Advanced Search (OLGA)

Gene: Tnfsf18 (tumor necrosis factor (ligand) superfamily, member 18) Mus musculus

Analyze

Symbol:

Tnfsf18

Name:

tumor necrosis factor (ligand) superfamily, member 18

RGD ID:

1312876

MGI Page

MGI

Description:

Enables identical protein binding activity and tumor necrosis factor receptor superfamily binding activity. Involved in several processes, including positive regulation of NF-kappaB transcription factor activity; regulation of T cell activation; and regulation of leukocyte chemotaxis. Located in cell surface. Is expressed in skin; submandibular gland; and thyroid gland. Orthologous to human TNFSF18 (TNF superfamily member 18).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

Gi; GITR ligand; Gitrl; glucocorticoid-induced TNF-related ligand; glucocorticoid-induced-tumor necrosis factor receptor ligand; Tnlg2a; tumor necrosis factor ligand 2a; tumor necrosis factor ligand superfamily member 18

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	TNFSF18 (TNF superfamily member 18)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Tnfsf18 (TNF superfamily member 18)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Tnfsf18 (TNF superfamily member 18)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	TNFSF18 (TNF superfamily member 18)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	TNFSF18 (TNF superfamily member 18)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Tnfsf18 (TNF superfamily member 18)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	TNFSF18 (TNF superfamily member 18)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	TNFSF18 (TNF superfamily member 18)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Tnfsf18 (TNF superfamily member 18)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Tnfsf18 (TNF superfamily member 18)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	TNFSF18 (TNF superfamily member 18)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	tnfsf18 (TNF superfamily member 18)	Alliance	DIOPT (PANTHER\|ZFIN)

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	161,322,221 - 161,333,903 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	161,322,224 - 161,332,859 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	1	161,494,657 - 161,505,290 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	161,494,655 - 161,505,290 (+)	Ensembl			mm10	GRCm38
MGSCv37	1	163,424,788 - 163,435,421 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	1	163,331,332 - 163,341,967 (+)	NCBI		MGSCv36	mm8
Celera	1	163,943,104 - 163,953,733 (+)	NCBI		Celera
Cytogenetic Map	1	H2.1	NCBI
cM Map	1	69.75	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

1q24 Deletion Syndrome (ISO)

antithrombin III deficiency (ISO)

autoimmune lymphoproliferative syndrome (ISO)

gastrointestinal stromal tumor (ISO)

parathyroid carcinoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

2,3,7,8-tetrachlorodibenzodioxine (ISO)

4-nitrophenol (EXP)

alpha-amanitin (EXP)

aripiprazole (ISO)

arsenous acid (ISO)

bisphenol A (ISO)

carbon nanotube (EXP)

copper atom (ISO)

copper(0) (ISO)

dexamethasone (EXP)

diarsenic trioxide (ISO)

diclofenac (EXP)

disodium selenite (ISO)

endosulfan (ISO)

epoxiconazole (EXP)

gentamycin (ISO)

lipopolysaccharide (EXP)

okadaic acid (ISO)

ozone (EXP,ISO)

p-menthan-3-ol (ISO)

paracetamol (ISO)

PF-3758309 (ISO)

pravastatin (EXP,ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

thioacetamide (ISO)

trichloroethene (ISO)

trovafloxacin (EXP)

zaragozic acid A (EXP,ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

activated CD4-positive, alpha-beta T cell proliferation (IMP)

adaptive immune response (IEA)

immune response (IEA)

immune system process (IEA)

negative regulation of T-helper 17 cell lineage commitment (IMP)

positive regulation of cell adhesion (IEA,IMP,ISO)

positive regulation of inflammatory response (IMP)

positive regulation of interleukin-10 production (IMP)

positive regulation of interleukin-12 production (IMP)

positive regulation of leukocyte migration (IEA,ISO)

positive regulation of macrophage chemotaxis (IMP)

positive regulation of monocyte chemotaxis (IMP)

positive regulation of NF-kappaB transcription factor activity (IMP)

positive regulation of tyrosine phosphorylation of STAT protein (ISO)

regulation of CD40 signaling pathway (IMP)

regulation of dendritic cell chemotaxis (IMP)

regulation of interleukin-6 production (IMP)

regulation of macromolecule metabolic process (IEA)

regulation of monocyte chemotactic protein-1 production (IMP)

regulation of primary metabolic process (IEA)

regulation of protein-containing complex assembly (IMP)

regulation of T cell proliferation (IBA,IDA)

regulation of tumor necrosis factor production (IMP)

regulation of type II interferon production (IMP)

signal transduction (IEA)

