Rras2 (RAS related 2) - Rat Genome Database

Name: Rras2
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes Community Projects (beta) QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease Coronavirus Disease Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Presentations Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Rras2 (RAS related 2) Rattus norvegicus

Analyze

Symbol:

Rras2

Name:

RAS related 2

RGD ID:

1310793

Description:

Predicted to enable GTPase activity. Predicted to act upstream of or within Ras protein signal transduction and positive regulation of Schwann cell migration. Predicted to be active in plasma membrane. Human ortholog(s) of this gene implicated in Noonan syndrome 12. Orthologous to human RRAS2 (RAS related 2); PARTICIPATES IN mitogen activated protein kinase signaling pathway; INTERACTS WITH (+)-schisandrin B; 1,3-dinitrobenzene; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC365355; MGC109327; ras-related protein R-Ras2; related RAS viral (r-ras) oncogene homolog 2

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RRAS2 (RAS related 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Rras2 (related RAS viral (r-ras) oncogene 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Rras2 (RAS related 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RRAS2 (RAS related 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RRAS2 (RAS related 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rras2 (RAS related 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RRAS2 (RAS related 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RRAS2 (RAS related 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rras2 (RAS related 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	RRAS2 (RAS related 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Rras2 (related RAS viral (r-ras) oncogene 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	rras2 (RAS related 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	RAS1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Ras64B	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ras-1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	RAS2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	rras	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	1	168,233,693 - 168,303,111 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	168,233,693 - 168,303,111 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	176,562,741 - 176,632,090 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	183,748,814 - 183,818,172 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	176,462,863 - 176,532,658 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	178,940,515 - 179,010,257 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	178,940,516 - 179,010,257 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	185,908,263 - 185,978,450 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	172,026,262 - 172,097,710 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	172,162,371 - 172,233,819 (-)	NCBI
Celera	1	166,086,473 - 166,155,650 (-)	NCBI		Celera
Cytogenetic Map	1	q33	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Experimental Liver Neoplasms (ISO)

genetic disease (ISO)

intellectual disability (ISO)

juvenile myelomonocytic leukemia (ISO)

Noonan syndrome (ISO)

Noonan syndrome 12 (ISO)

Ovarian Neoplasms (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (ISO)

1,3-dinitrobenzene (EXP)

1-naphthyl isothiocyanate (ISO)

17alpha-ethynylestradiol (ISO)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-(chloromethyl)pyridine (ISO)

2-butoxyethanol (ISO)

3,4-methylenedioxymethamphetamine (ISO)

5-aza-2'-deoxycytidine (ISO)

5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP)

6-propyl-2-thiouracil (EXP)

acrylamide (EXP)

afimoxifene (ISO)

aflatoxin B1 (ISO)

amiodarone (EXP)

amitrole (EXP)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

azathioprine (ISO)

benzbromarone (EXP)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bis(2-chloroethyl) sulfide (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

cadmium dichloride (EXP)

capecitabine (ISO)

carbamazepine (ISO)

carbon nanotube (ISO)

chenodeoxycholic acid (ISO)

cisplatin (ISO)

clofibrate (EXP)

cobalt dichloride (ISO)

copper atom (EXP,ISO)

copper(0) (EXP,ISO)

copper(II) sulfate (ISO)

Cuprizon (EXP)

cyclophosphamide (ISO)

cyclosporin A (ISO)

deoxycholic acid (ISO)

dexamethasone (ISO)

dextran sulfate (ISO)

diarsenic trioxide (ISO)

diazinon (ISO)

dibutyl phthalate (ISO)

diclofenac (ISO)

dicrotophos (ISO)

dioxygen (ISO)

doxifluridine (ISO)

ethanol (ISO)

fenthion (ISO)

flutamide (EXP)

folic acid (ISO)

fulvestrant (ISO)

gentamycin (EXP)

glycochenodeoxycholic acid (ISO)

glycocholic acid (ISO)

glycodeoxycholic acid (ISO)

hydrogen peroxide (ISO)

ivermectin (ISO)

ketamine (EXP)

L-ethionine (EXP)

lipopolysaccharide (ISO)

menadione (ISO)

methimazole (EXP)

monosodium L-glutamate (ISO)

