Cir1 (corepressor interacting with RBPJ, 1)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Cir1 (corepressor interacting with RBPJ, 1) Mus musculus

Analyze

Symbol:

Cir1

Name:

corepressor interacting with RBPJ, 1

RGD ID:

1319407

MGI Page

MGI

Description:

Predicted to enable histone deacetylase binding activity; protein kinase binding activity; and transcription corepressor activity. Acts upstream of or within in utero embryonic development. Predicted to be located in nuclear speck. Predicted to be part of protein-containing complex. Predicted to be active in nucleus. Predicted to colocalize with centrosome. Is expressed in genitourinary system and limb ectoderm. Orthologous to human CIR1 (corepressor interacting with RBPJ, CIR1).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

1700023B02Rik; 2810021A19Rik; C; CBF1 interacting corepressor; CBF1-interacting corepressor; Cicr; Cir; corepressor interacting with RBPJ 1; MGC117636; RP23-463K8.2

RGD Orthologs

Human

Rat

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CIR1 (corepressor interacting with RBPJ, CIR1)	HGNC	Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Cir1 (corepressor interacting with RBPJ, 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Cir1 (corepressor interacting with RBPJ, CIR1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CIR1 (corepressor interacting with RBPJ, CIR1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CIR1 (corepressor interacting with RBPJ, CIR1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Cir1 (corepressor interacting with RBPJ, CIR1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CIR1 (corepressor interacting with RBPJ, CIR1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CIR1 (corepressor interacting with RBPJ, CIR1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Cir1 (corepressor interacting with RBPJ, CIR1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Cir1 (corepressor interacting with RBPJ, 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	CIR1 (corepressor interacting with RBPJ, CIR1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG6843	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	cir-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cir1	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid\|ZFIN)
Xenopus tropicalis (tropical clawed frog):	cir1	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Related Pseudogenes:

Gm13803 Gm18717 Gm18760 Gm2810 Gm5605

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	73,113,445 - 73,142,922 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	73,113,449 - 73,143,045 (-)	Ensembl		GRCm39 Ensembl
GRCm38	2	73,283,872 - 73,312,592 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	73,283,105 - 73,312,701 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	73,121,929 - 73,150,649 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	74,118,687 - 74,147,526 (-)	NCBI		MGSCv36	mm8
MGSCv36	2	73,084,711 - 73,113,342 (-)	NCBI		MGSCv36	mm8
Celera	5	37,786,959 - 37,788,240 (+)	NCBI		Celera
Cytogenetic Map	2	C3	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

COVID-19 (ISO)

genetic disease (ISO)

split hand-foot malformation 5 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17beta-estradiol (ISO)

all-trans-retinoic acid (ISO)

amphetamine (ISO)

arsenite(3-) (ISO)

bisphenol A (EXP,ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

cisplatin (ISO)

copper(II) sulfate (ISO)

coumarin (ISO)

cyclosporin A (ISO)

dicrotophos (ISO)

ethyl methanesulfonate (ISO)

flutamide (ISO)

folic acid (EXP)

glyphosate (ISO)

methyl methanesulfonate (ISO)

nickel atom (ISO)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

senecionine (EXP)

Soman (ISO)

topotecan (ISO)

urethane (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

in utero embryonic development (IMP)

mRNA processing (IEA)

negative regulation of DNA-templated transcription (IBA,ISO)

negative regulation of transcription by RNA polymerase II (ISO)

RNA splicing (IEA)

Cellular Component

centrosome (ISO)

cytoplasm (IEA)

cytoskeleton (IEA)

nuclear speck (ISO)

nucleus (IBA,ISO)

protein-containing complex (ISO)

Molecular Function

histone deacetylase binding (ISO)

protein binding (IPI)

protein kinase binding (ISO)

protein-containing complex binding (ISO)

transcription corepressor activity (IBA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

