Advanced Search (OLGA)

Gene: Fxr1 (FMR1 autosomal homolog 1) Rattus norvegicus

Analyze

Symbol:

Fxr1

Name:

FMR1 autosomal homolog 1

RGD ID:

1311733

Description:

Predicted to enable several functions, including RNA binding activity; molecular condensate scaffold activity; and protein dimerization activity. Predicted to be involved in several processes, including modulation of chemical synaptic transmission; nucleus organization; and regulation of gene expression. Predicted to act upstream of or within cytoplasmic translational initiation. Predicted to be located in several cellular components, including costamere; dendritic spine; and ribosome. Predicted to be active in several cellular components, including cytoplasmic stress granule; glutamatergic synapse; and nuclear envelope. Human ortholog(s) of this gene implicated in congenital myopathy 9A and congenital myopathy 9B. Orthologous to human FXR1 (FMR1 autosomal homolog 1); INTERACTS WITH 2,3,7,8-Tetrachlorodibenzofuran; 2,6-dinitrotoluene; acrylamide.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

fragile X mental retardation gene 1, autosomal homolog; fragile X mental retardation syndrome-related protein 1; fragile X mental retardation, autosomal homolog 1; Fxr1h; LOC100366044; LOC361927; rCG41429-like; RNA-binding protein FXR1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	FXR1 (FMR1 autosomal homolog 1)	RGD	RGD
Mus musculus (house mouse):	Fxr1 (FMR1 autosomal homolog 1)	RGD	RGD
Chinchilla lanigera (long-tailed chinchilla):	Fxr1 (FMR1 autosomal homolog 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	FXR1 (FMR1 autosomal homolog 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	FXR1 (FMR1 autosomal homolog 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Fxr1 (FMR1 autosomal homolog 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	FXR1 (FMR1 autosomal homolog 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	FXR1 (FMR1 autosomal homolog 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Fxr1 (FMR1 autosomal homolog 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	FXR1 (FMR1 autosomal homolog 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Fxr1 (FMR1 autosomal homolog 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	fxr1 (fragile X mental retardation, autosomal homolog 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Fmr1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Fmr1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	T10E9.14	Alliance	DIOPT (OrthoFinder\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	fxr1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Related Pseudogenes:

Fxr1-ps1

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	118,812,287 - 118,865,813 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	118,811,980 - 118,867,027 (+)	Ensembl				GRCr8
mRatBN7.2	2	116,884,167 - 116,937,590 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	116,884,248 - 116,937,590 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	123,473,867 - 123,526,115 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	121,586,534 - 121,638,784 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	116,215,601 - 116,266,541 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	120,529,716 - 120,570,356 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	120,512,899 - 120,570,355 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	140,165,289 - 140,213,149 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	120,330,045 - 120,378,482 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	111,923,546 - 111,975,799 (+)	NCBI		Celera
RGSC_v3.1	2	120,275,008 - 120,323,418 (+)	NCBI
Cytogenetic Map	2	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

3-methylglutaconic aciduria type 5 (ISO)

congenital myopathy (ISO)

congenital myopathy 1B (ISO)

congenital myopathy 9A (ISO)

congenital myopathy 9B (ISO)

Currarino syndrome (ISO)

intellectual disability (ISO)

scoliosis (ISO)

syndromic microphthalmia 3 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2,4,6-tribromophenol (ISO)

2,6-dinitrotoluene (EXP)

2-hydroxypropanoic acid (ISO)

2-methylcholine (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

4,4'-sulfonyldiphenol (ISO)

acrylamide (EXP,ISO)

alpha-Zearalanol (EXP)

amphotericin B (ISO)

aristolochic acid A (ISO)

Aroclor 1254 (ISO)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

Brodifacoum (EXP)

caffeine (ISO)

carbon nanotube (ISO)

cisplatin (ISO)

cobalt dichloride (EXP,ISO)

copper(II) sulfate (ISO)

coumarin (ISO)

decabromodiphenyl ether (ISO)

Dibutyl phosphate (ISO)

dicrotophos (ISO)

dieldrin (EXP)

dioxygen (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

elemental selenium (ISO)

entinostat (ISO)

enzyme inhibitor (ISO)

ethanol (ISO)

finasteride (EXP)

flutamide (EXP)

folic acid (ISO)

FR900359 (ISO)

furan (EXP)

glafenine (EXP)

glufosinate (ISO)

hydrogen peroxide (ISO)

ivermectin (ISO)

methylmercury chloride (ISO)

Monobutylphthalate (EXP)

N-methyl-4-phenylpyridinium (ISO)

nefazodone (EXP)

ochratoxin A (ISO)

paracetamol (ISO)

perfluorooctanoic acid (EXP)

phenethyl isothiocyanate (EXP)

pirinixic acid (ISO)

potassium dichromate (ISO)

quercetin (ISO)

rac-lactic acid (ISO)

resveratrol (ISO)