N-methyl-4-phenylpyridinium (ISO)

naphthalene (ISO)

nefazodone (ISO)

obeticholic acid (ISO)

omeprazole (EXP)

oxaliplatin (EXP)

paracetamol (EXP,ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

phenobarbital (ISO)

pirinixic acid (EXP,ISO)

pyrogallol (ISO)

rimonabant (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (EXP,ISO)

sunitinib (ISO)

temozolomide (ISO)

tert-butyl hydroperoxide (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

topotecan (EXP)

trimellitic anhydride (ISO)

trimethyltin (ISO)

valproic acid (ISO)

vinclozolin (EXP)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

cell migration (ISO)

positive regulation of Schwann cell migration (ISO)

Ras protein signal transduction (ISO)

Schwann cell migration (ISO)

Cellular Component

plasma membrane (IBA,ISO)

Molecular Function

GDP binding (IBA)

GTP binding (IBA)

GTPase activity (IBA,ISO)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

mitogen activated protein kinase signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
4.	GOA pipeline	RGD automated data pipeline
5.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Comprehensive gene review and curation	RGD comprehensive gene curation
8.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:11788587	PMID:14724565	PMID:16210410	PMID:19056867	PMID:21085126	PMID:21423176

Genomics

Comparative Map Data

Rras2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	1	168,233,693 - 168,303,111 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	168,233,693 - 168,303,111 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	176,562,741 - 176,632,090 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	183,748,814 - 183,818,172 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	176,462,863 - 176,532,658 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	178,940,515 - 179,010,257 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	178,940,516 - 179,010,257 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	185,908,263 - 185,978,450 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	172,026,262 - 172,097,710 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	172,162,371 - 172,233,819 (-)	NCBI
Celera	1	166,086,473 - 166,155,650 (-)	NCBI		Celera
Cytogenetic Map	1	q33	NCBI

RRAS2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	14,277,920 - 14,364,506 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	11	14,277,922 - 14,364,506 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	11	14,299,466 - 14,386,052 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	14,256,042 - 14,337,305 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	11	14,256,871 - 14,337,289	NCBI
Celera	11	14,424,875 - 14,511,140 (-)	NCBI		Celera
Cytogenetic Map	11	p15.2	NCBI
HuRef	11	13,981,134 - 14,067,065 (-)	NCBI		HuRef
CHM1_1	11	14,298,377 - 14,384,667 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	11	14,373,520 - 14,459,786 (-)	NCBI		T2T-CHM13v2.0

Rras2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	113,646,017 - 113,717,016 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	113,646,017 - 113,717,016 (-)	Ensembl		GRCm39 Ensembl
GRCm38	7	114,046,782 - 114,117,781 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	114,046,782 - 114,117,781 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	121,190,296 - 121,261,295 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	113,837,969 - 113,908,962 (-)	NCBI		MGSCv36	mm8
Celera	7	114,009,446 - 114,081,527 (-)	NCBI		Celera
Cytogenetic Map	7	F1	NCBI
cM Map	7	59.29	NCBI

Rras2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955414	29,481,343 - 29,493,070 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955414	29,482,502 - 29,546,102 (-)	NCBI	ChiLan1.0	ChiLan1.0

RRAS2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	11	16,622,081 - 16,703,102 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	11	14,381,173 - 14,462,192 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	11	14,073,679 - 14,154,027 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	11	14,073,679 - 14,159,611 (-)	Ensembl	panpan1.1		panPan2

RRAS2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	21	37,037,576 - 37,119,733 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	21	37,038,334 - 37,112,662 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	21	36,540,855 - 36,621,893 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	21	37,927,178 - 38,008,648 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	21	37,928,606 - 38,008,632 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	21	37,178,474 - 37,259,232 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	21	37,363,683 - 37,444,503 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	21	37,644,316 - 37,725,950 (-)	NCBI		UU_Cfam_GSD_1.0

Rras2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	48,379,460 - 48,395,186 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936528	4,413,436 - 4,427,741 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936528	4,413,436 - 4,429,166 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RRAS2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	2	44,890,129 - 44,961,003 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