T cell proliferation involved in immune response (IBA,IDA,IEA)

tumor necrosis factor-mediated signaling pathway (IBA,IEA,IMP)

Cellular Component

cell surface (IBA,IDA)

extracellular space (IEA)

membrane (IEA)

plasma membrane (IEA)

Molecular Function

cytokine activity (IEA)

identical protein binding (IEA,IPI,ISO)

protein binding (IPI)

signaling receptor binding (IEA)

tumor necrosis factor receptor binding (IEA)

tumor necrosis factor receptor superfamily binding (IBA,IDA,IEA)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

abnormal response to injury (IAGP)

abnormal T cell activation (IAGP)

decreased CD8-positive, alpha-beta T cell number (IAGP)

decreased circulating alanine transaminase level (IAGP)

decreased circulating aspartate transaminase level (IAGP)

decreased hepatoblast number (IAGP)

decreased inflammatory response (IAGP)

decreased lean body mass (IEA)

increased hematocrit (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	MGDs mouse GO annotations	MGD data from the GO Consortium
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:14521928	PMID:14608036	PMID:14647196	PMID:15128759	PMID:15470044	PMID:17417651	PMID:18178614	PMID:18182486	PMID:18346459	PMID:19018533	PMID:19234165
PMID:19272591	PMID:19390148	PMID:19536139	PMID:19596991	PMID:19604302	PMID:19936238	PMID:20107429	PMID:20148423	PMID:20162721	PMID:20702832	PMID:21186078	PMID:21267068
PMID:21636079	PMID:21705620	PMID:21873635	PMID:22214837	PMID:22368274	PMID:22614805	PMID:22678896	PMID:23301790	PMID:23892569	PMID:24107315	PMID:24194600	PMID:25144375
PMID:25281716	PMID:25787078	PMID:26646413	PMID:29150240	PMID:30487647	PMID:30643147	PMID:30760623	PMID:33557842	PMID:33654081	PMID:34293591	PMID:36301339	PMID:38321001
PMID:38355793	PMID:38589318

Genomics

Comparative Map Data

Tnfsf18
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	161,322,221 - 161,333,903 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	161,322,224 - 161,332,859 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	1	161,494,657 - 161,505,290 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	161,494,655 - 161,505,290 (+)	Ensembl			mm10	GRCm38
MGSCv37	1	163,424,788 - 163,435,421 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	1	163,331,332 - 163,341,967 (+)	NCBI		MGSCv36	mm8
Celera	1	163,943,104 - 163,953,733 (+)	NCBI		Celera
Cytogenetic Map	1	H2.1	NCBI
cM Map	1	69.75	NCBI

TNFSF18
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	173,039,202 - 173,050,941 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	173,039,202 - 173,050,941 (-)	Ensembl			hg38	GRCh38
GRCh37	1	173,008,342 - 173,020,081 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	171,276,983 - 171,286,726 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	1	169,742,107 - 169,751,713	NCBI
Celera	1	146,119,822 - 146,129,565 (-)	NCBI		Celera
Cytogenetic Map	1	q25.1	NCBI
HuRef	1	144,235,111 - 144,244,854 (-)	NCBI		HuRef
CHM1_1	1	174,432,835 - 174,442,578 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	172,397,315 - 172,409,046 (-)	NCBI		T2T-CHM13v2.0