SB 431542 (ISO)

selenium atom (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

testosterone enanthate (ISO)

tetrachloromethane (ISO)

thiram (ISO)

titanium dioxide (ISO)

triptonide (ISO)

troglitazone (ISO)

urethane (ISO)

valproic acid (ISO)

vinclozolin (EXP)

vitamin E (ISO)

zinc atom (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

animal organ development (IBA)

cell differentiation (IEA)

cytoplasmic translational initiation (ISO)

dentate gyrus development (IEA,ISO,ISS)

membraneless organelle assembly (ISO,ISS)

mRNA destabilization (ISO,ISS)

mRNA transport (IBA)

muscle organ development (IEA,ISO,ISS)

muscle structure development (IEA)

negative regulation of gene expression (IEA)

negative regulation of inflammatory response (ISO,ISS)

negative regulation of long-term synaptic potentiation (ISO,ISS)

negative regulation of mRNA catabolic process (ISO)

negative regulation of translation (ISO,ISS)

negative regulation of tumor necrosis factor production (ISO,ISS)

nuclear pore complex assembly (ISO,ISS)

nuclear pore localization (ISO,ISS)

positive regulation of long-term neuronal synaptic plasticity (IBA)

positive regulation of miRNA-mediated gene silencing (ISO,ISS)

positive regulation of Rho protein signal transduction (ISO)

positive regulation of translation (IBA,ISO,ISS)

post-transcriptional regulation of gene expression (IEA,ISO,ISS)

regulation of circadian sleep/wake cycle, sleep (ISO,ISS)

regulation of mRNA stability (IBA)

regulation of neurogenesis (ISO,ISS)

regulation of synaptic transmission, glutamatergic (ISO,ISS)

regulation of translation (IEA)

regulation of translation at presynapse, modulating synaptic transmission (IBA)

skeletal muscle organ development (ISO)

spermatid development (ISO,ISS)

spermatogenesis (IEA)

Cellular Component

axon (IEA,ISO)

cell projection (IEA)

costamere (ISO)

cytoplasm (IEA,ISO,ISS)

cytoplasmic ribonucleoprotein granule (IEA,ISO,ISS)

cytoplasmic stress granule (IBA,IEA,ISO)

cytosol (ISO)

dendrite (IEA,ISO)

dendritic spine (IEA,ISO)

glutamatergic synapse (IEA,ISO)

neuron projection (IBA)

nuclear envelope (IEA,ISO,ISS)

nucleus (IBA,IEA,ISO)

perinuclear region of cytoplasm (ISO)

postsynapse (IEA,ISO)

presynapse (IEA)

ribonucleoprotein granule (ISO)

ribosome (IEA,ISO)

synapse (IEA)

Molecular Function

molecular condensate scaffold activity (ISO,ISS)

mRNA 3'-UTR AU-rich region binding (ISO,ISS)

mRNA 3'-UTR binding (IBA,ISO)

mRNA binding (IEA,ISO,ISS)

nucleic acid binding (IEA)

protein binding (ISO)

protein heterodimerization activity (ISO,ISS)

protein homodimerization activity (ISO,ISS)

ribonucleoprotein complex binding (ISO)

RNA binding (IEA,ISO)

RNA strand annealing activity (ISO,ISS)

translation regulator activity (IBA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	GOA pipeline	RGD automated data pipeline
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:7489725	PMID:11178106	PMID:12477932	PMID:15128702	PMID:15489334	PMID:15548538	PMID:17057366	PMID:17170008	PMID:19946888	PMID:22022532	PMID:22658674	PMID:22681889
PMID:27770568	PMID:29101288	PMID:29476059	PMID:30361391	PMID:31831836	PMID:32333305

Genomics

Comparative Map Data

Fxr1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	118,812,287 - 118,865,813 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	118,811,980 - 118,867,027 (+)	Ensembl				GRCr8
mRatBN7.2	2	116,884,167 - 116,937,590 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	116,884,248 - 116,937,590 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	123,473,867 - 123,526,115 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	121,586,534 - 121,638,784 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	116,215,601 - 116,266,541 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	120,529,716 - 120,570,356 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	120,512,899 - 120,570,355 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	140,165,289 - 140,213,149 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	120,330,045 - 120,378,482 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	111,923,546 - 111,975,799 (+)	NCBI		Celera
RGSC_v3.1	2	120,275,008 - 120,323,418 (+)	NCBI
Cytogenetic Map	2	q24	NCBI

FXR1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	180,912,670 - 180,982,753 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	180,868,141 - 180,982,753 (+)	Ensembl			hg38	GRCh38
GRCh37	3	180,630,458 - 180,700,541 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	182,113,146 - 182,177,644 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	3	182,113,163 - 182,177,036	NCBI
Celera	3	179,062,664 - 179,132,978 (+)	NCBI		Celera
Cytogenetic Map	3	q26.33	NCBI
HuRef	3	178,034,321 - 178,104,537 (+)	NCBI		HuRef
CHM1_1	3	180,593,505 - 180,663,825 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	3	183,714,436 - 183,784,535 (+)	NCBI		T2T-CHM13v2.0