RRAS2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	1	50,527,669 - 50,607,208 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	1	50,527,699 - 50,607,871 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	148,071,811 - 148,151,429 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rras2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624766	6,180,822 - 6,244,692 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624766	6,179,507 - 6,244,722 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Rras2
385 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	677
Count of miRNA genes:	294
Interacting mature miRNAs:	361
Transcripts:	ENSRNOT00000017199
Prediction methods:	Microtar, Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	49393289	199050459	Rat
1578780	Cm52	Cardiac mass QTL 52	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	1	81591954	219808434	Rat
724521	Uae1	Urinary albumin excretion QTL 1	3.8	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	90508614	173018436	Rat
1358902	Bw47	Body weight QTL 47	1.67		body mass (VT:0001259)	body weight (CMO:0000012)	1	90508614	180359386	Rat
1331793	Bp200	Blood pressure QTL 200	3.71601		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	94494440	172949803	Rat
1331751	Bp199	Blood pressure QTL 199	3.60022		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	94494440	181830018	Rat
1331749	Hrtrt11	Heart rate QTL 11	2.973		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	94494440	198211706	Rat
70209	Niddm23	Non-insulin dependent diabetes mellitus QTL 23	2.82		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	94494440	198324465	Rat
731168	Bp154	Blood pressure QTL 154	3.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	94642644	214537671	Rat
8655649	Arrd1	Age-related retinal degeneration QTL 1	4.89		retinal layer morphology trait (VT:0003727)	percentage of study population developing retinopathy during a period of time (CMO:0002453)	1	100357752	183970443	Rat
1354591	Cm36	Cardiac mass QTL 36	4.1		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	102813953	201278233	Rat
1354615	Cm32	Cardiac mass QTL 32	5.2		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	1	102813953	201278233	Rat
1354606	Bp246	Blood pressure QTL 246	3.6		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	102813953	218753816	Rat
1300158	Bp173	Blood pressure QTL 173	3.48		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	1	115540693	185145286	Rat
7794788	Mcs32	Mammary carcinoma susceptibility QTL 32	2.61		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	1	115540693	238914717	Rat
631199	Cm23	Cardiac mass QTL 23	4.6	0.0004	heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	1	115585465	172949803	Rat
7421630	Bp362	Blood pressure QTL 362		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	118608292	241799120	Rat
631205	Bp196	Blood pressure QTL 196	4	0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	118944897	199050459	Rat
631544	Bp84	Blood pressure QTL 84	5.6		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	123350408	181759564	Rat
1358189	Cstrr1	Cold stress response QTL 1		0.0001	catecholamine amount (VT:0010543)	urine norepinephrine level (CMO:0001629)	1	123350408	182418476	Rat
1641895	Bp298	Blood pressure QTL 298			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	123350408	182418476	Rat
1578770	Stresp23	Stress response QTL 23			kidney sympathetic nerve activity (VT:0004050)	stimulated renal sympathetic nerve activity to basal renal sympathetic nerve activity ratio (CMO:0001786)	1	123350408	182418476	Rat
631549	Bp89	Blood pressure QTL 89	5.7		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	123350581	201284552	Rat
634348	Bp138	Blood pressure QTL 138			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	125611501	168883176	Rat
9685799	Bp375	Blood pressure QTL 375			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	125611501	170611501	Rat
631654	Bp107	Blood pressure QTL 107			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	125611501	170611501	Rat
9685802	Bp376	Blood pressure QTL 376			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	126540680	171540680	Rat
738006	Anxrr14	Anxiety related response QTL 14	4	0.00035	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	130636910	175636910	Rat
738028	Anxrr12	Anxiety related response QTL 12	4.9	0.00001	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	130636910	175636910	Rat
6893347	Bw98	Body weight QTL 98	0.2	0.53	body mass (VT:0001259)	body weight (CMO:0000012)	1	133680936	178680936	Rat
6893361	Bw104	Body weight QTL 104	0.59	0.27	body mass (VT:0001259)	body weight (CMO:0000012)	1	133680936	178680936	Rat
1558645	Bw55	Body weight QTL 55	3.2	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	1	133680936	178680936	Rat
