3	UniSTS
Cytogenetic Map	X	q25-q26	UniSTS
Cytogenetic Map	2	q36.1	UniSTS
Cytogenetic Map	5	p13	UniSTS
Cytogenetic Map	15	q25	UniSTS
Cytogenetic Map	5	q12.1	UniSTS
Cytogenetic Map	5	p12	UniSTS
Cytogenetic Map	1	p36.22	UniSTS
Cytogenetic Map	3	q26.31	UniSTS
Cytogenetic Map	17	q22-q23	UniSTS
Cytogenetic Map	X	p22.33	UniSTS
Cytogenetic Map	Y	p11.3	UniSTS
Cytogenetic Map	17	p11.2	UniSTS
Cytogenetic Map	X	q13.2	UniSTS
Cytogenetic Map	12	q23.1	UniSTS
Cytogenetic Map	16	q12.2	UniSTS
Cytogenetic Map	3	q26.32	UniSTS
Cytogenetic Map	6	q22.31	UniSTS
Cytogenetic Map	3	q26.2-q27	UniSTS
Cytogenetic Map	1	q25.1-q25.2	UniSTS
Cytogenetic Map	14	q24	UniSTS
Cytogenetic Map	9	q21.13	UniSTS
Cytogenetic Map	10	q11.22	UniSTS
Cytogenetic Map	22	q13.31	UniSTS
Cytogenetic Map	3	p25.1	UniSTS
Cytogenetic Map	5	q21.3	UniSTS
Cytogenetic Map	5	p13.3	UniSTS
Cytogenetic Map	10	q22.1	UniSTS
Cytogenetic Map	14	q12-q13	UniSTS
Cytogenetic Map	X	p22	UniSTS
Cytogenetic Map	X	q23	UniSTS
Cytogenetic Map	20	p12.3-p11.21	UniSTS
Cytogenetic Map	2	p21	UniSTS
Cytogenetic Map	17	q11.2-q12	UniSTS
Cytogenetic Map	4	q32-q34	UniSTS
Cytogenetic Map	X	q25-q26.1	UniSTS
Cytogenetic Map	2	p25-p24	UniSTS
Cytogenetic Map	2	p25	UniSTS
Cytogenetic Map	11	q13.2	UniSTS
Cytogenetic Map	X	p22.2-p22.1	UniSTS
Cytogenetic Map	X	q22.1	UniSTS
Cytogenetic Map	4	q25	UniSTS
Cytogenetic Map	3	p24.2	UniSTS
Cytogenetic Map	22	q13	UniSTS
Cytogenetic Map	20	q11.22-q12	UniSTS
Cytogenetic Map	4	q34.2	UniSTS
Cytogenetic Map	20	p13	UniSTS
Cytogenetic Map	22	q13.1-q13.2	UniSTS
Cytogenetic Map	X	q28	UniSTS
Cytogenetic Map	12	q13-q14	UniSTS
Cytogenetic Map	6	q14.1	UniSTS
Cytogenetic Map	12	q13.3	UniSTS
Cytogenetic Map	9	q31.2	UniSTS
Cytogenetic Map	11	q13.1-q13.2	UniSTS
Cytogenetic Map	12	q13	UniSTS
Cytogenetic Map	1	p32-p31	UniSTS
Cytogenetic Map	21	q21.2	UniSTS
Cytogenetic Map	10	q24.3	UniSTS
Cytogenetic Map	16	q21	UniSTS
Cytogenetic Map	8	q21.1	UniSTS
Cytogenetic Map	5	p13.2	UniSTS
Cytogenetic Map	1	p34	UniSTS
Cytogenetic Map	1	q32.2	UniSTS
Cytogenetic Map	4	q21.3	UniSTS
Cytogenetic Map	7	q21-q22	UniSTS
Cytogenetic Map	3	q26.2	UniSTS
Cytogenetic Map	2	q36.3	UniSTS
Cytogenetic Map	8	p22	UniSTS
Cytogenetic Map	11	q22.1	UniSTS
Cytogenetic Map	3	q25.33	UniSTS
Cytogenetic Map	10	q23.31	UniSTS
Cytogenetic Map	4	p15.32	UniSTS
Cytogenetic Map	18	q12.2	UniSTS
Cytogenetic Map	15	q15.2	UniSTS
Cytogenetic Map	5	q12.3	UniSTS
Cytogenetic Map	14	q24.1	UniSTS
Cytogenetic Map	12	q14.1	UniSTS
Cytogenetic Map	6	p22.3-p22.1	UniSTS
Cytogenetic Map	7	p11.2	UniSTS
Cytogenetic Map	6	q15	UniSTS
Cytogenetic Map	6	q23.3	UniSTS
Cytogenetic Map	13	q14	UniSTS
Cytogenetic Map	5	q35.2	UniSTS
Cytogenetic Map	10	q22.3	UniSTS
Cytogenetic Map	1	p35	UniSTS
Cytogenetic Map	3	q12.3	UniSTS
Cytogenetic Map	19	q13.31	UniSTS
Cytogenetic Map	8	q23.1	UniSTS
Cytogenetic Map	6	q27	UniSTS
Cytogenetic Map	2	q14.3	UniSTS
Cytogenetic Map	X	p11	UniSTS
Cytogenetic Map	11	p15.3	UniSTS
Cytogenetic Map	20	p12	UniSTS
Cytogenetic Map	15	q13.1	UniSTS
Cytogenetic Map	X	p22.3	UniSTS
Cytogenetic Map	11	q13.5	UniSTS
Cytogenetic Map	19	p13.3-p13.2	UniSTS
Cytogenetic Map	1	p36.11-p34.2	UniSTS
Cytogenetic Map	4	q22.1-q23	UniSTS
Cytogenetic Map	7	q22.3	UniSTS
Cytogenetic Map	9	p22	UniSTS
Cytogenetic Map	17	q23.3	UniSTS
Cytogenetic Map	16	q23.2	UniSTS
Cytogenetic Map	2	p16.1	UniSTS
Cytogenetic Map	3	q27.1	UniSTS
Cytogenetic Map	2	p22.3	UniSTS
Cytogenetic Map	X	q26.1	UniSTS
Cytogenetic Map	4	q21.21	UniSTS
Cytogenetic Map	22	q13.3	UniSTS
Cytogenetic Map	2	q32.1	UniSTS
Cytogenetic Map	Y	p11.32	UniSTS
Cytogenetic Map	11	p14	UniSTS
Cytogenetic Map	1	p32.1	UniSTS
Cytogenetic Map	2	p25.3	UniSTS
Cytogenetic Map	4	q34.3	UniSTS
Cytogenetic Map	9	p12	UniSTS
Cytogenetic Map	3	q13.13	UniSTS
Cytogenetic Map	13	q34	UniSTS
Cytogenetic Map	3	p21	UniSTS
Cytogenetic Map	11	q23.2	UniSTS
Cytogenetic Map	20	p11.23	UniSTS
Cytogenetic Map	3	p13	UniSTS
Cytogenetic Map	4	p13	UniSTS
Cytogenetic Map	16	q23.1	UniSTS
Cytogenetic Map	10	p11.23	UniSTS
Cytogenetic Map	8	p21.1	UniSTS
Cytogenetic Map	15	q22-q24	UniSTS
Cytogenetic Map	8	q23	UniSTS
Cytogenetic Map	16	q12.1	UniSTS
Cytogenetic Map	14	q13.2	UniSTS
Cytogenetic Map	18	q12.1	UniSTS
Cytogenetic Map	5	q31.3	UniSTS
Cytogenetic Map	11	q14	UniSTS
Cytogenetic Map	13	q33.1	UniSTS
Cytogenetic Map	14	q21.2	UniSTS
Cytogenetic Map	4	q31.3	UniSTS
Cytogenetic Map	15	q21-q22	UniSTS
Cytogenetic Map	3	p14.3	UniSTS
Cytogenetic Map	17	p13.1	UniSTS
Cytogenetic Map	13	q12.11	UniSTS
Cytogenetic Map	6	p21.2	UniSTS
Cytogenetic Map	15	q21.3	UniSTS
Cytogenetic Map	3	q21.1	UniSTS
Cytogenetic Map	6	p21.31	UniSTS
Cytogenetic Map	10	p15.1	UniSTS
Cytogenetic Map	1	q24.2	UniSTS
Cytogenetic Map	12	p12	UniSTS
Cytogenetic Map	7	p22.1	UniSTS
Cytogenetic Map	11	q24	UniSTS
Cytogenetic Map	21	q22.13	UniSTS
Cytogenetic Map	15	q22.1-q22.31	UniSTS
Cytogenetic Map	15	q22	UniSTS
Cytogenetic Map	X	q13	UniSTS
Cytogenetic Map	1	q31-q41	UniSTS
Cytogenetic Map	6	p25	UniSTS
Cytogenetic Map	14	q32.1	UniSTS