Fxr1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	34,074,133 - 34,124,129 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	34,074,092 - 34,124,471 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	3	34,020,058 - 34,069,980 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	34,019,943 - 34,070,322 (+)	Ensembl			mm10	GRCm38
MGSCv37	3	33,919,001 - 33,968,267 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	3	34,211,657 - 34,260,887 (+)	NCBI		MGSCv36	mm8
Celera	3	33,916,172 - 33,965,473 (+)	NCBI		Celera
Cytogenetic Map	3	A3	NCBI
cM Map	3	16.41	NCBI

Fxr1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955420	9,903,736 - 9,966,100 (+)	Ensembl
ChiLan1.0	NW_004955420	9,903,736 - 9,966,100 (+)	NCBI	ChiLan1.0	ChiLan1.0

FXR1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	178,783,206 - 178,848,482 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	178,787,916 - 178,853,817 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	177,948,040 - 178,012,705 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	186,119,331 - 186,187,126 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2

FXR1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	34	14,129,978 - 14,192,016 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	34	14,130,017 - 14,191,370 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	34	18,212,277 - 18,274,019 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	34	14,031,339 - 14,093,392 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	34	14,031,378 - 14,093,391 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	34	14,077,460 - 14,139,011 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	34	14,059,493 - 14,121,524 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	34	14,303,530 - 14,365,583 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Fxr1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	110,795,745 - 110,866,441 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936566	2,354,441 - 2,425,176 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936566	2,354,301 - 2,425,140 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

FXR1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	118,839,338 - 118,900,136 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	13	118,839,314 - 118,899,804 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	128,089,495 - 128,175,102 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

FXR1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	15	8,420,789 - 8,486,681 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	15	8,421,654 - 8,486,384 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666063	17,252,536 - 17,318,234 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Fxr1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624730	58,680,030 - 58,743,229 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624730	58,679,945 - 58,743,688 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Variants