Notch signaling pathway (IEA)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

abnormal atrioventricular cushion morphology (IEA)

abnormal eye muscle morphology (IEA)

abnormal forebrain morphology (IEA)

abnormal hypoglossal nerve topology (IEA)

abnormal large intestine morphology (IEA)

abnormal Mullerian duct morphology (IEA)

abnormal optic cup morphology (IEA)

abnormal placenta morphology (IAGP)

abnormal placental labyrinth vasculature morphology (IAGP)

abnormal pulmonary valve cusp morphology (IEA)

abnormal thyroid gland morphology (IEA)

abnormal ureter morphology (IEA)

abnormal Wolffian duct morphology (IEA)

absent costovertebral joint (IEA)

absent intracranial segment of vertebral artery (IEA)

absent vertebral pedicles (IEA)

additional anastomosis between intracranial vertebral arteries (IEA)

decreased cervical vertebrae number (IEA)

decreased rib number (IEA)

fusion of vertebral arches (IEA)

heterochrony (IEA)

multiple persisting craniopharyngeal ducts (IEA)

occipital bone foramen (IEA)

overriding aortic valve (IEA)

perimembraneous ventricular septal defect (IEA)

persistent trigeminal artery (IEA)

preweaning lethality, complete penetrance (IAGP)

rib bifurcation (IEA)

rib fusion (IEA)

scoliosis (IEA)

small kidney (IEA)

subcutaneous edema (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	MGDs mouse GO annotations	MGD data from the GO Consortium
2.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
3.	Mouse MP Annotation Import Pipeline	RGD automated import pipeline
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:10349636	PMID:10922068	PMID:11042159	PMID:11076861	PMID:11217851	PMID:11591653	PMID:12466851	PMID:12477932	PMID:12520002	PMID:14610273	PMID:15317747	PMID:15489334
PMID:15652350	PMID:16141072	PMID:16141073	PMID:18287559	PMID:20059953	PMID:21267068	PMID:21677750	PMID:21873635	PMID:24146773	PMID:27996060	PMID:28185240	PMID:29539633
PMID:30196744	PMID:32325033

Genomics

Comparative Map Data

Cir1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	73,113,445 - 73,142,922 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	73,113,449 - 73,143,045 (-)	Ensembl		GRCm39 Ensembl
GRCm38	2	73,283,872 - 73,312,592 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	73,283,105 - 73,312,701 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	73,121,929 - 73,150,649 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	74,118,687 - 74,147,526 (-)	NCBI		MGSCv36	mm8
MGSCv36	2	73,084,711 - 73,113,342 (-)	NCBI		MGSCv36	mm8
Celera	5	37,786,959 - 37,788,240 (+)	NCBI		Celera
Cytogenetic Map	2	C3	NCBI

CIR1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	174,348,022 - 174,395,712 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	2	174,348,022 - 174,395,712 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	175,212,750 - 175,260,440 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	174,921,124 - 174,968,689 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	2	168,826,371 - 168,873,879 (-)	NCBI		Celera
Cytogenetic Map	2	q31.1	NCBI
HuRef	2	167,093,116 - 167,140,610 (-)	NCBI		HuRef
CHM1_1	2	175,219,101 - 175,266,631 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	2	174,836,713 - 174,884,400 (-)	NCBI		T2T-CHM13v2.0

Cir1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	3	58,159,418 - 58,188,719 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	58,158,951 - 58,188,789 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	61,551,945 - 61,581,203 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	3	70,135,603 - 70,164,861 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	3	67,900,616 - 67,929,874 (-)	NCBI	Rnor_WKY
Rnor_6.0	3	59,994,547 - 60,023,843 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	59,994,181 - 60,023,913 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	66,478,181 - 66,507,756 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	55,789,080 - 55,818,634 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	55,685,451 - 55,715,006 (-)	NCBI
Celera	3	57,695,014 - 57,724,195 (-)	NCBI		Celera
Cytogenetic Map	3	q23	NCBI

Cir1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955449	959,827 - 996,145 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955449	960,524 - 993,720 (+)	NCBI	ChiLan1.0	ChiLan1.0

CIR1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	2B	77,026,453 - 77,075,244 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2B	61,625,357 - 61,673,614 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2B	179,080,244 - 179,127,915 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2B	179,080,721 - 179,127,831 (-)	Ensembl	panpan1.1		panPan2

CIR1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	36	18,414,031 - 18,452,951 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	36	18,414,237 - 18,452,874 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	36	18,423,354 - 18,462,172 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	36	18,547,300 - 18,588,986 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	36	18,547,311 - 18,588,911 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	36	18,627,108 - 18,666,132 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	36	18,625,404 - 18,664,459 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	36	18,735,905 - 18,774,872 (-)	NCBI		UU_Cfam_GSD_1.0