Tnfsf18
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	76,366,790 - 76,440,673 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	13	76,366,771 - 76,376,608 (+)	Ensembl				GRCr8
mRatBN7.2	13	73,833,478 - 73,907,249 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	73,831,252 - 73,843,169 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	13	76,412,930 - 76,422,686 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	77,710,263 - 77,720,018 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	74,970,140 - 74,979,895 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	79,378,412 - 79,388,687 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	79,378,733 - 79,388,498 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	13	84,270,937 - 84,282,548 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	13	77,137,045 - 77,145,251 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	13	73,609,947 - 73,620,222 (+)	NCBI		Celera
RGSC_v3.1	13	77,151,151 - 77,159,439 (+)	NCBI
Cytogenetic Map	13	q22	NCBI

Tnfsf18
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955406	13,391,162 - 13,402,479 (-)	NCBI	ChiLan1.0	ChiLan1.0

TNFSF18
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	76,687,163 - 76,700,053 (+)	NCBI		NHGRI_mPanPan1-v2

TNFSF18
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	7	25,983,064 - 25,994,605 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	7	25,963,719 - 25,992,801 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	7	25,514,906 - 25,526,500 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	7	25,734,171 - 25,745,767 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	7	25,734,080 - 25,744,296 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	7	25,652,719 - 25,664,301 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	7	25,725,623 - 25,737,220 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	7	25,879,459 - 25,891,051 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Tnfsf18
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	96,652,746 - 96,661,551 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936481	14,499,577 - 14,508,017 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936481	14,499,495 - 14,508,074 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TNFSF18
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	9	115,448,973 - 115,460,950 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	9	115,447,438 - 115,460,649 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	9	127,140,943 - 127,151,861 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TNFSF18
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	25	56,105,757 - 56,118,249 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	25	56,106,584 - 56,118,758 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666055	57,711,144 - 57,721,390 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tnfsf18
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624771	8,711,017 - 8,722,539 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624771	8,711,093 - 8,722,518 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Variants