Variants in Fxr1
120 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	13
Count of miRNA genes:	13
Interacting mature miRNAs:	13
Transcripts:	ENSRNOT00000074060
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578648	Bss11	Bone structure and strength QTL 11	4.7		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	2	114837527	211674221	Rat
2293671	Bss44	Bone structure and strength QTL 44	10.97	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	2	43162366	148478373	Rat
631566	Bp90	Blood pressure QTL 90		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	102803808	147803808	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
1598865	Bp296	Blood pressure QTL 296	2.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	81018907	126018907	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118463	226797303	Rat
1578772	Stresp14	Stress response QTL 14	5	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	2	82345893	130923501	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	81754530	227146641	Rat
10755499	Bp389	Blood pressure QTL 389	2.61		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	18960362	228801039	Rat
152025242	Bw191	Body weight QTL 191	3.62		body mass (VT:0001259)		2	38573329	122609194	Rat
1598862	Glom9	Glomerulus QTL 9	3.5		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	2	92337601	137337601	Rat
631198	Cm22	Cardiac mass QTL 22	4.3	0.0008	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	76539322	150540526	Rat
1598863	Cm65	Cardiac mass QTL 65	2.3		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	92337601	137337601	Rat
1554319	Bmd2	Bone mineral density QTL 2	13.4	0.0001	lumbar vertebra area (VT:0010570)	lumbar vertebra cross-sectional area (CMO:0001689)	2	114837675	212549332	Rat
1302794	Stl27	Serum triglyceride level QTL 27	4.4	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	2	25413423	143657569	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	78665619	219826953	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	43154682	202446871	Rat
1358901	Cm38	Cardiac mass QTL 38	2		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	157142209	Rat
1359030	Bp277	Blood pressure QTL 277			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	114837527	185876470	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	56043031	202447032	Rat
2300165	Bmd49	Bone mineral density QTL 49	4.8	0.0001	lumbar vertebra mineral mass (VT:0010511)	bone mineral density (CMO:0001226)	2	88862519	133862519	Rat
1358899	Kidm23	Kidney mass QTL 23	3.88		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358908	Bw49	Body weight QTL 49	3.36		body mass (VT:0001259)	body weight (CMO:0000012)	2	25413652	157142078	Rat
2300170	Bmd45	Bone mineral density QTL 45	12.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	2	88862519	133862519	Rat
1358910	Kidm27	Kidney mass QTL 27	5.77		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358911	Kidm28	Kidney mass QTL 28	5.42		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358904	Cm39	Cardiac mass QTL 39	2.26		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	157142209	Rat
1359035	Bp276	Blood pressure QTL 276			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	114837527	143657569	Rat
8662836	Vetf8	Vascular elastic tissue fragility QTL 8	0.66		thoracic aorta molecular composition trait (VT:0010568)	aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003)	2	104559726	149559726	Rat
1358887	Bw50	Body weight QTL 50	2.39		body mass (VT:0001259)	body weight (CMO:0000012)	2	25413652	157142078	Rat
1298080	Bp163	Blood pressure QTL 163		0.02	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118275	202447032	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	81689826	221035911	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
2290453	Scl55	Serum cholesterol level QTL 55	2.83		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	2	26917817	136917119	Rat
2299162	Iddm32	Insulin dependent diabetes mellitus QTL 32	2.36		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	2	78665616	143657569	Rat
1358894	Kidm24	Kidney mass QTL 24	4.03		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
2300185	Bmd46	Bone mineral density QTL 46	8.4	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	2	88862519	133862519	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	78665619	249053267	Rat
61374	Edpm2	Estrogen-dependent pituitary mass QTL 2	4.42	0.86	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	76539322	202447032	Rat
634308	Sach6	Saccharin preference QTL 6	4.9		taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	2	112456140	212696837	Rat
61392	Bp6	Blood pressure QTL 6	7		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	2	80270434	125270434	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
631507	Bp105	Blood pressure QTL 105		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	112456140	212696837	Rat
2293835	Kiddil5	Kidney dilation QTL 5	3.8		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	42804607	157142209	Rat
1581552	Pur12	Proteinuria QTL 12	5.19	0.0009	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	2	112103657	148076632	Rat
1558653	Prcr1	Prostate cancer resistance QTL 1	5		prostate integrity trait (VT:0010571)	area of ventral prostate occupied by tumorous lesions to total ventral prostate area ratio (CMO:0000899)	2	72532993	157142209	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	81754530	222436696	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	46123260	202447032	Rat
7207808	Bmd89	Bone mineral density QTL 89	4.1		femur strength trait (VT:0010010)	femoral neck ultimate force (CMO:0001703)	2	88862519	133862519	Rat
1558648	Smcn1	Smooth muscle cell number QTL 1		0.039	blood vessel smooth muscle cell quantity (VT:0010525)	aorta smooth muscle cell count per unit vessel length (CMO:0001646)	2	59134147	127460910	Rat
2293843	Kiddil6	Kidney dilation QTL 6	3.1		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	42804607	182042367	Rat
1354594	Despr10	Despair related QTL 10		2e-06	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	2	114654253	159654253	Rat
152025206	Hrtrt23	Heart rate QTL 23	5.98		heart pumping trait (VT:2000009)		2	28484589	169504100	Rat
1354605	Rf48	Renal function QTL 48	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	2	74786664	206665859	Rat
152025204	Hrtrt22	Heart rate QTL 22	5.6		heart pumping trait (VT:2000009)		2	28484589	169504100	Rat
1354601	Slep1	Serum leptin concentration QTL 1	5.39		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	2	43171017	184114403	Rat
61438	Cia7	Collagen induced arthritis QTL 7	4.6	0.0001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	2	59324377	141596857	Rat
1354603	Bp243	Blood pressure QTL 243	3.9		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	26917817	127469484	Rat

Markers in Region

RH123299

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Rnor_5.0	2	140,184,741 - 140,185,213	NCBI	Rnor5.0
RGSC_v3.4	2	120,358,866 - 120,359,337	UniSTS	RGSC3.4
Celera	2	111,952,036 - 111,952,507	UniSTS
Cytogenetic Map	2	q25	UniSTS

RH132222

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	116,932,491 - 116,932,685 (-)	MAPPER	mRatBN7.2
Rnor_6.0	2	120,516,718 - 120,516,911	NCBI	Rnor6.0
Rnor_5.0	2	140,162,560 - 140,162,753	UniSTS	Rnor5.0
RGSC_v3.4	2	120,379,472 - 120,379,665	UniSTS	RGSC3.4
Celera	2	111,971,786 - 111,971,979	UniSTS
RH 3.4 Map	2	683.6	UniSTS
Cytogenetic Map	2	q25	UniSTS

X90875

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Rnor_5.0	2	140,158,874 - 140,159,032	UniSTS	Rnor5.0
Rnor_5.0	2	140,165,423 - 140,165,581	UniSTS	Rnor5.0
Celera	2	111,975,507 - 111,975,665	UniSTS
Cytogenetic Map	2	q25	UniSTS

RH139070

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	116,924,570 - 116,924,704 (-)	MAPPER	mRatBN7.2
Rnor_6.0	2	120,530,350 - 120,530,483	NCBI	Rnor6.0
Rnor_5.0	2	140,173,143 - 140,173,276	UniSTS	Rnor5.0
Celera	2	111,963,863 - 111,963,996	UniSTS
RH 3.4 Map	2	684.9	UniSTS
Cytogenetic Map	2	q25	UniSTS