Cir1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	135,577,359 - 135,618,066 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936509	4,130,629 - 4,172,408 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936509	4,131,257 - 4,171,984 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CIR1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	15	80,338,318 - 80,375,708 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	15	80,338,317 - 80,375,708 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	15	89,532,435 - 89,536,128 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CIR1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	10	59,862,745 - 59,911,732 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	10	59,863,244 - 59,912,492 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666040	139,682,580 - 139,731,007 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cir1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624787	11,589,396 - 11,624,745 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624787	11,589,199 - 11,624,862 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Cir1
569 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	396
Count of miRNA genes:	307
Interacting mature miRNAs:	341
Transcripts:	ENSMUST00000058615, ENSMUST00000136519
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCm39)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1301769	Orgwq2_m	organ weight QTL 2 (mouse)			Not determined		2	3887126	93421651	Mouse
1357881	Estoq1_m	embryo survival total QTL 1 (mouse)			Not determined		2	20897778	118894840	Mouse
1357454	Kidq1_m	kidney weight QTL 1 (mouse)			Not determined		2	20897778	118894840	Mouse
1357436	Splq1_m	spleen weight QTL 1 (mouse)			Not determined		2	20897778	118894840	Mouse
39128209	Lwq14_m	liver weight QTL 14 (mouse)					2	20897778	118894840	Mouse
1558899	Egq1_m	early growth QTL 1 (mouse)			Not determined		2	20897778	118894840	Mouse
1558966	W10q9_m	weight 10 weeks QTL 9 (mouse)			Not determined		2	20897778	118894840	Mouse
1558915	W3q1_m	weight 3 weeks QTL 1 (mouse)			Not determined		2	20897778	118894840	Mouse
1558738	W6q1_m	weight 6 weeks QTL 1 (mouse)			Not determined		2	20897778	118894840	Mouse
1357681	Hrtq1_m	heart weight QTL 1 (mouse)			Not determined		2	20897778	118894840	Mouse
1302174	Dssc2_m	dextran sodium sulfate induced colitis QTL2 (mouse)			Not determined		2	24224632	148700377	Mouse
1300577	Capsq1_m	capsaicin sensitivity related QTL 1 (mouse)			Not determined		2	27602060	84013384	Mouse
4141854	T2dm2sa_m	type 2 diabetes mellitus 2 in SMXA RI mice (mouse)			Not determined		2	29307947	148374934	Mouse
4141236	Hbnr5_m	Heligmosomoides bakeri nematode resistance 5 (mouse)			Not determined			31214567	105143570	Mouse
11038703	Ltpr1_m	Leishmania tropica response 1 (mouse)					2	39971665	73971811	Mouse
1301109	Dntcs2_m	dental caries susceptibility 2 (mouse)			Not determined		2	40885493	114910165	Mouse
1301480	Pbwg1_m	postnatal body weight growth 1 (mouse)			Not determined		2	41820719	75820843	Mouse
4141069	Pbwg1.5_m	postnatal body weight growth 1.5 (mouse)			Not determined			43520612	77520756	Mouse
1300788	Cia2_m	collagen induced arthritis QTL 2 (mouse)			Not determined		2	43520612	77520756	Mouse
1300671	Cia4_m	collagen induced arthritis QTL 4 (mouse)			Not determined		2	43520612	77520756	Mouse
1301402	Ap2q_m	alcohol preference 2 QTL (mouse)			Not determined		2	43520612	77520756	Mouse
1301411	Pitm1_m	prion incubation time 1 (mouse)			Not determined		2	43520612	77520756	Mouse
10755532	Lymph5_m	lymphocyte differential 5 (mouse)					2	44199017	78199017	Mouse
1301344	Lith1_m	lithogenic gene 1 (mouse)			Not determined		2	45347635	145312647	Mouse
11532740	Pbwg1.10_m	postnatal body weight growth 1.10 (mouse)					2	48132412	82132495	Mouse
1558820	Moo1_m	modifier of Odc1 (mouse)			Not determined		17	48269746	82269934	Mouse
1301747	Eae21_m	experimental allergic encephalomyelitis 21 (mouse)			Not determined		2	48269746	82269934	Mouse
1301235	Alcw4_m	alcohol withdrawal 4 (mouse)			Not determined		2	48269746	82269934	Mouse
1300568	Hdl1_m	high density lipoprotein (HDL) level 1 (mouse)			Not determined		2	48269746	82269934	Mouse
10755526	Lymph1_m	lymphocyte differential 1 (mouse)					2	50819314	84819314	Mouse
1300875	Taste1_m	taste-saccharin preference 1 (mouse)			Not determined		2	50923175	84923278	Mouse
1300761	Lgth1_m	body length 1 (mouse)			Not determined		2	51703276	85703425	Mouse
13464141	Hbbcq3_m	hemoglobin concentration QTL 3 (mouse)					2	52448019	86448136	Mouse
13463471	Hctq6_m	hematocrit QTL 6 (mouse)					2	52448019	86448136	Mouse
4141406	Alpq2_m	alcohol preference QTL 2 (mouse)			Not determined		2	57524117	91524288	Mouse
12738429	Lfibq18_m	liver fibrosis QTL 18 (mouse)					2	57919991	91919991	Mouse
1357577	Trmq3_m	T cell ratio modifier QTL 3 (mouse)			Not determined		2	60520612	119355518	Mouse
13432178	Actres2_m	activity response to ethanol/saline 2 (mouse)					2	60692287	74092287	Mouse
13824983	Vclq1_m	curvilinear velocity QTL 1 (mouse)					2	61830344	136841920	Mouse
10044002	Hdl7_m	HDL level 7 (mouse)			Not determined		2	63005954	97006113	Mouse
10053681	Lith24_m	lithogenic gene 24 (mouse)			Not determined		2	63005954	97006113	Mouse
1301405	Etohr_m	ethanol response acute (mouse)			Not determined		2	63005954	97006113	Mouse
1301703	Bomd3_m	bone mineral density 3 (mouse)			Not determined		2	63005954	97006113	Mouse
1300662	Etohila_m	ethanol induced locomotor activity (mouse)			Not determined		2	63005954	97006113	Mouse
1301048	Actre2_m	activity response to ethanol 2 (mouse)			Not determined		2	63005954	97006113	Mouse
1301873	Hsl1_m	hyperoxia susceptibility locus 1 (mouse)			Not determined		2	63570154	97570301	Mouse
5491197	Mobq5_m	multigenic obesity QTL 5 (mouse)			Not determined		2	65269746	162518926	Mouse
1301059	Hrtfm1_m	heart failure modifier 1 (mouse)			Not determined		2	67591940	74964933	Mouse
1301660	Iba1_m	induction of brown adipocytes 1 (mouse)			Not determined		2	67647887	101648142	Mouse
13463482	Mchq17_m	mean corpuscular hemoglobin QTL 17 (mouse)					2	67647887	101648142	Mouse
1301882	Etohc2_m	ethanol consumption 2 (mouse)			Not determined		2	68724269	102724407	Mouse
1301948	Elsgp3_m	elevated serum gp70 3 (mouse)			Not determined		2	68724269	102724407	Mouse