Variants in Tnfsf18
543 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	901
Count of miRNA genes:	475
Interacting mature miRNAs:	576
Transcripts:	ENSMUST00000086084
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCm39)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1301523	Ccrs1_m	corpus callosum hemisphere surface size 1 (mouse)			Not determined		1	139602037	173602216	Mouse
27226779	Tibl1_m	tibia length 1, 5 week (mouse)					1	95527725	162027569	Mouse
10412185	Hcs9_m	hepatocarcinogenesis susceptibility 9 (mouse)			Not determined		1	63854690	189303617	Mouse
12790987	Tgl5_m	triglyceride 5 (mouse)					1	160097157	194097157	Mouse
13824984	Twq5_m	testis weight QTL 5 (mouse)					1	3069992	184732197	Mouse
12790984	Pcho7_m	plasma cholesterol 7 (mouse)					1	147219390	181219390	Mouse
12790988	Phdlc5_m	plasma HDL cholesterol 5 (mouse)					9	160097157	194097157	Mouse
27226767	Tibl10_m	tibia length 10, 10 week (mouse)					1	121727729	164827569	Mouse
1300740	Tne1_m	total number errors (mouse)			Not determined		1	139602037	173602216	Mouse
12790996	Aath2_m	aortic arch atherosclerosis 2 (mouse)					1	145077630	179077630	Mouse
12791001	Aath6_m	aortic arch atherosclerosis 6 (mouse)					1	147219390	181219390	Mouse
1300745	Gvhd1_m	graft-versus-host disease 1 (mouse)			Not determined		1	157456299	191456436	Mouse
10412162	Nobq3_m	New Zealand obese QTL 3 (mouse)			Not determined		1	103933405	191225397	Mouse
4141346	Skmw12_m	skeletal muscle weight 12 (mouse)			Not determined			150756737	184756922	Mouse
1357618	Splq5_m	spleen weight QTL 5 (mouse)			Not determined		1	150193673	188359312	Mouse
1301301	Sle1_m	systemic lupus erythmatosus susceptibility 1 (mouse)			Not determined		1	152038741	186038913	Mouse
1301818	Ap1q_m	alcohol preference 1 QTL (mouse)			Not determined		1	146908199	167586222	Mouse
12904936	Edlmmq1_m	extensor digitorum longus muscle mass QTL 1 (mouse)					1	155002940	189002940	Mouse
4141075	Bmd1a_m	bone mineral density 1a (mouse)			Not determined		1	155837814	162145325	Mouse
1301565	Mnotch_m	modifier of Notch (mouse)			Not determined		1	157456299	191456436	Mouse
27226799	Feml5_m	femur length 5, 5 week (mouse)					1	122027729	164827569	Mouse
1301025	Lbw7_m	lupus NZB x NZW 7 (mouse)			Not determined		1	152038741	186038913	Mouse
12904944	Tammq1_m	tibialis anterior muscle mass QTL 1 (mouse)					1	155002940	189002940	Mouse
1357602	Vtbt2_m	vertebral trabecular bone trait 2 (mouse)			Not determined		1	139602037	173602216	Mouse
12904957	Gmmq1_m	gastrocnemius muscle mass QTL 1 (mouse)					1	155002940	189002940	Mouse
1300777	Chol10_m	cholesterol 10 (mouse)			Not determined		9	147875502	181875616	Mouse
1302098	Eila1_m	ethanol induced locomotor activity 1 (mouse)			Not determined		1	112008822	175468938	Mouse
1300823	Ath9_m	atherosclerosis 9 (mouse)			Not determined		1	160112768	194112883	Mouse
1300571	Opfa_m	open field activity (mouse)			Not determined		1	144531347	178531592	Mouse
4141165	Bglu3_m	blood glucose level 3 (mouse)			Not determined			155831765	189831892	Mouse
1357889	Lprq3_m	lipoprotein QTL 3 (mouse)			Not determined		1	152038741	186038913	Mouse
4141160	Cq1_m	cholesterol QTL 1 (mouse)			Not determined		1	139452188	173452308	Mouse
4142182	Shali5_m	survival time to hyperoxic acute lung injury 5 (mouse)			Not determined			155582237	185994196	Mouse
10402498	Lmr20_m	leishmaniasis resistance 20 (mouse)			Not determined		1	158468817	192468938	Mouse
1301619	Cafq1_m	caffeine metabolism QTL 1 (mouse)			Not determined		1	155716221	189716369	Mouse