BI274570

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	116,935,372 - 116,936,240 (-)	MAPPER	mRatBN7.2
Rnor_6.0	2	120,519,947 - 120,520,151	NCBI	Rnor6.0
Rnor_6.0	2	120,513,163 - 120,514,030	NCBI	Rnor6.0
Rnor_5.0	2	140,159,005 - 140,159,872	UniSTS	Rnor5.0
Rnor_5.0	2	140,165,554 - 140,165,758	UniSTS	Rnor5.0
Celera	2	111,974,667 - 111,975,534	UniSTS
RH 3.4 Map	1	16.7	UniSTS
Cytogenetic Map	2	q25	UniSTS

BI281166

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Rnor_6.0	2	120,520,007 - 120,520,204	NCBI	Rnor6.0
Rnor_5.0	2	140,165,614 - 140,165,811	UniSTS	Rnor5.0
RH 3.4 Map	1	16.7	UniSTS
Cytogenetic Map	2	q25	UniSTS

UniSTS:479111

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Rnor_6.0	2	120,520,193 - 120,520,822	NCBI	Rnor6.0
Rnor_5.0	2	140,165,800 - 140,166,429	UniSTS	Rnor5.0
Cytogenetic Map	2	q25	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001012179	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001415068	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001415069	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001415070	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001415071	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039102584	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282053	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282054	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282055	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282057	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282058	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282059	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC083807	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC099129	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MG938503	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000088442 ⟹ ENSRNOP00000069834

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	118,834,094 - 118,860,422 (+)	Ensembl
mRatBN7.2 Ensembl	2	116,884,257 - 116,936,504 (+)	Ensembl
Rnor_6.0 Ensembl	2	120,512,899 - 120,570,355 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000101775 ⟹ ENSRNOP00000084548

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	118,812,479 - 118,865,813 (+)	Ensembl
mRatBN7.2 Ensembl	2	116,884,248 - 116,937,590 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000102612 ⟹ ENSRNOP00000095711

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	118,811,980 - 118,865,813 (+)	Ensembl
mRatBN7.2 Ensembl	2	116,884,251 - 116,936,347 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000103508 ⟹ ENSRNOP00000081168

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	118,811,980 - 118,865,813 (+)	Ensembl
mRatBN7.2 Ensembl	2	116,884,248 - 116,937,590 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000117973 ⟹ ENSRNOP00000084892

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	118,812,343 - 118,861,113 (+)	Ensembl
mRatBN7.2 Ensembl	2	116,905,868 - 116,932,847 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000121093 ⟹ ENSRNOP00000110312

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	118,812,478 - 118,867,027 (+)	Ensembl

RefSeq Acc Id:

NM_001012179 ⟹ NP_001012179

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	118,812,479 - 118,865,813 (+)	NCBI
mRatBN7.2	2	116,884,250 - 116,937,590 (+)	NCBI
Rnor_6.0	2	120,529,716 - 120,570,356 (-)	NCBI
Rnor_5.0	2	140,165,289 - 140,213,149 (-)	NCBI
RGSC_v3.4	2	120,330,045 - 120,378,482 (+)	RGD
Celera	2	111,923,546 - 111,975,799 (+)	NCBI

Sequence:

show sequence

TTCCAACATGGCGGAGCTGACGGTGGAGGTTCGCGGCTCCAACGGGGCTTTCTACAAGGTATTT
ATCAAAGATGTCCACGAAGACTCCCTCACAGTTGTTTTTGAAAATAATTGGCAACCAGAACGCC
AGGTTCCGTTTAATGAAGTTCGATTACCACCACCACCTGATATAAAAAAAGAAATTAGTGAAGG
AGATGAAGTAGAGGTATATTCAAGAGCAAATGACCAAGAACCATGTGGATGGTGGCTGGCTAAA
GTTCGGATGATGAAAGGCGAGTTTTATGTCATTGAATATGCTGCTTGTGATGCCACTTACAATG
AAATAGTCACATTTGAACGACTTCGGCCTGTCAATCAAAATAAAACTGTCAAAAAAAATACCTT
CTTTAAGTGCACAGTGGATGTTCCTGAGGATTTGAGAGAAGCGTGTGCTAATGAAAATGCCCAT
AAAGATTTCAAGAAAGCAGTAGGAGCGTGCAGAATTTTCTATCATCCTGAAACTACCCAGCTAA
TGATACTGTCGGCCAGTGAAGCAACTGTGAAGAGAGTAAATATCTTAAGTGATATGCATTTGCG
AAGTATTCGGACGAAGTTGATGCTTATGTCCAGAAATGAAGAGGCCACTAAGCATTTAGAATGC
ACAAAACAGCTTGCAGCAGCTTTTCATGAAGAATTTGTTGTGAGAGAAGATCTAATGGGCCTGG
CAATAGGAACGCATGGTAGTAACATACAGCAAGCTAGGAAGGTCCCTGGAGTTACTGCCATTGA
GTTAGATGAAGATACTGGAACGTTTAGAATCTACGGAGAGAGTGCTGAGGCTGTAAAGAAAGCA
AGAGGTTTCTTGGAATTTGTGGAAGATTTTATTCAAGTTCCCAGGAATCTTGTTGGAAAAGTTA
TTGGAAAAAATGGCAAAGTTATTCAAGAAATAGTGGATAAATCTGGTGTGGTTCGAGTAAGAAT
TGAAGGAGACAATGAAAATAAACTACCTAGAGAAGATGGAATGGTTCCATTTGTATTTGTTGGC
ACTAAAGAAAGTATTGGAAATGTGCAAGTTCTTCTAGAGTATCACATTGCTTACTTAAAGGAAG
TGGAACAACTAAGAATGGAACGCCTGCAGATCGATGAACAGCTGCGACAGATTGGTATGGGTTT
CAGACCTTCTTCCACCAGAGGGCCTGAAAAAGAGAAAGGATATGCCACTGATGAAAGTACCGTC
TCTTCTGTACAAGGTTCTAGGTCTTATAGTGGAAGAGGCAGAGGTCGTCGGGGCCCTAATTACA
CCTCCGGTTATGGTACAAATTCTGAGCTGTCTAACCCCTCCGAAACAGAATCTGAGCGTAAAGA
TGAGCTGAGTGATTGGTCATTGGCAGGAGAAGATGATCGAGAGACTCGACATCAGCGAGACAGC
AGGAGACGCCCAGGAGGAAGAGGCAGAAGTGTTTCTGGGGGACGAGGTCGTGGTGGACCACGTG
GTGGCAAATCCTCCATCAGTTCTGTGCTCAAAGATCCAGACAGCAATCCATACAGCTTACTTGA
TAATACAGAATCAGATCAGACTGCAGACACTGACGCCAGCGAATCTCACCACAGTACTAACCGT
CGTAGGCGGTCTCGTAGACGAAGGACTGATGAAGATGCTGTTCTGATGGATGGAATGACTGAAT
CTGATACAGCCTCAGTTAATGAGAATGGGCTAGGCAAAAGATGTGATTGAAGAGCATGGTCCAT
CAGAAAAGGCAATAAATGGTCCAACTAGCGCTTCTGGCGATGAAATTCCTAAGCTACCGCGTAC
TCCAGGAGAAGAAAAGACTAAAACCTTAAAAGAAGAGAGCACTCAAGAAGCAGCAGTCCTGAAT
GGTGTTTCATAACTGAAGGAAGTTCCTAGTTTACAGTTCTTTTACATTACAGTTACAATAGTGC
TTGTACAAGCTTGCCAAAGATAGAATACGGATCGCCAGTCTTACATCGCACTTTCAGTTCCTCC
ATTTGGAATTCAGAAAGGGGAGGGATCCTGACGAAATCATATGTTAAACATACTTTGACACCTA
CTGTGTTAAAAATATATCATCAGATGTGCCTTGAGAATAGTATATGTAACATTAAAAAAAAGTT
GCTGGCTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

NM_001415068 ⟹ NP_001401997

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	118,812,479 - 118,865,813 (+)	NCBI
mRatBN7.2	2	116,884,250 - 116,937,590 (+)	NCBI

RefSeq Acc Id:

NM_001415069 ⟹ NP_001401998

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	118,812,479 - 118,865,813 (+)	NCBI
mRatBN7.2	2	116,884,250 - 116,937,590 (+)	NCBI

RefSeq Acc Id:

NM_001415070 ⟹ NP_001401999

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	118,812,479 - 118,865,813 (+)	NCBI
mRatBN7.2	2	116,884,250 - 116,937,590 (+)	NCBI

RefSeq Acc Id:

NM_001415071 ⟹ NP_001402000

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	118,812,479 - 118,865,813 (+)	NCBI
mRatBN7.2	2	116,884,250 - 116,937,590 (+)	NCBI

RefSeq Acc Id:

XM_039102584 ⟹ XP_038958512

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	118,812,320 - 118,865,353 (+)	NCBI
mRatBN7.2	2	116,884,167 - 116,937,586 (+)	NCBI

RefSeq Acc Id:

XM_063282053 ⟹ XP_063138123

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	118,813,263 - 118,865,353 (+)	NCBI

RefSeq Acc Id:

XM_063282054 ⟹ XP_063138124

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	118,812,287 - 118,865,353 (+)	NCBI

RefSeq Acc Id:

XM_063282055 ⟹ XP_063138125

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	118,813,263 - 118,865,353 (+)	NCBI

RefSeq Acc Id:

XM_063282057 ⟹ XP_063138127

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	118,842,850 - 118,865,353 (+)	NCBI