Cytogenetic Map	16	q12-q13	UniSTS
Cytogenetic Map	X	q12-q13	UniSTS
Cytogenetic Map	14	q23	UniSTS
Cytogenetic Map	12	q11-q12	UniSTS
Cytogenetic Map	1	q42.1-q43	UniSTS
Cytogenetic Map	3	q13.33	UniSTS
Cytogenetic Map	7	q31	UniSTS
Cytogenetic Map	12	q24	UniSTS
Cytogenetic Map	X	p22.11	UniSTS
Cytogenetic Map	11	q13.4	UniSTS
Cytogenetic Map	2	p25.1-p24.1	UniSTS
Cytogenetic Map	8	q24.21	UniSTS
Cytogenetic Map	12	q13.1	UniSTS
Cytogenetic Map	12	q22-q23.1	UniSTS
Cytogenetic Map	11	q12.2	UniSTS
Cytogenetic Map	1	p13.2	UniSTS
Cytogenetic Map	5	q31.2-q34	UniSTS
Cytogenetic Map	11	p15.1	UniSTS
Cytogenetic Map	6	q24.2	UniSTS
Cytogenetic Map	22	q	UniSTS
Cytogenetic Map	12	q13.11-q14.3	UniSTS
Cytogenetic Map	7	p11	UniSTS
Cytogenetic Map	X	p22.12-p22.11	UniSTS
Cytogenetic Map	7	q11.21	UniSTS
Cytogenetic Map	20	q11.22-q11.23	UniSTS
Cytogenetic Map	8	q24.22	UniSTS
Cytogenetic Map	8	p22-p21.3	UniSTS
Cytogenetic Map	10	q24	UniSTS
Cytogenetic Map	1	q21.2-q21.3	UniSTS
Cytogenetic Map	1	p36.12	UniSTS
Cytogenetic Map	9	p24.1	UniSTS
Cytogenetic Map	6	q25.2-q27	UniSTS
Cytogenetic Map	9	q34	UniSTS
Cytogenetic Map	5	p13.1	UniSTS
Cytogenetic Map	8	q11.2	UniSTS
Cytogenetic Map	3	q28-q29	UniSTS
Cytogenetic Map	7	p14-p13	UniSTS
Cytogenetic Map	12	q24.2	UniSTS
Cytogenetic Map	6	p22.2	UniSTS
Cytogenetic Map	7	q22-qter	UniSTS
Cytogenetic Map	12	q24.2-q24.31	UniSTS
Cytogenetic Map	X	q13.1	UniSTS
Cytogenetic Map	6	p25.2	UniSTS
Cytogenetic Map	1	p21	UniSTS
Cytogenetic Map	1	q32.2-q41	UniSTS
Cytogenetic Map	11	q22-q23	UniSTS
Cytogenetic Map	3	q26.33	UniSTS
Cytogenetic Map	12	q23-q24.1	UniSTS
Cytogenetic Map	5	p15.1-p14.3	UniSTS
Cytogenetic Map	16	p13.11	UniSTS
Cytogenetic Map	6	q22-q23	UniSTS
Cytogenetic Map	9	p21	UniSTS
Cytogenetic Map	6	p12.3	UniSTS
Cytogenetic Map	3	p12.1	UniSTS
Cytogenetic Map	9	q21.11	UniSTS
Cytogenetic Map	17	q24.1	UniSTS
Cytogenetic Map	10	q11.21	UniSTS
Cytogenetic Map	14	q21	UniSTS
Cytogenetic Map	11	p15	UniSTS
Cytogenetic Map	16	q22	UniSTS
Cytogenetic Map	15	q11-q13	UniSTS
Cytogenetic Map	13	q12-q14	UniSTS
Cytogenetic Map	18	q21.1	UniSTS
Cytogenetic Map	2	q24	UniSTS
Cytogenetic Map	12	p13	UniSTS
Cytogenetic Map	3	q28	UniSTS
Cytogenetic Map	7	q32.1	UniSTS
Cytogenetic Map	X	q22.2	UniSTS
Cytogenetic Map	7	p12.3	UniSTS
Cytogenetic Map	7	p15.1	UniSTS
Cytogenetic Map	2	q37.2	UniSTS
Cytogenetic Map	18	q22.3	UniSTS
Cytogenetic Map	14	q32.13	UniSTS
Cytogenetic Map	14	q22.1	UniSTS
Cytogenetic Map	16	p13.1	UniSTS
Cytogenetic Map	7	q31.3	UniSTS
Cytogenetic Map	20	q13.2-q13.3	UniSTS
Cytogenetic Map	1	p21.2	UniSTS
Cytogenetic Map	9	q21.33	UniSTS
Cytogenetic Map	14	q32.2	UniSTS
Cytogenetic Map	13	q13.3	UniSTS
Cytogenetic Map	10	p12.31	UniSTS
Cytogenetic Map	22	q11.1	UniSTS
Cytogenetic Map	5	q33.2	UniSTS
Cytogenetic Map	13	q32.2	UniSTS
Cytogenetic Map	14	q23.1	UniSTS
Cytogenetic Map	8	q21.2	UniSTS
Cytogenetic Map	2	q24.1	UniSTS
Cytogenetic Map	10	q26.13	UniSTS
Cytogenetic Map	2	q23.3	UniSTS
Cytogenetic Map	19	p13.1	UniSTS
Cytogenetic Map	15	q14-q15	UniSTS
Cytogenetic Map	1	q42.13	UniSTS
Cytogenetic Map	14	q31	UniSTS
Cytogenetic Map	7	p21.1	UniSTS
Cytogenetic Map	8	p12-p11	UniSTS
Cytogenetic Map	18	p11.2	UniSTS
Cytogenetic Map	7	p11.1	UniSTS
Cytogenetic Map	1	q31-q32	UniSTS
Cytogenetic Map	2	q12	UniSTS
Cytogenetic Map	3	p21.32	UniSTS
Cytogenetic Map	2	p24.2	UniSTS
Cytogenetic Map	2	q33-q34	UniSTS
Cytogenetic Map	6	q24.1	UniSTS
Cytogenetic Map	4	q22.1	UniSTS
Cytogenetic Map	15	q13.3	UniSTS
Cytogenetic Map	10	q26.11	UniSTS
Cytogenetic Map	7	p15.3	UniSTS
Cytogenetic Map	10	q23.33	UniSTS
Cytogenetic Map	12	p12.1	UniSTS
Cytogenetic Map	7	p13-p12	UniSTS
Cytogenetic Map	X	q25	UniSTS
Cytogenetic Map	17	q11-q21	UniSTS
Cytogenetic Map	12	q23	UniSTS
Cytogenetic Map	6	p24-p22.3	UniSTS
Cytogenetic Map	14	q23.2	UniSTS
Cytogenetic Map	7	q31.1-q31.2	UniSTS
Cytogenetic Map	8	q22.2	UniSTS
Cytogenetic Map	15	q21.2	UniSTS
Cytogenetic Map	3	p26.1-p25.1	UniSTS
Cytogenetic Map	5	q35	UniSTS
Cytogenetic Map	3	q13.2	UniSTS
Cytogenetic Map	4	p15.2	UniSTS
Cytogenetic Map	6	q16.3	UniSTS
Cytogenetic Map	17	q24-q25	UniSTS
Cytogenetic Map	X	q12	UniSTS
Cytogenetic Map	X	q27.1	UniSTS
Cytogenetic Map	8	q12.3	UniSTS
Cytogenetic Map	5	q21.2	UniSTS
Cytogenetic Map	5	q15	UniSTS
Cytogenetic Map	5	q35.1	UniSTS
Cytogenetic Map	4	q13.3	UniSTS
Cytogenetic Map	4	q35.2	UniSTS
Cytogenetic Map	3	p26.1	UniSTS
Cytogenetic Map	3	p11.1	UniSTS
Cytogenetic Map	17	q21.2	UniSTS
Cytogenetic Map	2	q21.2	UniSTS
Cytogenetic Map	19	p13.13	UniSTS
Cytogenetic Map	18	q12.3	UniSTS
Cytogenetic Map	18	p11.3	UniSTS
Cytogenetic Map	17	q11.1	UniSTS
Cytogenetic Map	15	q25.1	UniSTS
Cytogenetic Map	13	q12.3	UniSTS
Cytogenetic Map	12	q23.2	UniSTS
Cytogenetic Map	12	q12-q13	UniSTS
Cytogenetic Map	12	q14	UniSTS
Cytogenetic Map	5	q33.1	UniSTS
Cytogenetic Map	2	q32-q34	UniSTS
Cytogenetic Map	16	q22.3	UniSTS
Cytogenetic Map	2	p15-p13	UniSTS
Cytogenetic Map	X	p11.4	UniSTS
Cytogenetic Map	19	q13.33-q13.41	UniSTS
Cytogenetic Map	20	p11	UniSTS
Cytogenetic Map	6	q23-q24	UniSTS
Cytogenetic Map	2	p12	UniSTS
Cytogenetic Map	2	p13	UniSTS
Cytogenetic Map	13	q11-q12	UniSTS
Cytogenetic Map	6	p12.3-p11.2	UniSTS
Cytogenetic Map	6	q16.1-q16.3	UniSTS
Cytogenetic Map	22	q11	UniSTS
Cytogenetic Map	7	q31.2	UniSTS
Cytogenetic Map	10	q21.3	UniSTS
Cytogenetic Map	3	q25.2	UniSTS
Cytogenetic Map	3	p21.1-p14.3	UniSTS
Cytogenetic Map	6	p12.1	UniSTS
Cytogenetic Map	3	q23-q24	UniSTS
Cytogenetic Map	3	q12	UniSTS
Cytogenetic Map	7	q11.1	UniSTS
Cytogenetic Map	3	q22.3	UniSTS
Cytogenetic Map	7	q21.3	UniSTS
Cytogenetic Map	4	q31.1	UniSTS
Cytogenetic Map	22	q12-q13	UniSTS
Cytogenetic Map	4	q23	UniSTS
Cytogenetic Map	X	p22.12	UniSTS
Cytogenetic Map	6	q16.1	UniSTS
Cytogenetic Map	13	q14.13	UniSTS
Cytogenetic Map	18	q21.3	UniSTS
Cytogenetic Map	9	q33.2	UniSTS
Cytogenetic Map	11	q21	UniSTS
Cytogenetic Map	8	q12	UniSTS
Cytogenetic Map	4	q28-q32	UniSTS
Cytogenetic Map	17	q24.3	UniSTS
Cytogenetic Map	6	p23	UniSTS
Cytogenetic Map	8	p11	UniSTS
Cytogenetic Map	5	q34	UniSTS
Cytogenetic Map	1	q24.3	UniSTS
Cytogenetic Map	9	q33.1	UniSTS
Cytogenetic Map	1	q23.3	UniSTS
Cytogenetic Map	2	p16.2	UniSTS
Cytogenetic Map	9	q22.31	UniSTS
Cytogenetic Map	9	p24.3	UniSTS
Cytogenetic Map	7	q35	UniSTS
Cytogenetic Map	1	p36.2	UniSTS
Cytogenetic Map	11	q22.3	UniSTS
Cytogenetic Map	16	p12	UniSTS
Cytogenetic Map	1	q22-q23	UniSTS
Cytogenetic Map	13	q22.1	UniSTS
Cytogenetic Map	2	q12.2	UniSTS
Cytogenetic Map	8	p12	UniSTS
Cytogenetic Map	4	q21	UniSTS
Cytogenetic Map	13	q12.2	UniSTS
Cytogenetic Map	9	q31-q33	UniSTS
Cytogenetic Map	6	p24.1	UniSTS
Cytogenetic Map	1	q23	UniSTS
Cytogenetic Map	11	q12-q13	UniSTS
Cytogenetic Map	11	q13.3	UniSTS
Cytogenetic Map	11	q24.2	UniSTS
Cytogenetic Map	11	q12.1	UniSTS
Cytogenetic Map	3	p26	UniSTS
Cytogenetic Map	5	q13	UniSTS
Cytogenetic Map	8	p21	UniSTS
Cytogenetic Map	19	q13.1-q13.2	UniSTS
Cytogenetic Map	1	p33-p32	UniSTS
Cytogenetic Map	7	q36.2	UniSTS
Cytogenetic Map	4	q32.3	UniSTS
Cytogenetic Map	16	p13.2	UniSTS
Cytogenetic Map	14	q32	UniSTS
Cytogenetic Map	10	q11.23	UniSTS
Cytogenetic Map	10	q26.1	UniSTS
Cytogenetic Map	9	q32-q33.3	UniSTS
Cytogenetic Map	9	q22.1-q22.2	UniSTS
Cytogenetic Map	3	q26.1-q26.2	UniSTS
Cytogenetic Map	5	q31-q34	UniSTS
Cytogenetic Map	9	q33-q34	UniSTS
Cytogenetic Map	5	q11.2-q13.2	UniSTS
Cytogenetic Map	13	q32	UniSTS
Cytogenetic Map	9	q22.32	UniSTS
Cytogenetic Map	1	p36.3	UniSTS
Cytogenetic Map	1	p36.3-p36.2	UniSTS
Cytogenetic Map	4	q28.1	UniSTS
Cytogenetic Map	5	q22	UniSTS
Cytogenetic Map	12	p11.21	UniSTS
Cytogenetic Map	X	q13.3	UniSTS
Cytogenetic Map	9	q31.3	UniSTS
Cytogenetic Map	3	p26.3	UniSTS
Cytogenetic Map	2	q11.1	UniSTS
Cytogenetic Map	21	q11.2	UniSTS
Cytogenetic Map	18	q21.32	UniSTS
Cytogenetic Map	15	q26.2	UniSTS
Cytogenetic Map	12	q24.23	UniSTS
Cytogenetic Map	10	q25.3	UniSTS
Cytogenetic Map	20	q11.23	UniSTS
Cytogenetic Map	20	p12.1	UniSTS
Cytogenetic Map	2	q31.1-q31.2	UniSTS
Cytogenetic Map	X	p22.31	UniSTS
Cytogenetic Map	X	p21.3	UniSTS
Cytogenetic Map	5	q33.3	UniSTS
Cytogenetic Map	4	q28.2	UniSTS
Cytogenetic Map	3	p14.2	UniSTS
Cytogenetic Map	3	q24	UniSTS
Cytogenetic Map	2	q13	UniSTS
Cytogenetic Map	20	q13.2	UniSTS
Cytogenetic Map	14	q11.2-q12	UniSTS
Cytogenetic Map	3	p24	UniSTS
Cytogenetic Map	12	q23.3	UniSTS
Cytogenetic Map	11	q24.3	UniSTS
Cytogenetic Map	11	q14.3	UniSTS
Cytogenetic Map	10	q25.2	UniSTS
Cytogenetic Map	3	q25.1	UniSTS
Cytogenetic Map	8	q13	UniSTS
Cytogenetic Map	1	p22.2	UniSTS
Cytogenetic Map	3	p22.3	UniSTS
Cytogenetic Map	18	q11.1	UniSTS
Cytogenetic Map	8	q23.3	UniSTS
Cytogenetic Map	15	q24	UniSTS
Cytogenetic Map	11	cen-q12	UniSTS
Cytogenetic Map	11	q25	UniSTS
Cytogenetic Map	3	p22.2	UniSTS
Cytogenetic Map	X	p21.1	UniSTS
Cytogenetic Map	7	q36	UniSTS
Cytogenetic Map	7	p14.3	UniSTS
Cytogenetic Map	12	q21	UniSTS
Cytogenetic Map	7	p15	UniSTS
Cytogenetic Map	7	q22-q31	UniSTS
Cytogenetic Map	11	q22	UniSTS
Cytogenetic Map	5	p15.3	UniSTS
Cytogenetic Map	20	q13.3-qter	UniSTS
Cytogenetic Map	1	p35-p34	UniSTS
Cytogenetic Map	4	p13-p12	UniSTS
Cytogenetic Map	10	q21-q22	UniSTS
Cytogenetic Map	4	q22	UniSTS
Cytogenetic Map	7	p13-p11.1	UniSTS
Cytogenetic Map	9	q31-q34	UniSTS
Cytogenetic Map	7	q21.1-q22	UniSTS
Cytogenetic Map	15	q26.1	UniSTS
Cytogenetic Map	3	q13.13-q13.2	UniSTS
Cytogenetic Map	X	p22.13	UniSTS
Cytogenetic Map	13	q12.12	UniSTS
Cytogenetic Map	13	q14.2	UniSTS
Cytogenetic Map	12	q	UniSTS
Cytogenetic Map	1	p	UniSTS
Cytogenetic Map	16	p	UniSTS
Cytogenetic Map	15	q	UniSTS
Cytogenetic Map	7	q	UniSTS
Cytogenetic Map	2	q	UniSTS
Cytogenetic Map	5	q13.1	UniSTS
Cytogenetic Map	11	p14.1	UniSTS
Cytogenetic Map	4	q32	UniSTS
Cytogenetic Map	2	p22	UniSTS
Cytogenetic Map	5	q14.3	UniSTS
Cytogenetic Map	10	p12.1	UniSTS
Cytogenetic Map	5	q23.2	UniSTS
Cytogenetic Map	2	p24.1	UniSTS
Cytogenetic Map	8	q24.13	UniSTS
Cytogenetic Map	12	p13.32	UniSTS
Cytogenetic Map	9	p21.1	UniSTS
Cytogenetic Map	9	q34.2-q34.3	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

adipose tissue	alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	entire extraembryonic component	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	pharyngeal arch	renal system	reproductive system	respiratory system	sensory system	visual system
1204	2418	2659	2106	4683	1691	2310	6	593	1593	434	2268	6641	5953	52	3449	1	848	1743	1607	173	1

Sequence

Nucleotide Sequences


RefSeq Transcripts	NG_023058	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001178044	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001178045	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_025257	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF134726	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AI560195	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AI956094	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK027397	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK222998	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK223013	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK300550	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK301596	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK314673	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AL662834	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AL671762	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AL833009	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AL844853	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY358457	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BA000025	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC014659	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BX005460	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH471081	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CP068272	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CR388202	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CR759784	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CR936237	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DA924720	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DC300771	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DC392935	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	HM005361	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	KU175229	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	KY500651	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	KY500652	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	KY500653	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	KY500654	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	KY500655	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	KY500656	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	KY500657	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENST00000229729 ⟹ ENSP00000229729

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	6	31,863,192 - 31,878,997 (-)	Ensembl

Ensembl Acc Id:

ENST00000375562 ⟹ ENSP00000364712

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	6	31,863,195 - 31,879,046 (-)	Ensembl

Ensembl Acc Id:

ENST00000414427 ⟹ ENSP00000398901

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	6	31,865,690 - 31,878,967 (-)	Ensembl

Ensembl Acc Id:

ENST00000462671

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	6	31,874,822 - 31,878,997 (-)	Ensembl

Ensembl Acc Id:

ENST00000465707

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	6	31,874,525 - 31,878,997 (-)	Ensembl

Ensembl Acc Id:

ENST00000475563

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	6	31,869,596 - 31,871,244 (-)	Ensembl

Ensembl Acc Id:

ENST00000479777

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	6	31,866,059 - 31,871,202 (-)	Ensembl

Ensembl Acc Id:

ENST00000487680

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	6	31,863,577 - 31,864,680 (-)	Ensembl

Ensembl Acc Id:

ENST00000544672 ⟹ ENSP00000444109

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	6	31,863,195 - 31,877,671 (-)	Ensembl

Ensembl Acc Id:

ENST00000644409 ⟹ ENSP00000496109

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	6	31,863,454 - 31,877,671 (-)	Ensembl

RefSeq Acc Id:

NM_001178044 ⟹ NP_001171515

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	6	31,863,192 - 31,878,997 (-)	NCBI
GRCh37	6	31,830,969 - 31,846,823 (-)	RGD
Celera	6	33,429,555 - 33,445,404 (-)	RGD
HuRef	6	31,616,782 - 31,632,627 (-)	RGD
CHM1_1	6	31,833,110 - 31,848,964 (-)	NCBI
T2T-CHM13v2.0	6	31,716,432 - 31,732,232 (-)	NCBI

Sequence:

show sequence

ACTCCGGAGACTGAGCCATGGGGGGAAAGCAGCGGGACGAGGATGACGAGGCCTACGGGAAGCC
AGTCAAATACGACCCCTCCTTTCGAGGCCCCATCAAGAACAGAAGCTGCACAGATGTCATCTGC
TGCGTCCTCTTCCTGCTCTTCATTCTAGGTTACATCGTGGTGGGGATTGTGGCCTGGTTGTATG
GAGACCCCCGGCAAGTCCTCTACCCCAGGAACTCTACTGGGGCCTACTGTGGCATGGGGGAGAA
CAAAGATAAGCCGTATCTCCTGTACTTCAACATCTTCAGCTGCATCCTGTCCAGCAACATCATC
TCAGTTGCTGAGAACGGCCTACAGTGCCCCACACCCCAGACGGTGATCACAAGCCTGCAACAGG
AACTCTGCCCCAGTTTCCTCCTCCCCTCTGCTCCAGCTCTGGGGCGCTGCTTTCCATGGACCAA
CGTTACTCCACCGGCGCTCCCAGGGATCACCAATGACACCACCATACAGCAGGGGATCAGCGGT
CTTATTGACAGCCTCAATGCCCGAGACATCAGTGTTAAGATCTTTGAAGATTTTGCCCAGTCCT
GGTATTGGATTCTTGTTGCCCTGGGGGTGGCTCTGGTCTTGAGCCTACTGTTTATCTTGCTTCT
GCGCCTGGTGGCTGGGCCCCTGGTGCTGGTGCTGATCCTGGGAGTGCTGGGCGTGCTGGCATAC
GGCATCTACTACTGCTGGGAGGAGTACCGAGTGCTGCGGGACAAGGGCGCCTCCATCTCCCAGC
TGGGTTTCACCACCAACCTCAGTGCCTACCAGAGCGTGCAGGAGACCTGGCTGGCCGCCCTGAT
CGTGTTGGCGGTGCTTGAAGCCATCCTGCTGCTGATGCTCATCTTCCTGCGGCAGCGGATTCGT
ATTGCCATCGCCCTCCTGAAGGAGGCCAGCAAGGCTGTGGGACAGATGATGTCTACCATGTTCT
ACCCACTGGTCACCTTTGTCCTCCTCCTCATCTGCATTGCCTACTGGGCCATGACTGCTCTGTA
CCTGGCTACATCGGGGCAACCCCAGTATGTGCTCTGGGCATCCAACATCAGCTCCCCCGGCTGT
GAGAAAGTGCCAATAAATACATCATGCAACCCCACGGCCCACCTTGTGAACTCCTCGTGCCCAG
GGCTGATGTGCGTCTTCCAGGGCTACTCATCCAAAGGCCTAATCCAACGTTCTGTCTTCAATCT
GCAAATCTATGGGGTCCTGGGGCTCTTCTGGACCCTTAACTGGGTACTGGCCCTGGGCCAATGC
GTCCTCGCTGGAGCCTTTGCCTCCTTCTACTGGGCCTTCCACAAGCCCCAGGACATCCCTACCT
TCCCCTTAATCTCTGCCTTCATCCGCACACTCCGTTACCACACTGGGTCATTGGCATTTGGAGC
CCTCATCCTGACCCTTGTGCAGATAGCCCGGGTCATCTTGGAGTATATTGACCACAAGCTCAGA
GGAGTGCAGAACCCTGTAGCCCGCTGCATCATGTGCTGTTTCAAGTGCTGCCTCTGGTGTCTGG
AAAAATTTATCAAGTTCCTAAACCGCAATGCATACATCATGATCGCCATCTACGGGAAGAATTT
CTGTGTCTCAGCCAAAAATGCGTTCATGCTACTCATGCGAAACATTGTCAGGGTGGTCGTCCTG
GACAAAGTCACAGACCTGCTGCTGTTCTTTGGGAAGCTGCTGGTGGTCGGAGGCGTGGGGGTCC
TGTCCTTCTTTTTTTTCTCCGGTCGCATCCCGGGGCTGGGTAAAGACTTTAAGAGCCCCCACCT
CAACTATTACTGGCTGCCCATCATGACCTCCATCCTGGGGGCCTATGTCATCGCCAGCGGCTTC
TTCAGCGTTTTCGGCATGTGTGTGGACACGCTCTTCCTCTGCTTCCTGGAAGACCTGGAGCGGA
ACAACGGCTCCCTGGACCGGCCCTACTACATGTCCAAGAGCCTTCTAAAGATTCTGGGCAAGAA
GAACGAGGCGCCCCCGGACAACAAGAAGAGGAAGAAGTGACAGCTCCGGCCCTGATCCAGGACT
GCACCCCACCCCCACCGTCCAGCCATCCAACCTCACTTCGCCTTACAGGTCTCCATTTTGTGGT
AAAAAAAGGTTTTAGGCCAGGCGCCGTGGCTCACGCCTGTAATCCAACACTTTGAGAGGCTGAG
GCGGGCGGATCACCTGAGTCAGGAGTTCGAGACCAGCCTGGCCAACATGGTGAAACCTCCGTCT
CTATTAAAAATACAAAAATTAGCCGAGAGTGGTGGCATGCACCTGTCATCCCAGCTACTCGGGA
GGCTGAGGCAGGAGAATCGCTTGAACCCGGGAGGCAGAGGTTGCAGTGAGCCGAGATCGCGCCA
CTGCACTCCAACCTGGGTGACAGACTCTGTCTCCAAAACAAAACAAACAAACAAAAAGATTTTA
TTAAAGATATTTTGTTAACTCAGTAAA

hide sequence

RefSeq Acc Id:

NM_001178045 ⟹ NP_001171516

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	6	31,863,192 - 31,877,671 (-)	NCBI
GRCh37	6	31,830,969 - 31,846,823 (-)	RGD
Celera	6	33,429,555 - 33,445,404 (-)	RGD
HuRef	6	31,616,782 - 31,632,627 (-)	RGD
CHM1_1	6	31,833,110 - 31,847,589 (-)	NCBI
T2T-CHM13v2.0	6	31,716,432 - 31,730,906 (-)	NCBI

Sequence:

show sequence

ACTGAGGTCCCACCAGAGTGAGGATGTACAGGGCCGCTTCCCTCCCCAGGCCCTGCTGGGGTTG
ACACCTTTGTCTCCAGTTTCTTTCCCCATAGCCTTGAACCAGAGGGGAAGCCAGTCAAATACGA
CCCCTCCTTTCGAGGCCCCATCAAGAACAGAAGCTGCACAGATGTCATCTGCTGCGTCCTCTTC
CTGCTCTTCATTCTAGGTTACATCGTGGTGGGGATTGTGGCCTGGTTGTATGGAGACCCCCGGC
AAGTCCTCTACCCCAGGAACTCTACTGGGGCCTACTGTGGCATGGGGGAGAACAAAGATAAGCC
GTATCTCCTGTACTTCAACATCTTCAGCTGCATCCTGTCCAGCAACATCATCTCAGTTGCTGAG
AACGGCCTACAGTGCCCCACACCCCAGGTGTGTGTGTCCTCCTGCCCGGAGGACCCATGGACTG
TGGGAAAAAACGAGTTCTCACAGACTGTTGGGGAAGTCTTCTATACAAAAAACAGGAACTTTTG
TCTGCCAGGGGTACCCTGGAATATGACGGTGATCACAAGCCTGCAACAGGAACTCTGCCCCAGT
TTCCTCCTCCCCTCTGCTCCAGCTCTGGGGCGCTGCTTTCCATGGACCAACGTTACTCCACCGG
CGCTCCCAGGGATCACCAATGACACCACCATACAGCAGGGGATCAGCGGTCTTATTGACAGCCT
CAATGCCCGAGACATCAGTGTTAAGATCTTTGAAGATTTTGCCCAGTCCTGGTATTGGATTCTT
GTTGCCCTGGGGGTGGCTCTGGTCTTGAGCCTACTGTTTATCTTGCTTCTGCGCCTGGTGGCTG
GGCCCCTGGTGCTGGTGCTGATCCTGGGAGTGCTGGGCGTGCTGGCATACGGCATCTACTACTG
CTGGGAGGAGTACCGAGTGCTGCGGGACAAGGGCGCCTCCATCTCCCAGCTGGGTTTCACCACC
AACCTCAGTGCCTACCAGAGCGTGCAGGAGACCTGGCTGGCCGCCCTGATCGTGTTGGCGGTGC
TTGAAGCCATCCTGCTGCTGATGCTCATCTTCCTGCGGCAGCGGATTCGTATTGCCATCGCCCT
CCTGAAGGAGGCCAGCAAGGCTGTGGGACAGATGATGTCTACCATGTTCTACCCACTGGTCACC
TTTGTCCTCCTCCTCATCTGCATTGCCTACTGGGCCATGACTGCTCTGTACCTGGCTACATCGG
GGCAACCCCAGTATGTGCTCTGGGCATCCAACATCAGCTCCCCCGGCTGTGAGAAAGTGCCAAT
AAATACATCATGCAACCCCACGGCCCACCTTGTGAACTCCTCGTGCCCAGGGCTGATGTGCGTC
TTCCAGGGCTACTCATCCAAAGGCCTAATCCAACGTTCTGTCTTCAATCTGCAAATCTATGGGG
TCCTGGGGCTCTTCTGGACCCTTAACTGGGTACTGGCCCTGGGCCAATGCGTCCTCGCTGGAGC
CTTTGCCTCCTTCTACTGGGCCTTCCACAAGCCCCAGGACATCCCTACCTTCCCCTTAATCTCT
GCCTTCATCCGCACACTCCGTTACCACACTGGGTCATTGGCATTTGGAGCCCTCATCCTGACCC
TTGTGCAGATAGCCCGGGTCATCTTGGAGTATATTGACCACAAGCTCAGAGGAGTGCAGAACCC
TGTAGCCCGCTGCATCATGTGCTGTTTCAAGTGCTGCCTCTGGTGTCTGGAAAAATTTATCAAG
TTCCTAAACCGCAATGCATACATCATGATCGCCATCTACGGGAAGAATTTCTGTGTCTCAGCCA
AAAATGCGTTCATGCTACTCATGCGAAACATTGTCAGGGTGGTCGTCCTGGACAAAGTCACAGA
CCTGCTGCTGTTCTTTGGGAAGCTGCTGGTGGTCGGAGGCGTGGGGGTCCTGTCCTTCTTTTTT
TTCTCCGGTCGCATCCCGGGGCTGGGTAAAGACTTTAAGAGCCCCCACCTCAACTATTACTGGC
TGCCCATCATGACCTCCATCCTGGGGGCCTATGTCATCGCCAGCGGCTTCTTCAGCGTTTTCGG
CATGTGTGTGGACACGCTCTTCCTCTGCTTCCTGGAAGACCTGGAGCGGAACAACGGCTCCCTG
GACCGGCCCTACTACATGTCCAAGAGCCTTCTAAAGATTCTGGGCAAGAAGAACGAGGCGCCCC
CGGACAACAAGAAGAGGAAGAAGTGACAGCTCCGGCCCTGATCCAGGACTGCACCCCACCCCCA
CCGTCCAGCCATCCAACCTCACTTCGCCTTACAGGTCTCCATTTTGTGGTAAAAAAAGGTTTTA
GGCCAGGCGCCGTGGCTCACGCCTGTAATCCAACACTTTGAGAGGCTGAGGCGGGCGGATCACC
TGAGTCAGGAGTTCGAGACCAGCCTGGCCAACATGGTGAAACCTCCGTCTCTATTAAAAATACA
AAAATTAGCCGAGAGTGGTGGCATGCACCTGTCATCCCAGCTACTCGGGAGGCTGAGGCAGGAG
AATCGCTTGAACCCGGGAGGCAGAGGTTGCAGTGAGCCGAGATCGCGCCACTGCACTCCAACCT
GGGTGACAGACTCTGTCTCCAAAACAAAACAAACAAACAAAAAGATTTTATTAAAGATATTTTG
TTAACTCAGTAAA