4141149	Hbnr4_m	Heligmosomoides bakeri nematode resistance 4 (mouse)			Not determined			147125258	188983224	Mouse
10043899	Hdlq99_m	HDL QTL 99 (mouse)			Not determined		1	147875502	181875616	Mouse
1302128	Ity3_m	immunity to S. typhimurium 3 (mouse)			Not determined		11	131156308	165139464	Mouse
11537365	Cnes4_m	C. neoformans susceptibility locus 4 (mouse)					1	144449142	178449142	Mouse
11081167	Tir8_m	trypanosome infection response 8 (mouse)					1	155716221	189716369	Mouse
1302132	Pbw1_m	pentobarbital withdrawal QTL 1 (mouse)			Not determined		1	155831765	189831892	Mouse
1357434	Obsty1_m	obesity 1 (mouse)			Not determined		1	136209950	170210094	Mouse
4142159	Nba2_m	New Zealand Black autoimmunity 2 (mouse)			Not determined			151835111	185835280	Mouse
1301602	Bslm4_m	basal locomotor activity 4 (mouse)			Not determined		1	157456299	191456436	Mouse
1301866	Cplaq3_m	circadian period of locomotor activity 3 (mouse)			Not determined		1	155721528	189722608	Mouse
1300842	Sle9_m	systematic lupus erythematosus susceptibility 9 (mouse)			Not determined		1	158468817	192468938	Mouse
4142149	Ctex_m	Ctla4 expression QTL (mouse)			Not determined		1	153557406	175468938	Mouse
10449381	Actre11_m	activity response to ethanol 11 (mouse)					1	160284665	161840065	Mouse
1301608	Emo3_m	emotionality 3 (mouse)			Not determined		1	129130858	163130993	Mouse
1301614	Cgnz1_m	chronic glomerulonephritis in NZM 1 (mouse)			Not determined		1	152038741	186038913	Mouse
12910521	Scgq1_m	spontaneous crescentic glomerulonephritis QTL 1 (mouse)					1	156602037	176262693	Mouse
12910522	Scgq2_m	spontaneous crescentic glomerulonephritis QTL 2 (mouse)					1	147125258	171632257	Mouse
11039528	Ccc3_m	colitis susceptibility in the Collaborative Cross 3 (mouse)					1	3680142	195051546	Mouse
4142014	Wbcq5_m	white blood cell quantitative locus 5 (mouse)			Not determined		1	141095010	175095156	Mouse
4141245	Cq2_m	cholesterol QTL 2 (mouse)			Not determined		1	157456299	191456436	Mouse
4141244	Bmd5c_m	bone mineral density 5c (mouse)			Not determined			155526796	189526897	Mouse
14746980	Manh50_m	mandible shape 50 (mouse)					1	134131564	168131564	Mouse
13464138	Hdlq107_m	HDL QTL 107 (mouse)					1	152132744	186132744	Mouse
1301151	Hdlq14_m	HDL QTL 14 (mouse)			Not determined		1	142489543	176489734	Mouse
1301149	Lrnx12_m	learning-contextual 12 (mouse)			Not determined		1	112008822	168186402	Mouse
4141233	Femwf12_m	femur work to failure 12 (mouse)			Not determined			141233173	175233272	Mouse
1301122	Cd8mts1_m	CD8 T memory cell subset 1 (mouse)			Not determined		1	155831765	189831892	Mouse
1301632	Bw8q1_m	body weight at 8 weeks QTL 1 (mouse)			Not determined		1	161201261	195154279	Mouse
1301894	Skull2_m	skull morphology 2 (mouse)			Not determined		1	139602037	173602216	Mouse
1301385	Radpf2_m	radiation pulmonary fibrosis 2 (mouse)			Not determined		1	147125258	182873798	Mouse
1301134	Bmd1_m	bone mineral density 1 (mouse)			Not determined		1	156602037	189303617	Mouse
13452397	Leusq4_m	leucocytosis susceptibility QTL 4 (mouse)					1	156602037	170803640	Mouse
1357493	Lgaq3_m	late growth adjusted QTL 3 (mouse)			Not determined		1	150193673	188359312	Mouse
11251722	Ewc1_m	ethanol withdrawal and consumption 1 (mouse)					1	152132744	186132744	Mouse
1302193	Cpfd1_m	cerebellum pattern fissures (mouse)			Not determined		1	139602037	173602216	Mouse
10043963	Obq25_m	obesity QTL 25 (mouse)			Not determined		1	154410512	188410512	Mouse
13452393	Ity3b_m	immunity to S. typhimurium 3b (mouse)					1	156497439	172097436	Mouse