RefSeq Acc Id:

XM_063282058 ⟹ XP_063138128

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	118,812,320 - 118,848,436 (+)	NCBI

RefSeq Acc Id:

XM_063282059 ⟹ XP_063138129

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	118,812,320 - 118,848,492 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001012179	(Get FASTA)	NCBI Sequence Viewer
	NP_001401997	(Get FASTA)	NCBI Sequence Viewer
	NP_001401998	(Get FASTA)	NCBI Sequence Viewer
	NP_001401999	(Get FASTA)	NCBI Sequence Viewer
	NP_001402000	(Get FASTA)	NCBI Sequence Viewer
	XP_038958512	(Get FASTA)	NCBI Sequence Viewer
	XP_063138123	(Get FASTA)	NCBI Sequence Viewer
	XP_063138124	(Get FASTA)	NCBI Sequence Viewer
	XP_063138125	(Get FASTA)	NCBI Sequence Viewer
	XP_063138127	(Get FASTA)	NCBI Sequence Viewer
	XP_063138128	(Get FASTA)	NCBI Sequence Viewer
	XP_063138129	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH83807	(Get FASTA)	NCBI Sequence Viewer
	AYN77819	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000081168
	ENSRNOP00000084548
	ENSRNOP00000110312
GenBank Protein	Q5XI81	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001012179 ⟸ NM_001012179
- Peptide Label:	isoform 4
- UniProtKB:	Q5XI81 (UniProtKB/Swiss-Prot), A0A3G2LW22 (UniProtKB/TrEMBL), A0A0G2JWD2 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAELTVEVRGSNGAFYKVFIKDVHEDSLTVVFENNWQPERQVPFNEVRLPPPPDIKKEISEGDE VEVYSRANDQEPCGWWLAKVRMMKGEFYVIEYAACDATYNEIVTFERLRPVNQNKTVKKNTFFK CTVDVPEDLREACANENAHKDFKKAVGACRIFYHPETTQLMILSASEATVKRVNILSDMHLRSI RTKLMLMSRNEEATKHLECTKQLAAAFHEEFVVREDLMGLAIGTHGSNIQQARKVPGVTAIELD EDTGTFRIYGESAEAVKKARGFLEFVEDFIQVPRNLVGKVIGKNGKVIQEIVDKSGVVRVRIEG DNENKLPREDGMVPFVFVGTKESIGNVQVLLEYHIAYLKEVEQLRMERLQIDEQLRQIGMGFRP SSTRGPEKEKGYATDESTVSSVQGSRSYSGRGRGRRGPNYTSGYGTNSELSNPSETESERKDEL SDWSLAGEDDRETRHQRDSRRRPGGRGRSVSGGRGRGGPRGGKSSISSVLKDPDSNPYSLLDNT ESDQTADTDASESHHSTNRRRRSRRRRTDEDAVLMDGMTESDTASVNENGLGKRCD hide sequence

Ensembl Acc Id:

ENSRNOP00000069834 ⟸ ENSRNOT00000088442

RefSeq Acc Id:	XP_038958512 ⟸ XM_039102584
- Peptide Label:	isoform X2
- UniProtKB:	Q5XI81 (UniProtKB/Swiss-Prot)

Ensembl Acc Id:

ENSRNOP00000084892 ⟸ ENSRNOT00000117973

Ensembl Acc Id:

ENSRNOP00000081168 ⟸ ENSRNOT00000103508

Ensembl Acc Id:

ENSRNOP00000084548 ⟸ ENSRNOT00000101775

Ensembl Acc Id:

ENSRNOP00000095711 ⟸ ENSRNOT00000102612

RefSeq Acc Id:	NP_001401997 ⟸ NM_001415068
- Peptide Label:	isoform 1
- UniProtKB:	Q5XI81 (UniProtKB/Swiss-Prot), A0A8I6AM03 (UniProtKB/TrEMBL), A6IHT2 (UniProtKB/TrEMBL)

RefSeq Acc Id:	NP_001401998 ⟸ NM_001415069
- Peptide Label:	isoform 2
- UniProtKB:	Q5XI81 (UniProtKB/Swiss-Prot)

RefSeq Acc Id:	NP_001401999 ⟸ NM_001415070
- Peptide Label:	isoform 3
- UniProtKB:	Q5XI81 (UniProtKB/Swiss-Prot), A0A8I5ZRV6 (UniProtKB/TrEMBL), A6IHT3 (UniProtKB/TrEMBL)

RefSeq Acc Id:	NP_001402000 ⟸ NM_001415071
- Peptide Label:	isoform 5
- UniProtKB:	Q5XI81 (UniProtKB/Swiss-Prot), A6IHT4 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063138124 ⟸ XM_063282054
- Peptide Label:	isoform X3
- UniProtKB:	Q5XI81 (UniProtKB/Swiss-Prot)