hide sequence

RefSeq Acc Id:

NM_025257 ⟹ NP_079533

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	6	31,863,192 - 31,878,997 (-)	NCBI
GRCh37	6	31,830,969 - 31,846,823 (-)	RGD
Build 36	6	31,938,948 - 31,954,802 (-)	NCBI Archive
Celera	6	33,429,555 - 33,445,404 (-)	RGD
HuRef	6	31,616,782 - 31,632,627 (-)	RGD
CHM1_1	6	31,833,110 - 31,848,964 (-)	NCBI
T2T-CHM13v2.0	6	31,716,432 - 31,732,232 (-)	NCBI

Sequence:

show sequence

ACTCCGGAGACTGAGCCATGGGGGGAAAGCAGCGGGACGAGGATGACGAGGCCTACGGGAAGCC
AGTCAAATACGACCCCTCCTTTCGAGGCCCCATCAAGAACAGAAGCTGCACAGATGTCATCTGC
TGCGTCCTCTTCCTGCTCTTCATTCTAGGTTACATCGTGGTGGGGATTGTGGCCTGGTTGTATG
GAGACCCCCGGCAAGTCCTCTACCCCAGGAACTCTACTGGGGCCTACTGTGGCATGGGGGAGAA
CAAAGATAAGCCGTATCTCCTGTACTTCAACATCTTCAGCTGCATCCTGTCCAGCAACATCATC
TCAGTTGCTGAGAACGGCCTACAGTGCCCCACACCCCAGGTGTGTGTGTCCTCCTGCCCGGAGG
ACCCATGGACTGTGGGAAAAAACGAGTTCTCACAGACTGTTGGGGAAGTCTTCTATACAAAAAA
CAGGAACTTTTGTCTGCCAGGGGTACCCTGGAATATGACGGTGATCACAAGCCTGCAACAGGAA
CTCTGCCCCAGTTTCCTCCTCCCCTCTGCTCCAGCTCTGGGGCGCTGCTTTCCATGGACCAACG
TTACTCCACCGGCGCTCCCAGGGATCACCAATGACACCACCATACAGCAGGGGATCAGCGGTCT
TATTGACAGCCTCAATGCCCGAGACATCAGTGTTAAGATCTTTGAAGATTTTGCCCAGTCCTGG
TATTGGATTCTTGTTGCCCTGGGGGTGGCTCTGGTCTTGAGCCTACTGTTTATCTTGCTTCTGC
GCCTGGTGGCTGGGCCCCTGGTGCTGGTGCTGATCCTGGGAGTGCTGGGCGTGCTGGCATACGG
CATCTACTACTGCTGGGAGGAGTACCGAGTGCTGCGGGACAAGGGCGCCTCCATCTCCCAGCTG
GGTTTCACCACCAACCTCAGTGCCTACCAGAGCGTGCAGGAGACCTGGCTGGCCGCCCTGATCG
TGTTGGCGGTGCTTGAAGCCATCCTGCTGCTGATGCTCATCTTCCTGCGGCAGCGGATTCGTAT
TGCCATCGCCCTCCTGAAGGAGGCCAGCAAGGCTGTGGGACAGATGATGTCTACCATGTTCTAC
CCACTGGTCACCTTTGTCCTCCTCCTCATCTGCATTGCCTACTGGGCCATGACTGCTCTGTACC
TGGCTACATCGGGGCAACCCCAGTATGTGCTCTGGGCATCCAACATCAGCTCCCCCGGCTGTGA
GAAAGTGCCAATAAATACATCATGCAACCCCACGGCCCACCTTGTGAACTCCTCGTGCCCAGGG
CTGATGTGCGTCTTCCAGGGCTACTCATCCAAAGGCCTAATCCAACGTTCTGTCTTCAATCTGC
AAATCTATGGGGTCCTGGGGCTCTTCTGGACCCTTAACTGGGTACTGGCCCTGGGCCAATGCGT
CCTCGCTGGAGCCTTTGCCTCCTTCTACTGGGCCTTCCACAAGCCCCAGGACATCCCTACCTTC
CCCTTAATCTCTGCCTTCATCCGCACACTCCGTTACCACACTGGGTCATTGGCATTTGGAGCCC
TCATCCTGACCCTTGTGCAGATAGCCCGGGTCATCTTGGAGTATATTGACCACAAGCTCAGAGG
AGTGCAGAACCCTGTAGCCCGCTGCATCATGTGCTGTTTCAAGTGCTGCCTCTGGTGTCTGGAA
AAATTTATCAAGTTCCTAAACCGCAATGCATACATCATGATCGCCATCTACGGGAAGAATTTCT
GTGTCTCAGCCAAAAATGCGTTCATGCTACTCATGCGAAACATTGTCAGGGTGGTCGTCCTGGA
CAAAGTCACAGACCTGCTGCTGTTCTTTGGGAAGCTGCTGGTGGTCGGAGGCGTGGGGGTCCTG
TCCTTCTTTTTTTTCTCCGGTCGCATCCCGGGGCTGGGTAAAGACTTTAAGAGCCCCCACCTCA
ACTATTACTGGCTGCCCATCATGACCTCCATCCTGGGGGCCTATGTCATCGCCAGCGGCTTCTT
CAGCGTTTTCGGCATGTGTGTGGACACGCTCTTCCTCTGCTTCCTGGAAGACCTGGAGCGGAAC
AACGGCTCCCTGGACCGGCCCTACTACATGTCCAAGAGCCTTCTAAAGATTCTGGGCAAGAAGA
ACGAGGCGCCCCCGGACAACAAGAAGAGGAAGAAGTGACAGCTCCGGCCCTGATCCAGGACTGC
ACCCCACCCCCACCGTCCAGCCATCCAACCTCACTTCGCCTTACAGGTCTCCATTTTGTGGTAA
AAAAAGGTTTTAGGCCAGGCGCCGTGGCTCACGCCTGTAATCCAACACTTTGAGAGGCTGAGGC
GGGCGGATCACCTGAGTCAGGAGTTCGAGACCAGCCTGGCCAACATGGTGAAACCTCCGTCTCT
ATTAAAAATACAAAAATTAGCCGAGAGTGGTGGCATGCACCTGTCATCCCAGCTACTCGGGAGG
CTGAGGCAGGAGAATCGCTTGAACCCGGGAGGCAGAGGTTGCAGTGAGCCGAGATCGCGCCACT
GCACTCCAACCTGGGTGACAGACTCTGTCTCCAAAACAAAACAAACAAACAAAAAGATTTTATT
AAAGATATTTTGTTAACTCAGTAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001171515	(Get FASTA)	NCBI Sequence Viewer
	NP_001171516	(Get FASTA)	NCBI Sequence Viewer
	NP_079533	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAD21813	(Get FASTA)	NCBI Sequence Viewer
	AAH14659	(Get FASTA)	NCBI Sequence Viewer
	AAQ88822	(Get FASTA)	NCBI Sequence Viewer
	AEE60961	(Get FASTA)	NCBI Sequence Viewer
	ANB32183	(Get FASTA)	NCBI Sequence Viewer
	AQY77123	(Get FASTA)	NCBI Sequence Viewer
	AQY77124	(Get FASTA)	NCBI Sequence Viewer
	AQY77125	(Get FASTA)	NCBI Sequence Viewer
	AQY77126	(Get FASTA)	NCBI Sequence Viewer
	AQY77127	(Get FASTA)	NCBI Sequence Viewer
	AQY77128	(Get FASTA)	NCBI Sequence Viewer
	AQY77129	(Get FASTA)	NCBI Sequence Viewer
	BAB55083	(Get FASTA)	NCBI Sequence Viewer
	BAB63296	(Get FASTA)	NCBI Sequence Viewer
	BAD96718	(Get FASTA)	NCBI Sequence Viewer
	BAG62256	(Get FASTA)	NCBI Sequence Viewer
	BAG63084	(Get FASTA)	NCBI Sequence Viewer
	CAH56275	(Get FASTA)	NCBI Sequence Viewer
	EAX03538	(Get FASTA)	NCBI Sequence Viewer
	EAX03539	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSP00000229729
	ENSP00000229729.6
	ENSP00000364712
	ENSP00000364712.4
	ENSP00000372870.4
	ENSP00000389244.2
	ENSP00000393939.2
	ENSP00000398852.2
	ENSP00000399161.2
	ENSP00000414120.2
	ENSP00000444109
	ENSP00000444109.1
	ENSP00000447560.1
	ENSP00000447704.1
	ENSP00000448088.1
	ENSP00000448474.1
	ENSP00000449039.1
	ENSP00000449180.1
	ENSP00000449232.1
	ENSP00000449518.1
	ENSP00000449642.1
GenBank Protein	Q53GD3	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_079533 ⟸ NM_025257
- Peptide Label:	isoform 1
- UniProtKB:	Q96K59 (UniProtKB/Swiss-Prot), Q96C58 (UniProtKB/Swiss-Prot), Q8TEW4 (UniProtKB/Swiss-Prot), Q6UX89 (UniProtKB/Swiss-Prot), Q658S8 (UniProtKB/Swiss-Prot), Q5JQ93 (UniProtKB/Swiss-Prot), Q5JP84 (UniProtKB/Swiss-Prot), E9PEK7 (UniProtKB/Swiss-Prot), B4DWM2 (UniProtKB/Swiss-Prot), B4DU94 (UniProtKB/Swiss-Prot), B0UZY8 (UniProtKB/Swiss-Prot), B0UXX8 (UniProtKB/Swiss-Prot), A2BED3 (UniProtKB/Swiss-Prot), Q9Y332 (UniProtKB/Swiss-Prot), Q53GD3 (UniProtKB/Swiss-Prot), A0A140VJH4 (UniProtKB/TrEMBL), A0A0G2JL76 (UniProtKB/TrEMBL)
- Sequence:	show sequence MGGKQRDEDDEAYGKPVKYDPSFRGPIKNRSCTDVICCVLFLLFILGYIVVGIVAWLYGDPRQV LYPRNSTGAYCGMGENKDKPYLLYFNIFSCILSSNIISVAENGLQCPTPQVCVSSCPEDPWTVG KNEFSQTVGEVFYTKNRNFCLPGVPWNMTVITSLQQELCPSFLLPSAPALGRCFPWTNVTPPAL PGITNDTTIQQGISGLIDSLNARDISVKIFEDFAQSWYWILVALGVALVLSLLFILLLRLVAGP LVLVLILGVLGVLAYGIYYCWEEYRVLRDKGASISQLGFTTNLSAYQSVQETWLAALIVLAVLE AILLLMLIFLRQRIRIAIALLKEASKAVGQMMSTMFYPLVTFVLLLICIAYWAMTALYLATSGQ PQYVLWASNISSPGCEKVPINTSCNPTAHLVNSSCPGLMCVFQGYSSKGLIQRSVFNLQIYGVL GLFWTLNWVLALGQCVLAGAFASFYWAFHKPQDIPTFPLISAFIRTLRYHTGSLAFGALILTLV QIARVILEYIDHKLRGVQNPVARCIMCCFKCCLWCLEKFIKFLNRNAYIMIAIYGKNFCVSAKN AFMLLMRNIVRVVVLDKVTDLLLFFGKLLVVGGVGVLSFFFFSGRIPGLGKDFKSPHLNYYWLP IMTSILGAYVIASGFFSVFGMCVDTLFLCFLEDLERNNGSLDRPYYMSKSLLKILGKKNEAPPD NKKRKK hide sequence

RefSeq Acc Id:	NP_001171515 ⟸ NM_001178044
- Peptide Label:	isoform 2
- UniProtKB:	A0A0G2JL76 (UniProtKB/TrEMBL), A0A1U9X8K1 (UniProtKB/TrEMBL)
- Sequence:	show sequence MGGKQRDEDDEAYGKPVKYDPSFRGPIKNRSCTDVICCVLFLLFILGYIVVGIVAWLYGDPRQV LYPRNSTGAYCGMGENKDKPYLLYFNIFSCILSSNIISVAENGLQCPTPQTVITSLQQELCPSF LLPSAPALGRCFPWTNVTPPALPGITNDTTIQQGISGLIDSLNARDISVKIFEDFAQSWYWILV ALGVALVLSLLFILLLRLVAGPLVLVLILGVLGVLAYGIYYCWEEYRVLRDKGASISQLGFTTN LSAYQSVQETWLAALIVLAVLEAILLLMLIFLRQRIRIAIALLKEASKAVGQMMSTMFYPLVTF VLLLICIAYWAMTALYLATSGQPQYVLWASNISSPGCEKVPINTSCNPTAHLVNSSCPGLMCVF QGYSSKGLIQRSVFNLQIYGVLGLFWTLNWVLALGQCVLAGAFASFYWAFHKPQDIPTFPLISA FIRTLRYHTGSLAFGALILTLVQIARVILEYIDHKLRGVQNPVARCIMCCFKCCLWCLEKFIKF LNRNAYIMIAIYGKNFCVSAKNAFMLLMRNIVRVVVLDKVTDLLLFFGKLLVVGGVGVLSFFFF SGRIPGLGKDFKSPHLNYYWLPIMTSILGAYVIASGFFSVFGMCVDTLFLCFLEDLERNNGSLD RPYYMSKSLLKILGKKNEAPPDNKKRKK hide sequence

RefSeq Acc Id:	NP_001171516 ⟸ NM_001178045
- Peptide Label:	isoform 3
- UniProtKB:	A0A1U9X8K7 (UniProtKB/TrEMBL), A0A0G2JL76 (UniProtKB/TrEMBL)
- Sequence:	show sequence MGENKDKPYLLYFNIFSCILSSNIISVAENGLQCPTPQVCVSSCPEDPWTVGKNEFSQTVGEVF YTKNRNFCLPGVPWNMTVITSLQQELCPSFLLPSAPALGRCFPWTNVTPPALPGITNDTTIQQG ISGLIDSLNARDISVKIFEDFAQSWYWILVALGVALVLSLLFILLLRLVAGPLVLVLILGVLGV LAYGIYYCWEEYRVLRDKGASISQLGFTTNLSAYQSVQETWLAALIVLAVLEAILLLMLIFLRQ RIRIAIALLKEASKAVGQMMSTMFYPLVTFVLLLICIAYWAMTALYLATSGQPQYVLWASNISS PGCEKVPINTSCNPTAHLVNSSCPGLMCVFQGYSSKGLIQRSVFNLQIYGVLGLFWTLNWVLAL GQCVLAGAFASFYWAFHKPQDIPTFPLISAFIRTLRYHTGSLAFGALILTLVQIARVILEYIDH KLRGVQNPVARCIMCCFKCCLWCLEKFIKFLNRNAYIMIAIYGKNFCVSAKNAFMLLMRNIVRV VVLDKVTDLLLFFGKLLVVGGVGVLSFFFFSGRIPGLGKDFKSPHLNYYWLPIMTSILGAYVIA SGFFSVFGMCVDTLFLCFLEDLERNNGSLDRPYYMSKSLLKILGKKNEAPPDNKKRKK hide sequence

Ensembl Acc Id:

ENSP00000229729 ⟸ ENST00000229729

Ensembl Acc Id:

ENSP00000444109 ⟸ ENST00000544672

Ensembl Acc Id:

ENSP00000398901 ⟸ ENST00000414427

Ensembl Acc Id:

ENSP00000364712 ⟸ ENST00000375562

Ensembl Acc Id:

ENSP00000496109 ⟸ ENST00000644409

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q53GD3-F1-model_v2	AlphaFold	Q53GD3	1-710	view protein structure

Promoters

RGD ID:

6872670

Promoter ID:

EPDNEW_H9500

Type:

initiation region

Name:

SLC44A4_1

Description:

solute carrier family 44 member 4

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	6	31,878,997 - 31,879,057	EPDNEW

RGD ID:

6804804

Promoter ID:

HG_KWN:53008

Type:

Non-CpG

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

K562

Transcripts:

OTTHUMT00000268532

Position:

Human Assembly	Chr	Position (strand)	Source
Build 36	6	31,940,881 - 31,941,381 (-)	MPROMDB

RGD ID:

6804145

Promoter ID:

HG_KWN:53011

Type:

Non-CpG

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

NB4

Transcripts:

ENST00000229729, ENST00000375562, ENST00000375582, NM_001178044, OTTHUMT00000076235, OTTHUMT00000268528, OTTHUMT00000268529

Position:

Human Assembly	Chr	Position (strand)	Source
Build 36	6	31,955,246 - 31,955,746 (-)	MPROMDB

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	HGNC:13941	AgrOrtholog
COSMIC	SLC44A4	COSMIC
Ensembl Genes	ENSG00000204385	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
	ENSG00000206378	UniProtKB/Swiss-Prot
	ENSG00000228263	UniProtKB/Swiss-Prot
	ENSG00000229077	UniProtKB/Swiss-Prot
	ENSG00000231479	UniProtKB/Swiss-Prot
	ENSG00000232180	UniProtKB/Swiss-Prot
	ENSG00000235336	UniProtKB/Swiss-Prot
Ensembl Transcript	ENST00000229729	ENTREZGENE
	ENST00000229729.11	UniProtKB/Swiss-Prot
	ENST00000375562	ENTREZGENE
	ENST00000375562.8	UniProtKB/Swiss-Prot
	ENST00000383379.8	UniProtKB/Swiss-Prot
	ENST00000415517.6	UniProtKB/Swiss-Prot
	ENST00000417894.6	UniProtKB/Swiss-Prot
	ENST00000425238.6	UniProtKB/Swiss-Prot
	ENST00000442152.6	UniProtKB/Swiss-Prot
	ENST00000453831.6	UniProtKB/Swiss-Prot
	ENST00000544672	ENTREZGENE
	ENST00000544672.5	UniProtKB/Swiss-Prot
	ENST00000546461.3	UniProtKB/Swiss-Prot
	ENST00000547493.1	UniProtKB/Swiss-Prot
	ENST00000547684.1	UniProtKB/Swiss-Prot
	ENST00000548188.1	UniProtKB/Swiss-Prot
	ENST00000549663.5	UniProtKB/Swiss-Prot
	ENST00000549677.5	UniProtKB/Swiss-Prot
	ENST00000550401.2	UniProtKB/Swiss-Prot
	ENST00000551168.3	UniProtKB/Swiss-Prot
	ENST00000553121.5	UniProtKB/Swiss-Prot
GTEx	ENSG00000204385	GTEx
	ENSG00000206378	GTEx
	ENSG00000228263	GTEx
	ENSG00000229077	GTEx
	ENSG00000231479	GTEx
	ENSG00000232180	GTEx
	ENSG00000235336	GTEx
HGNC ID	HGNC:13941	ENTREZGENE
Human Proteome Map	SLC44A4	Human Proteome Map
InterPro	Choline_transptr-like	UniProtKB/Swiss-Prot
KEGG Report	hsa:80736	UniProtKB/Swiss-Prot
NCBI Gene	80736	ENTREZGENE
OMIM	606107	OMIM
PANTHER	CHOLINE TRANSPORTER-LIKE PROTEIN 4	UniProtKB/Swiss-Prot
	PTHR12385	UniProtKB/Swiss-Prot
Pfam	Choline_transpo	UniProtKB/Swiss-Prot
PharmGKB	PA25930	PharmGKB
RNAcentral	URS00009B9A04	RNACentral
	URS0002617BB2	RNACentral
	URS0002617E54	RNACentral
UniProt	A0A0G2JIN1_HUMAN	UniProtKB/TrEMBL
	A0A0G2JL76	ENTREZGENE, UniProtKB/TrEMBL
	A0A140VJH4	ENTREZGENE, UniProtKB/TrEMBL
	A0A1U9X8K1	ENTREZGENE, UniProtKB/TrEMBL
	A0A1U9X8K7	ENTREZGENE, UniProtKB/TrEMBL
	A2BED3	ENTREZGENE
	B0UXX8	ENTREZGENE
	B0UZY8	ENTREZGENE
	B4DU94	ENTREZGENE
	B4DWM2	ENTREZGENE
	CTL4_HUMAN	UniProtKB/Swiss-Prot
	E9PEK7	ENTREZGENE
	H0Y5I3_HUMAN	UniProtKB/TrEMBL
	Q53GD3	ENTREZGENE
	Q5JP84	ENTREZGENE
	Q5JQ93	ENTREZGENE
	Q658S8	ENTREZGENE
	Q6UX89	ENTREZGENE
	Q8TEW4	ENTREZGENE
	Q96C58	ENTREZGENE
	Q96K59	ENTREZGENE
	Q9Y332	ENTREZGENE
UniProt Secondary	A2BED3	UniProtKB/Swiss-Prot
	B0UXX8	UniProtKB/Swiss-Prot
	B0UZY8	UniProtKB/Swiss-Prot
	B4DU94	UniProtKB/Swiss-Prot
	B4DWM2	UniProtKB/Swiss-Prot
	E9PEK7	UniProtKB/Swiss-Prot
	Q5JP84	UniProtKB/Swiss-Prot
	Q5JQ93	UniProtKB/Swiss-Prot
	Q658S8	UniProtKB/Swiss-Prot
	Q6UX89	UniProtKB/Swiss-Prot
	Q8TEW4	UniProtKB/Swiss-Prot
	Q96C58	UniProtKB/Swiss-Prot
	Q96K59	UniProtKB/Swiss-Prot
	Q9Y332	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-12-15	SLC44A4	solute carrier family 44 member 4		solute carrier family 44, member 4	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Imported Human Phenotype Annotations - HPO

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Imported Human Phenotype Annotations - HPO