1301431	Pcho1_m	plasma cholesterol 1 (mouse)			Not determined		1	159262573	193262693	Mouse
13452394	Leusq1_m	leucocytosis susceptibility QTL 1 (mouse)					1	156602037	168186402	Mouse
1301408	Lore8_m	loss of righting induced by ethanol 8 (mouse)			Not determined		1	135877901	169878015	Mouse
10412074	Nhdlt1_m	non-HDL cholesterol and triglyceride levels 1 (mouse)			Not determined		1	153675990	187676105	Mouse
1357485	Lgq4_m	late growth QTL 4 (mouse)			Not determined		1	150193673	188359312	Mouse
1301932	Ssta2_m	susceptibility to Salmonella typhimurium antigens 2 (mouse)			Not determined		1	155716221	189716369	Mouse
27095901	Scvln8_m	sacral vertebrae length 2, 10 week (mouse)					1	94127725	172027567	Mouse
11049576	Lmr8a_m	leishmaniasis resistance 8a (mouse)					1	139602037	173602216	Mouse
1301458	Skts8_m	skin tumor susceptibility 8 (mouse)			Not determined		1	135794822	169795012	Mouse
1301202	Yaa4_m	Y-linked autoimmune acceleration 4 (mouse)			Not determined		1	158468817	192468938	Mouse
10054490	Opefa_m	open field activity (mouse)			Not determined		1	153712853	187712853	Mouse
1300948	Fglu2_m	fasting glucose 2 (mouse)			Not determined		1	157456299	191456436	Mouse
1301467	Pcir1_m	periosteal circumference 1 (mouse)			Not determined		1	141233173	175233272	Mouse
1301722	Cia9_m	collagen induced arthritis QTL 9 (mouse)			Not determined		1	45783900	189303617	Mouse
1300696	Bpq2_m	blood pressure QTL 2 (mouse)			Not determined		1	139602037	173602216	Mouse
11059556	Lmr20b_m	leishmaniasis resistance 20b (mouse)					1	158468817	192468938	Mouse
4141554	Cfmq1_m	cystic fibrosis modifier QTL 1 (mouse)			Not determined		1	152038741	186038913	Mouse
11059557	Lmr20a_m	leishmaniasis resistance 20a (mouse)					1	158468817	192468938	Mouse
11059558	Lmr20c_m	leishmaniasis resistance 20c (mouse)					1	158468817	192468938	Mouse
1301191	Stia1_m	serum transfer induced arthritis 1 (mouse)			Not determined		1	141233173	175233272	Mouse
1300934	Cfbw1_m	cystic fibrosis body weight 1 (mouse)			Not determined		1	145145207	179145325	Mouse
1301189	Lmr8_m	leishmaniasis resistance 8 (mouse)			Not determined		1	156602037	189303617	Mouse
1558720	Bpq8_m	blood pressure QTL 8 (mouse)			Not determined		1	143284665	177284803	Mouse
10766456	Sle21_m	systematic lupus erythematosus susceptibility 21 (mouse)					1	155831765	189831892	Mouse
1301710	Bmd5_m	bone mineral density 5 (mouse)			Not determined		1	139602037	173602216	Mouse
27095935	Ulnl5_m	ulna length 5, 10 week (mouse)					1	128727737	181327565	Mouse
1301232	Hcs7_m	hepatocarcinogenesis susceptibility 7 (mouse)			Not determined		1	156602037	168186402	Mouse
10054271	Nba9_m	New Zealand Black autoimmunity 9 (mouse)			Not determined		1	155525623	189527533	Mouse
10054270	Nba10_m	New Zealand Black autoimmunity 10 (mouse)			Not determined		1	152794822	186438620	Mouse
1357567	Nidd3k_m	Nidd3 on KK-A<y> (mouse)			Not determined		7	147125258	169038913	Mouse
4142291	Aec2_m	autoimmune exocrinopathy 2 (mouse)			Not determined			52457737	182250592	Mouse
1300732	Melm2_m	melanoma modifier 2 (mouse)			Not determined		1	157456299	191456436	Mouse
1301216	Cbm1_m	cerebellum weight 1 (mouse)			Not determined		1	157456299	191456436	Mouse
27095915	Scvln13_m	sacral vertebrae length 2, 16 week (mouse)					1	117527730	179827565	Mouse
11533913	Rd6m1_m	retinal degeneration 6 modifier 1 (mouse)					1	141233173	175233272	Mouse
26884448	Sklq1_m	skull length QTL 1, 5 week (mouse)					1	75976637	181327565	Mouse
1300969	Sluc5_m	susceptibility to lung cancer 5 (mouse)			Not determined		1	151186243	185186402	Mouse

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_183391	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC163268	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AJ577579	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AJ577580	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AJ577581	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY234223	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY267900	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY320040	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY359852	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC137814	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC137815	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466520	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CQ968991	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	LN874396	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSMUST00000086084 ⟹ ENSMUSP00000083251

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	1	161,322,224 - 161,332,859 (+)	Ensembl
GRCm38.p6 Ensembl	1	161,494,655 - 161,505,290 (+)	Ensembl

RefSeq Acc Id:

NM_183391 ⟹ NP_899247

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	1	161,322,221 - 161,333,903 (+)	NCBI
GRCm38	1	161,494,657 - 161,505,290 (+)	ENTREZGENE
MGSCv37	1	163,424,788 - 163,435,421 (+)	RGD
Celera	1	163,943,104 - 163,953,733 (+)	RGD
cM Map	1		ENTREZGENE

Sequence:

show sequence

TTGTGGGTATCTGCTTTCCCCAGTTCTCATTCCATCAGAGAACGAGTTCTAGCCTCATGGAGGA
AATGCCTTTGAGAGAATCAAGTCCTCAAAGGGCAGAGAGGTGCAAGAAGTCATGGCTCTTGTGC
ATAGTGGCTCTGTTACTGATGTTGCTCTGTTCTTTGGGTACACTGATCTATACTTCACTCAAGC
CAACTGCCATCGAGTCCTGCATGGTTAAGTTTGAACTATCATCCTCAAAATGGCACATGACATC
TCCCAAACCTCACTGTGTGAATACGACATCTGATGGGAAGCTGAAGATACTGCAGAGTGGCACA
TATTTAATCTACGGCCAAGTGATTCCTGTGGATAAGAAATACATAAAAGACAATGCCCCCTTCG
TAGTACAGATATATAAAAAGAATGATGTCCTACAAACTCTAATGAATGATTTTCAAATCTTGCC
TATAGGAGGGGTTTATGAACTGCATGCTGGAGATAACATATATCTGAAGTTCAACTCTAAAGAC
CATATTCAGAAAACTAACACATACTGGGGGATCATCTTAATGCCTGATCTACCATTCATCTCTT
AGAGATTGGGTTTGGTCTCCTCATCTTCTTCTTTGTATCCCGAGATGCTGGTGGGTGGGTTGGA
GGGGGATGATTGATGGCAATGCACACAGTTTGTGAGGGCTTACAAATTGACACAATCAGAGCCT
CTTGGCATATAAAATTTTAGCCCTCATATCTGTCTGAAGAGGACTCAGCAAATGGGCCAATCCC
TAATGTTGGGTCTGCAAATGGACTTGTACAATCCATGATAAAAAGGAGTATGGGCCACAGAAGA
CAGAAACTCTTCCAAAGAATGTCTTTCTAACCTTGATCCCTGGGTAGAATGAGATCCTGTTTCC
ATGGGAGTCTTACTTGGCTTGCAAAAAAGGGTGTAGGGCAGTAGCTTGGCCTTTTTTCCATCAT
AATTTCCTTGAGCTGTTTTACCTTAATCCCTCCAAACTCTCACCTTCTGAGAGCCTCCTAATGA
AACATTGTTAGACTGGTGGGGTGGCCAAGACATGCCAACAACACCCTTCTTTAGAGGTGGTGTT
TTTAGAGGACAGAGAACATTATGAAGCCTAGAGCAGCAGAGGTCAAGATGCCACGAAATGGAAT
TGATCTGGGAATTTTTTTTTTTTTTCATTCTCAGGATGCAGGTTCATTCTGAACTTTCCCCTAG
GCCTTCATTGCTTTTGTGTGTATGTGTGCATAAATTCTGCAAATAGAAAAATGAGAGTTTGCAC
CAGTACTCACTAGATTTAACACCAGAAAGTGGTACTTTTCTGGCTGTATTATGCCATGATAGCA
CATTTTCTGTTGGTGTTCCCTAACTGACAAGTATAACAGTTTTCCTAAACCACACAACAATGCT
ATGATGTTAATGGGGTAGATATTTTTGGAAAAAAATTGCACAGTGAGAACATGGGTAGATGAAC
CCTAAGACTCTTACCTCAATTCAGAACTCGCAAGGAGTTAAGTGAGTGGGGTCTTCATTAGACC
ATTCACATGGTCTCTGCTTTGAAACTGGCGTTGCTACTGTCTCATTATACATCACTAAAATGGA
ATTAACTCAACTTTGAAATGGATGCATCGACTTTACCCCAAGGTGTCCAGAATGAAGCTACAAG
ACTTTTACCAGCAGTCATTTTCCTTTTGCCTGGAGCAAGAAGATCCAGGATACTGTTGGAAGAG
TTCATCTCACTCAACCATGCTGACTTTCCAAAGTAATAATGAACATTTGTGTTCAAATTTTGGA
TTCTGTTAAATTTAGCCAGCTTGTGAGTTCTTGTCGAAAAGTATTTTAAACCAATTTACACTAT
TTATGGGTATTTGTGAAAAGCTATATAGTGATATTTTATATATAACTAATTTAAAATATTTTTA
TTTTATGTAACAAAAATACTATAGGCTAAGCTATTTCTTCTTATTTTTTTATGAATACTTGCTG
AATTGCCATAGGGCACAAAGACTCTTCTGTTTGCATATCTTCTCAGGAAATTAAAATTGTATCA
CATGTATTTATAAGAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_899247	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI37815	(Get FASTA)	NCBI Sequence Viewer
	AAI37816	(Get FASTA)	NCBI Sequence Viewer
	AAO89011	(Get FASTA)	NCBI Sequence Viewer
	AAP70494	(Get FASTA)	NCBI Sequence Viewer
	AAP96745	(Get FASTA)	NCBI Sequence Viewer
	AAQ55265	(Get FASTA)	NCBI Sequence Viewer
	CAE12166	(Get FASTA)	NCBI Sequence Viewer
	CAE12167	(Get FASTA)	NCBI Sequence Viewer
	CAI38636	(Get FASTA)	NCBI Sequence Viewer
	CTQ86161	(Get FASTA)	NCBI Sequence Viewer
	EDL39313	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSMUSP00000083251
	ENSMUSP00000083251.2
GenBank Protein	Q7TS55	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_899247 ⟸ NM_183391
- UniProtKB:	Q7TNY2 (UniProtKB/Swiss-Prot), Q80YG2 (UniProtKB/Swiss-Prot), Q7TS55 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MEEMPLRESSPQRAERCKKSWLLCIVALLLMLLCSLGTLIYTSLKPTAIESCMVKFELSSSKWH MTSPKPHCVNTTSDGKLKILQSGTYLIYGQVIPVDKKYIKDNAPFVVQIYKKNDVLQTLMNDFQ ILPIGGVYELHAGDNIYLKFNSKDHIQKTNTYWGIILMPDLPFIS hide sequence

Ensembl Acc Id:

ENSMUSP00000083251 ⟸ ENSMUST00000086084

Protein Domains

THD

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q7TS55-F1-model_v2	AlphaFold	Q7TS55	1-173	view protein structure

Promoters

RGD ID:

6875446

Promoter ID:

EPDNEW_M1174

Type:

multiple initiation site

Name:

Tnfsf18_1

Description:

Mus musculus tumor necrosis factor superfamily, member 18 , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	1	161,494,655 - 161,494,715	EPDNEW

RGD ID:

6818614

Promoter ID:

MM_KWN:2620

Type:

Non-CpG

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

Kidney

Transcripts:

ENSMUST00000086084, OTTMUST00000066639

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv36	1	163,424,476 - 163,424,976 (+)	MPROMDB

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	MGI:2673064	AgrOrtholog
Ensembl Genes	ENSMUSG00000066755	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000086084	ENTREZGENE
	ENSMUST00000086084.2	UniProtKB/Swiss-Prot
Gene3D-CATH	2.60.120.40	UniProtKB/Swiss-Prot
InterPro	TNF_dom	UniProtKB/Swiss-Prot
	TNFSF18	UniProtKB/Swiss-Prot
	Tumour_necrosis_fac-like_dom	UniProtKB/Swiss-Prot
KEGG Report	mmu:240873	UniProtKB/Swiss-Prot
MGD	MGI:2673064	ENTREZGENE
NCBI Gene	240873	ENTREZGENE
PANTHER	PTHR15267	UniProtKB/Swiss-Prot
	TUMOR NECROSIS FACTOR LIGAND SUPERFAMILY MEMBER 18	UniProtKB/Swiss-Prot
Pfam	TNF	UniProtKB/Swiss-Prot
PhenoGen	Tnfsf18	PhenoGen
PROSITE	THD_2	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF49842	UniProtKB/Swiss-Prot
UniProt	A0A0U5J3Y4_MOUSE	UniProtKB/TrEMBL
	Q7TNY2	ENTREZGENE
	Q7TS55	ENTREZGENE
	Q80YG2	ENTREZGENE
	TNF18_MOUSE	UniProtKB/Swiss-Prot
UniProt Secondary	Q7TNY2	UniProtKB/Swiss-Prot
	Q80YG2	UniProtKB/Swiss-Prot

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar

Mammalian Phenotype