Markers in Region

RH126971

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	2	73,302,624 - 73,302,871	UniSTS	GRCm38
MGSCv37	2	73,140,681 - 73,140,928	UniSTS	GRCm37
Celera	2	74,989,139 - 74,989,386	UniSTS
Cytogenetic Map	2	C3	UniSTS
cM Map	2	43.0	UniSTS
Whitehead/MRC_RH	2	1148.12	UniSTS

UniSTS:488742

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	8	5,117,345 - 5,118,814	UniSTS	GRCm38
MGSCv37	8	5,117,345 - 5,118,814	UniSTS	GRCm37
Celera	8	5,316,144 - 5,317,613	UniSTS
Cytogenetic Map	8	A1.1	UniSTS
Cytogenetic Map	2	C3	UniSTS

Expression

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_025854	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AK005900	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK006260	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK008242	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK131674	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AL954713	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC012219	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC061077	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC079479	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC089602	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC094283	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC099444	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CJ050326	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSMUST00000058615 ⟹ ENSMUSP00000049834

RefSeq Status:

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	2	73,113,449 - 73,143,045 (-)	Ensembl
GRCm38.p6 Ensembl	2	73,283,105 - 73,312,701 (-)	Ensembl

RefSeq Acc Id:

ENSMUST00000136519

RefSeq Status:

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	2	73,115,361 - 73,142,911 (-)	Ensembl
GRCm38.p6 Ensembl	2	73,285,017 - 73,312,567 (-)	Ensembl

RefSeq Acc Id:

NM_025854 ⟹ NP_080130

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	2	73,113,445 - 73,142,922 (-)	NCBI
GRCm38	2	73,283,872 - 73,312,592 (-)	ENTREZGENE
MGSCv37	2	73,121,929 - 73,150,649 (-)	RGD
cM Map	2		ENTREZGENE

Sequence:

show sequence

GGAAGTTCTCGCCCAAACTTGCCTAGCAGTTCCGGTGAAGCTCCGGGAGTTTGTTTACGTTCCG
AGAAGACCTAGCGGTTGGCTTCTCCGACTCAGACGCCAAGATGGGGAAGTCATTCGCCAATTTC
ATGTGTAAGAAGGACTTCCATCCTGCGTCCAAATCCAACATCAAGAAGGTATGGATGGCAGAAC
AGAAAATATCGTATGATAAAAAGAAACAAGAAGAATTAATGCAACAGTACCTTAAAGAGCAGGA
GTCGTATGATAACAGATTGCTTATGGGAGATGAACGTGTGAAGAATGGCCTGAATTTCATGTAC
GAGGCCCCACCAGGAGTTAAGAAAGAAAACAAAGAGAAAGAAGAAACGGAAGGAGAGACCGAGT
ACAAGTTTGAATGGCAGAAAGGCGCTCCGAGAGAAAAATATGCCAAAGATGACATGAACATCAG
AGATCAGCCCTTTGGTATTCAGGTTCGAAATGTAAGGTGTATTAAATGTCACAAGTGGGGCCAT
GTGAACACAGATCGAGAGTGTCCCTTGTTTGGTCTTTCTGGGATCAATGCAAGTTCAGTTCCTA
CTGATGGCTCAGGGCCGTCGATGCACCCCTCGGAGCTAATAGCGGAGATGAGAAACAGTGGGTT
TGCACTGAAACGAAATGTACTGGGGAGAAACTTGACCGCAAATGATCCATCACAGGACTATGTC
GCAAGTGACTGTGAAGAAGACCCTGAAGTTGAGTTCTTAAAGTCGCTCACCACCAAGCAGAAGC
AGAAGCTCCTCAGGAAATTGGATAGACTTGAAAAGAAAAAAAAGAAAAAGAAAAGTGATAAGAA
AAAGAAGAAGTTACAGAAGAGCAAAAATAAACACAAGAAACGTAAAAACAAATCCCCTTCCTCT
TCCTCCTCTTCCTCCTCTTCCTCCTCTTCCTCCTCCTCCTCCTCCTCTTCCTCTTCCTCCTCCT
CGGAGACATCAGATAGCAGCAGTGAGAGTGATAACAAAGAAAAGAAAAGAGAGAAAGAGAAGAG
GAAGAAGAAGAAGAAAACCAAATGTTCTGAAAGTAAATCCAGTGACTGTAAGGAGGACAAGCCT
AAGAACATGCTTTACGAAGAACTTTCCAGCAGTCACAGTGACAGGGGAAAAGCCCAGGAAAAAT
TAAGGTTTCCAAAACAAGAGAGTTCTGGGGAGAATAGCATGTGGGTCCATTCTGCTTCTGACCG
GACATCCAGAAGCCACCGGCACAGTCCAGAGAAGAAAGGGTCTGACAGAAATCGGGGAATCCGA
AGTCGGAGCCGTAGCCGGGCTGAGAGCAGCCGGCGAAGCAGAAGCAGGAGTCCTTACCGTCAGA
AGCACAGGGAGGTGAGGAGCCGGCCACACCGGAGCCCTAGTGAAGAGCAGAAGGGAAGAAAGGG
CACCAGAAGCCATGGTGAAGGTGACCATAGAAGAGAGCACGTGCGCTGAGCGCCCAGGAGATAA
AGGGAGAGGCAGCAGGCTCAACAGAGCTTCGGAGCAACCACCTGGGCATCAAGGACATCTTTAG
CAAGGGCTAACATACACATTGTTATCTAATAAAAAAAGTCAATTCATTTTCCATCTCTGTAAAC
TGTTGTTTCAAGTATTAAAGCACTGTTGTACCACAAGCTTAAGTTTGCAGATATTTGCAGGGAA
TTTAGGGTATACAAGTAGTTTTTGTTTTGTTGTTGTTGTGGTGGTGGTGATGGTGGTGGTAGTG
GTGGTTTTCTTGTTGGTAGTTGTTTCTTCTGCCTTATACCAGATTTAAAATATGTACGTAATTG
TGTGATTTTGTTGTTGTTTTGAAACACCATTAAAACAGTGACAGAATCTTGAATAATTATCAAT
TCAAATTTGTTATTTTAAGATTTGAATATGCTTGAAGCAAAATGTAATCATTGTTGAAACTGAC
TAGGGTGAATAAAATACTGGATATC

hide sequence

Protein Sequences


Protein RefSeqs	NP_080130	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH89602	(Get FASTA)	NCBI Sequence Viewer
	AAH94283	(Get FASTA)	NCBI Sequence Viewer
	BAB24488	(Get FASTA)	NCBI Sequence Viewer
	BAE20758	(Get FASTA)	NCBI Sequence Viewer
	Q9DA19	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_080130 ⟸ NM_025854

- UniProtKB:

Q5FW66 (UniProtKB/Swiss-Prot), Q9DA19 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MGKSFANFMCKKDFHPASKSNIKKVWMAEQKISYDKKKQEELMQQYLKEQESYDNRLLMGDERV
KNGLNFMYEAPPGVKKENKEKEETEGETEYKFEWQKGAPREKYAKDDMNIRDQPFGIQVRNVRC
IKCHKWGHVNTDRECPLFGLSGINASSVPTDGSGPSMHPSELIAEMRNSGFALKRNVLGRNLTA
NDPSQDYVASDCEEDPEVEFLKSLTTKQKQKLLRKLDRLEKKKKKKKSDKKKKKLQKSKNKHKK
RKNKSPSSSSSSSSSSSSSSSSSSSSSSSSETSDSSSESDNKEKKREKEKRKKKKKTKCSESKS
SDCKEDKPKNMLYEELSSSHSDRGKAQEKLRFPKQESSGENSMWVHSASDRTSRSHRHSPEKKG
SDRNRGIRSRSRSRAESSRRSRSRSPYRQKHREVRSRPHRSPSEEQKGRKGTRSHGEGDHRREH
VR

hide sequence

RefSeq Acc Id:

ENSMUSP00000049834 ⟸ ENSMUST00000058615

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9DA19-F1-model_v2	AlphaFold	Q9DA19	1-450	view protein structure

Promoters

RGD ID:

6831075

Promoter ID:

MM_KWN:29698

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day4, 3T3L1_Day6, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Liver, MEF_B4, MEF_B6, Spleen

Transcripts:

ENSMUST00000102686, OTTMUST00000032443, OTTMUST00000032444

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv36	2	73,150,711 - 73,151,432 (-)	MPROMDB

RGD ID:

6877614

Promoter ID:

EPDNEW_M2258

Type:

initiation region

Name:

Cir1_1

Description:

Mus musculus corepressor interacting with RBPJ, 1 , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	2	73,312,540 - 73,312,600	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	MGI:1914185	AgrOrtholog
Ensembl Genes	ENSMUSG00000041777	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Protein	ENSMUSP00000049834	ENTREZGENE
	ENSMUSP00000049834.10	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000058615	ENTREZGENE
	ENSMUST00000058615.10	UniProtKB/Swiss-Prot
InterPro	CIR1	UniProtKB/Swiss-Prot
	CIR_N_dom	UniProtKB/Swiss-Prot
KEGG Report	mmu:66935	UniProtKB/Swiss-Prot
MGD	MGI:1914185	ENTREZGENE
NCBI Gene	66935	ENTREZGENE
PANTHER	COREPRESSOR INTERACTING WITH RBPJ 1	UniProtKB/Swiss-Prot
	PTHR13151	UniProtKB/Swiss-Prot
Pfam	Cir_N	UniProtKB/Swiss-Prot
PhenoGen	Cir1	PhenoGen
SMART	Cir_N	UniProtKB/Swiss-Prot
UniProt	CIR1_MOUSE	UniProtKB/Swiss-Prot
	Q5FW66	ENTREZGENE
	Q9DA19	ENTREZGENE
UniProt Secondary	Q3V2N9	UniProtKB/Swiss-Prot
	Q4KL44	UniProtKB/Swiss-Prot
	Q52KL9	UniProtKB/Swiss-Prot
	Q5FW66	UniProtKB/Swiss-Prot

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Annotations - KEGG (archival)

Mammalian Phenotype

Send us a Message

Imported Disease Annotations - ClinVar

Imported Annotations - KEGG (archival)

Mammalian Phenotype