71118	Thym1	Thymus enlargement QTL 1	10.17	0.001	thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	1	136829932	181829932	Rat
724550	Thym3	Thymus enlargement QTL 3	7.82	0.001	thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	1	136829932	181829932	Rat
631519	Pia11	Pristane induced arthritis QTL 11	5.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	136830018	181830018	Rat
1598853	Memor3	Memory QTL 3	4.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	1	143506580	212458660	Rat
61348	Bp30	Blood pressure QTL 30	2.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	144017057	197814409	Rat
70160	Bw18	Body weight QTL 18	5.7		body mass (VT:0001259)	body weight (CMO:0000012)	1	144267353	196383668	Rat
737828	Hcas3	Hepatocarcinoma susceptibility QTL 3	4.9		liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	1	144267353	222987745	Rat
2302378	Insul11	Insulin level QTL 11	3.25		blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	1	144267353	251128347	Rat
634315	Niddm45	Non-insulin dependent diabetes mellitus QTL 45	7.16		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	144267916	172949660	Rat
61379	Bp44	Blood pressure QTL 44	19.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	144267916	174133260	Rat
7771612	Cm80	Cardiac mass QTL 80	8.4		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	1	149448574	221264292	Rat
724531	Uae5	Urinary albumin excretion QTL 5	4		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	1	150700142	252085212	Rat
1578759	Uae30	Urinary albumin excretion QTL 30	3.3	0.003	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	150700247	252085048	Rat
1578778	Pur4	Proteinuria QTL 4	3.3	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	1	150700247	252085048	Rat
1354602	Bw35	Body weight QTL 35	12.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	201278233	Rat
1354620	Kidm19	Kidney mass QTL 19	4		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	151162512	201278233	Rat
1354634	Kidm12	Kidney mass QTL 12	3.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	1	151162512	201278233	Rat
1354636	Lmblg1	Limb length QTL 1	6.4		tibia length (VT:0004357)	tibia length (CMO:0000450)	1	151162512	201278233	Rat
1354610	Bw34	Body weight QTL 34	4.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
1354646	Kidm18	Kidney mass QTL 18	5.7		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	151162512	256448636	Rat
1354661	Bw33	Body weight QTL 33	5.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
1358886	Bp260	Blood pressure QTL 260	3.67		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	151162766	225824951	Rat
61343	Bp28	Blood pressure QTL 28			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	151646613	196646613	Rat
1549837	Hcar15	Hepatocarcinoma resistance QTL 15		0.05	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	153136852	260522016	Rat
2303622	Vencon6	Ventilatory control QTL 6		0.001	respiration trait (VT:0001943)	respiration rate (CMO:0000289)	1	154561505	199561505	Rat
1582204	Livw1	Liver weight QTL 1	3.6	0.0003	liver mass (VT:0003402)	liver weight to body weight ratio (CMO:0000633)	1	155422851	172949803	Rat
4889428	Stresp24	Stress response QTL 24		0.05	heart pumping trait (VT:2000009)	absolute change in electrocardiographic low frequency R-R spectral component to high frequency R-R spectral component ratio (CMO:0002162)	1	155866514	200866514	Rat
631548	Bp88	Blood pressure QTL 88	5	0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	156677124	176484451	Rat
1354618	Kidm15	Kidney mass QTL 15	5		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	1	156677124	201278233	Rat
2312420	Pur17	Proteinuria QTL 17	7.1	0.0001	urine protein amount (VT:0005160)	urine total protein excretion rate (CMO:0000756)	1	156677124	218753816	Rat
1354580	Scort1	Serum corticosterone level QTL 1	3.4		blood corticosterone amount (VT:0005345)	blood corticosterone level (CMO:0001172)	1	156677124	256448636	Rat
61347	Bp197	Blood pressure QTL 197	4.2		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	1	158633083	203633083	Rat
2292222	Bp307	Blood pressure QTL 307	3.06	0.0014	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	164310393	213533942	Rat
2292220	Bp306	Blood pressure QTL 306	3.47	0.00087	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	164310393	243914901	Rat
619613	Bp77	Blood pressure QTL 77		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	164747424	209747424	Rat
619613	Bp77	Blood pressure QTL 77		0.01	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	164747424	209747424	Rat
737974	Bp161	Blood pressure QTL 161		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	164747558	181133855	Rat
2312558	Glom17	Glomerulus QTL 17	3.9	0.001	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	1	166532971	191278129	Rat
1354653	Despr9	Despair related QTL 9		0.00019	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	167909849	212909849	Rat

Markers in Region

D1Rat243

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	168,278,025 - 168,278,264 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	178,985,175 - 178,985,413	NCBI	Rnor6.0
Rnor_5.0	1	185,953,368 - 185,953,606	UniSTS	Rnor5.0
RGSC_v3.4	1	172,072,626 - 172,072,864	UniSTS	RGSC3.4
RGSC_v3.4	1	172,072,625 - 172,072,864	RGD	RGSC3.4
RGSC_v3.1	1	172,208,735 - 172,208,973	RGD
Celera	1	166,130,565 - 166,130,803	UniSTS
RH 3.4 Map	1	1316.29	RGD
RH 3.4 Map	1	1316.29	UniSTS
RH 2.0 Map	1	868.3	RGD
SHRSP x BN Map	1	84.65	RGD
FHH x ACI Map	1	81.06	RGD
Cytogenetic Map	1	q34	UniSTS

C86394

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	168,233,945 - 168,234,027 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	178,940,768 - 178,940,849	NCBI	Rnor6.0
Rnor_5.0	1	185,908,516 - 185,908,597	UniSTS	Rnor5.0
RGSC_v3.4	1	172,026,515 - 172,026,596	UniSTS	RGSC3.4
Celera	1	166,086,726 - 166,086,807	UniSTS
Cytogenetic Map	1	q34	UniSTS

PMC140962P1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	45,916,922 - 45,917,137 (+)	MAPPER	mRatBN7.2
mRatBN7.2	1	168,234,719 - 168,234,933 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	178,941,542 - 178,941,755	NCBI	Rnor6.0
Rnor_6.0	10	47,514,096 - 47,514,310	NCBI	Rnor6.0
Rnor_5.0	10	47,288,934 - 47,289,148	UniSTS	Rnor5.0
Rnor_5.0	1	185,909,290 - 185,909,503	UniSTS	Rnor5.0
RGSC_v3.4	1	172,027,289 - 172,027,502	UniSTS	RGSC3.4
RGSC_v3.4	10	47,389,121 - 47,389,335	UniSTS	RGSC3.4
Celera	10	45,170,319 - 45,170,533	UniSTS
Celera	1	166,087,500 - 166,087,713	UniSTS
Cytogenetic Map	1	q34	UniSTS
Cytogenetic Map	10	q22	UniSTS

RH134521

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	168,234,569 - 168,234,749 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	178,941,392 - 178,941,571	NCBI	Rnor6.0
Rnor_5.0	1	185,909,140 - 185,909,319	UniSTS	Rnor5.0
RGSC_v3.4	1	172,027,139 - 172,027,318	UniSTS	RGSC3.4
Celera	1	166,087,350 - 166,087,529	UniSTS
RH 3.4 Map	1	1317.9	UniSTS
Cytogenetic Map	1	q34	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	43	46	37	19	37	4	4	70	35	36	11	4
Low			11	4		4	4	7	4		5		4
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001013434	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC110462	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC091333	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473956	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000043	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000017199 ⟹ ENSRNOP00000017199

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	168,233,694 - 168,303,111 (-)	Ensembl
Rnor_6.0 Ensembl	1	178,940,516 - 179,010,257 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000087771 ⟹ ENSRNOP00000073247

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	1	178,941,894 - 178,955,352 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000096467 ⟹ ENSRNOP00000081051

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	168,233,693 - 168,251,234 (-)	Ensembl

RefSeq Acc Id:

NM_001013434 ⟹ NP_001013452

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	1	168,233,693 - 168,303,111 (-)	NCBI
Rnor_6.0	1	178,940,515 - 179,010,257 (-)	NCBI
Rnor_5.0	1	185,908,263 - 185,978,450 (-)	NCBI
RGSC_v3.4	1	172,026,262 - 172,097,710 (-)	RGD
Celera	1	166,086,473 - 166,155,650 (-)	RGD

Sequence:

show sequence

GCGGTGCTAGAGGCTGCGTTCGGCTGCGCTGCAGAGCCGCGAAGAGGATCGCGCTCCCTGGCCG
CTGCGTCCTCTGCCCTGGAGCCTTCTCGGCTCTCCTGCGTCTCGGGCAACTCCCAACCAGTCCC
GGGGATAGCGCTCCGCGGCCCTCCAGGCCACTCGCGGGCCCCGCGCGCTCTACCGCCTGTAACC
CAGCCGGCCGCACTCGTCCCCGGAGCCGGGCCTAGGGCGCGCGGCGGCCGGGCTGGGCTCGGGG
CGTCCCGATGGCCGCGGCCGGCTGGCGCGACGGCTCCGGCCAGGAGAAGTACCGGCTCGTGGTG
GTCGGCGGTGGCGGCGTGGGCAAGTCGGCGCTCACCATCCAGTTCATCCAGTCCTACTTTGTGA
CGGACTATGATCCAACCATCGAAGACTCATACACAAAACAGTGTGTGATCGATGATCGAGCGGC
CCGGCTGGACATTTTGGATACAGCCGGACAAGAGGAGTTTGGAGCCATGAGAGAGCAGTACATG
AGGACAGGCGAGGGCTTCCTGTTGGTCTTCTCAGTTACAGATAGAGGCAGTTTTGAAGAAATCT
ATAAGTTTCAAAGACAGATTCTCAGAGTAAAGGATCGTGATGAGTTTCCCATGATTTTAATTGG
CAATAAAGCAGACCTGGACCATCAGAGACAGGTAACGCAGGAAGAAGGGCAGCAGTTAGCGCGG
CAGCTCAAGGTCACGTATATGGAGGCGTCGGCAAAGATCAGGATGAATGTAGATCAAGCTTTCC
ACGAACTTGTCCGAGTTATCAGGAAGTTTCAAGAACAAGAATGTCCTCCTTCACCAGAACCAAC
CCGGAAAGAAAAAGACAAGAAAGGCTGCCATTGTGTCATTTTCTAAAGAGTCCCTTAAGGTTTA
GCTAACAACTGCCAGGGAAGCCCTCATCTCTGCTACCGTTTACATCATCCGGTACCTTTGTAGC
CTTAGACCGATGATCACCGTGTTAGCCTTACACCAAGAAGCTGGCTAATCCTTTATGTGAAGCT
AATGTAACGGTCTTTCCCAGACTTGTGTACAGGAAACACTAAGGCTGCTTCAGACTCCTTTAGA
ACACACGTCTACACACACGATGCAGTCTGTAAGGGCTTTTAGTAGAGGTGAACAGGTTTGGAGC
CCGAGCTGTTTGCTAAGCTGAAGTCATAGGTTGTGAAGTAATTTTTAACTTCTGGAATCATGTT
GCCTACTGTTACTCTAAATAGAAATATAGGAAGGTTTTTTTTTTTTAAATGTGAATTTTTGCCT
ATCTTTAAAACTTTGGATGTCAACTTTCATTAACCTTAAATACACTGAATGGAATCTACAGAAG
TGAGACATCTCAGAACTTTCCTGATGCTACGGCTTTTGTTTTTCCAGTGGCCAGAATACCAAAA
TGCCTGTTGTATTTATGGATTAAAAACTGCTGATTGAGCTATTGTTATTCTGCCTCCTTCAAGA
TGACAGTATTCTCTGTGGCCAAGTGTTTGGACTGGTTCTGCACTTAGATGTTTCAGTGAACTTG
ATTTCTTTTCACAGCCGTGGTAAGGGTAAGAGTGAATGGTTCTTGTCTGTCTTCCTGTTCAAAT
ATTCCTGGGTAAGGGATTAAAAAAGAAAACCCACACAAGCTAAAGCTGTTTTCGTTTGATGTAA
TATAAAATATGGAATCGATCTTCCCAAAGTCAGAGATGATTAATGTTTTTGCTATATACTTTTA
TACGTTATTTTCTTATCAAACTAGTTAACAAGTATTTTTATATGTTTGTAAGCGAATATGCTTT
CACAGCGCACCTTGTGTATATGTAAAGATGAGTATTTAAGTCTCACTGTTCACCGTTAGCTGAC
AAAGAGAACGTGGAAGCCACGGCGACCATGGCTTTTGCTTGCTGGCTTGGTCCTTGTTCTATCC
ACTGGTGGCCAGTAATCAGAAACCCTTCCCAACAGAACGCAACAGGATGAGACTGTGAAGTCAC
GTTCAATGTCCCCGCTAGATATTGACTGTTATAGCAAGTATTACATGTAAAACCTCTACTTGAC
AATTAGTGTAACTGTGGATGGCTTCTGGTTTTGTTTTTAACTCTGTGGATTGTGTTTAAGCAAT
TCAAAGTGTTTTCCTGGTCTTGAGACTCTCAGTGGTATTGCACAGTGCTCACTTTACTGAATGT
GTACAACAGCCCCATGACGTTTATAAAGTGGACCCTTGTATAGCTTCAGGTGCTAGAATTAAAG
TTGATCTGTTATCACCAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001013452	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH91333	(Get FASTA)	NCBI Sequence Viewer
	EDM17786	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000017199
	ENSRNOP00000017199.3
	ENSRNOP00000081051.1

RefSeq Acc Id:

NP_001013452 ⟸ NM_001013434

- UniProtKB:

Q5BJU0 (UniProtKB/TrEMBL), F7ESH4 (UniProtKB/TrEMBL), A0A8I6G5F9 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARL
DILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNK
ADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRK
EKDKKGCHCVIF

hide sequence

RefSeq Acc Id:

ENSRNOP00000073247 ⟸ ENSRNOT00000087771

RefSeq Acc Id:

ENSRNOP00000017199 ⟸ ENSRNOT00000017199

RefSeq Acc Id:

ENSRNOP00000081051 ⟸ ENSRNOT00000096467

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5BJU0-F1-model_v2	AlphaFold	Q5BJU0	1-204	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13690327

Promoter ID:

EPDNEW_R852

Type:

multiple initiation site

Name:

Rras2_1

Description:

RAS related 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	179,010,272 - 179,010,332	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1310793	AgrOrtholog
BioCyc Gene	G2FUF-57744	BioCyc
Ensembl Genes	ENSRNOG00000012258	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000017199	ENTREZGENE
	ENSRNOT00000017199.6	UniProtKB/TrEMBL
	ENSRNOT00000096467.1	UniProtKB/TrEMBL
Gene3D-CATH	3.40.50.300	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7314509	IMAGE-MGC_LOAD
InterPro	P-loop_NTPase	UniProtKB/TrEMBL
	Ras_GTPase	UniProtKB/TrEMBL
	Ras_small_GTPase	UniProtKB/TrEMBL
	Small_GTP-bd_dom	UniProtKB/TrEMBL
KEGG Report	rno:365355	UniProtKB/TrEMBL
MGC_CLONE	MGC:109327	IMAGE-MGC_LOAD
NCBI Gene	365355	ENTREZGENE
PANTHER	PTHR24070	UniProtKB/TrEMBL
	RAS-RELATED PROTEIN R-RAS2	UniProtKB/TrEMBL
Pfam	Ras	UniProtKB/TrEMBL
PhenoGen	Rras2	PhenoGen
PRINTS	RASTRNSFRMNG	UniProtKB/TrEMBL
PROSITE	RAB	UniProtKB/TrEMBL
	RAS	UniProtKB/TrEMBL
	RHO	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000012258	RatGTEx
SMART	RAB	UniProtKB/TrEMBL
	RAN	UniProtKB/TrEMBL
	RAS	UniProtKB/TrEMBL
	RHO	UniProtKB/TrEMBL
Superfamily-SCOP	SSF52540	UniProtKB/TrEMBL
UniProt	A0A8I6G5F9	ENTREZGENE, UniProtKB/TrEMBL
	F7ESH4	ENTREZGENE, UniProtKB/TrEMBL
	Q5BJU0	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-08-16	Rras2	RAS related 2	Rras2	related RAS viral (r-ras) oncogene homolog 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Rras2	related RAS viral (r-ras) oncogene homolog 2	Rras2_predicted	related RAS viral (r-ras) oncogene homolog 2 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Rras2_predicted	related RAS viral (r-ras) oncogene homolog 2 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)