RefSeq Acc Id:	XP_063138129 ⟸ XM_063282059
- Peptide Label:	isoform X6

RefSeq Acc Id:	XP_063138128 ⟸ XM_063282058
- Peptide Label:	isoform X6

RefSeq Acc Id:	XP_063138123 ⟸ XM_063282053
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_063138125 ⟸ XM_063282055
- Peptide Label:	isoform X4

RefSeq Acc Id:	XP_063138127 ⟸ XM_063282057
- Peptide Label:	isoform X5

Ensembl Acc Id:

ENSRNOP00000110312 ⟸ ENSRNOT00000121093

Protein Domains

Agenet-like KH

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5XI81-F1-model_v2	AlphaFold	Q5XI81	1-568	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1311733	AgrOrtholog
BioCyc Gene	G2FUF-53396	BioCyc
Ensembl Genes	ENSRNOG00000051480	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000101775	ENTREZGENE
	ENSRNOT00000103508	ENTREZGENE
	ENSRNOT00000121093	ENTREZGENE
Gene3D-CATH	2.30.30.140	UniProtKB/Swiss-Prot
	3.30.1370.10	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7109902	IMAGE-MGC_LOAD
InterPro	Agenet-like_dom	UniProtKB/Swiss-Prot
	FMR1	UniProtKB/Swiss-Prot
	FMRP_KH0	UniProtKB/Swiss-Prot
	FXMRP1_C_core	UniProtKB/Swiss-Prot
	FXR_C1	UniProtKB/Swiss-Prot
	KH_dom	UniProtKB/Swiss-Prot
	KH_dom_type_1	UniProtKB/Swiss-Prot
	KH_dom_type_1_sf	UniProtKB/Swiss-Prot
	KH_I_FXR1_rpt1	UniProtKB/Swiss-Prot
	KH_I_FXR1_rpt2	UniProtKB/Swiss-Prot
	KH_I_FXR1_rpt3	UniProtKB/Swiss-Prot
	Tudor_Agenet_FXR1_rpt1	UniProtKB/Swiss-Prot
	Tudor_Agenet_FXR1_rpt2	UniProtKB/Swiss-Prot
	Tudor_FRX1	UniProtKB/Swiss-Prot
KEGG Report	rno:361927	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:94858	IMAGE-MGC_LOAD
NCBI Gene	361927	ENTREZGENE
PANTHER	FRAGILE X MENTAL RETARDATION SYNDROME-RELATED PROTEIN 1	UniProtKB/Swiss-Prot
	PTHR10603	UniProtKB/Swiss-Prot
Pfam	Agenet	UniProtKB/Swiss-Prot
	FXMRP1_C_core	UniProtKB/Swiss-Prot
	FXR_C1	UniProtKB/Swiss-Prot
	KH_1	UniProtKB/Swiss-Prot
	KH_9	UniProtKB/Swiss-Prot
	Tudor_FRX1	UniProtKB/Swiss-Prot
PhenoGen	Fxr1	PhenoGen
PROSITE	AGENET_LIKE	UniProtKB/Swiss-Prot
	KH_TYPE_1	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000051480	RatGTEx
SMART	SM00322	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF54791	UniProtKB/Swiss-Prot
UniProt	A0A0G2JWD2	ENTREZGENE, UniProtKB/TrEMBL
	A0A3G2LW22	ENTREZGENE
	A0A8I5ZRV6	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6A275_RAT	UniProtKB/TrEMBL
	A0A8I6AM03	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6GBZ3_RAT	UniProtKB/TrEMBL
	A6IHT2	ENTREZGENE, UniProtKB/TrEMBL
	A6IHT3	ENTREZGENE, UniProtKB/TrEMBL
	A6IHT4	ENTREZGENE, UniProtKB/TrEMBL
	FXR1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-03-09	Fxr1	FMR1 autosomal homolog 1	LOC100366044	rCG41429-like	Data merged from RGD:2324412	737654	PROVISIONAL
2016-02-24	Fxr1	FMR1 autosomal homolog 1	Fxr1	fragile X mental retardation, autosomal homolog 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2013-07-09	Fxr1	fragile X mental retardation, autosomal homolog 1	Fxr1	fragile X mental retardation gene 1, autosomal homolog	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-01-17	Fxr1	fragile X mental retardation gene 1, autosomal homolog	Fxr1	fragile X mental retardation, autosomal homolog 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2010-05-06	LOC100366044	rCG41429-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2008-03-04	Fxr1	fragile X mental retardation, autosomal homolog 1	Fxr1h	fragile X mental retardation gene 1, autosomal homolog	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Fxr1h	fragile X mental retardation gene 1, autosomal homolog	Fxr1h_predicted	fragile X mental retardation gene 1, autosomal homolog (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Fxr1h_predicted	fragile X mental retardation gene 1, autosomal homolog (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM