Advanced Search (OLGA)

Gene: Hvcn1 (hydrogen voltage-gated channel 1) Rattus norvegicus

Analyze

Symbol:

Hvcn1

Name:

hydrogen voltage-gated channel 1

RGD ID:

1310788

Description:

Predicted to enable protein homodimerization activity and voltage-gated proton channel activity. Involved in positive regulation of superoxide anion generation and regulation of intracellular pH. Located in apical plasma membrane. Used to study middle cerebral artery infarction. Orthologous to human HVCN1 (hydrogen voltage gated channel 1); INTERACTS WITH 17beta-estradiol; 17beta-estradiol 3-benzoate; alpha-Zearalanol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC304485; RGD1310788; similar to RIKEN cDNA 0610039P13; voltage-gated hydrogen channel 1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	HVCN1 (hydrogen voltage gated channel 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Hvcn1 (hydrogen voltage-gated channel 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Hvcn1 (hydrogen voltage gated channel 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	HVCN1 (hydrogen voltage gated channel 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	HVCN1 (hydrogen voltage gated channel 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Hvcn1 (hydrogen voltage gated channel 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	HVCN1 (hydrogen voltage gated channel 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	HVCN1 (hydrogen voltage gated channel 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Hvcn1 (hydrogen voltage gated channel 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	MAP2K7 (mitogen-activated protein kinase kinase 7)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Hvcn1 (hydrogen voltage-gated channel 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	HVCN1 (hydrogen voltage gated channel 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	hvcn1 (hydrogen voltage-gated channel 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	hvcn1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Allele / Splice:

Hvcn1^em1Mcwi ; Hvcn1^em2Mcwi

Genetic Models:

SS-Hvcn1^em2Mcwi-/- ; SS-Hvcn1^em1Mcwi

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	40,001,205 - 40,030,671 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	12	40,001,498 - 40,042,020 (-)	Ensembl				GRCr8
mRatBN7.2	12	34,341,673 - 34,370,010 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	34,335,190 - 34,370,141 (-)	Ensembl				mRatBN7.2
Rnor_6.0	12	39,822,814 - 39,851,093 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	39,822,637 - 39,850,567 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	12	41,702,567 - 41,731,349 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	12	35,536,954 - 35,556,666 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	12	36,012,998 - 36,041,213 (-)	NCBI		Celera
RGSC_v3.1	12	35,401,133 - 35,431,692 (-)	NCBI
Cytogenetic Map	12	q16	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

COVID-19 (ISO)

middle cerebral artery infarction (IMP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (EXP)

17beta-estradiol 3-benzoate (EXP)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

5-aza-2'-deoxycytidine (ISO)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

amphetamine (EXP)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chlordecone (ISO)

choline (ISO)

chromium(6+) (ISO)

cisplatin (ISO)

cocaine (EXP)

crocidolite asbestos (ISO)

Cuprizon (EXP)

dimethylarsinic acid (ISO)

dioxygen (ISO)

endosulfan (EXP)

ethyl methanesulfonate (ISO)

folic acid (ISO)

formaldehyde (ISO)

genistein (ISO)

gentamycin (EXP)

L-methionine (ISO)

lidocaine (EXP)

methyl methanesulfonate (ISO)

methylarsonic acid (ISO)

nickel atom (ISO)

niclosamide (ISO)

nitrates (ISO)

okadaic acid (ISO)

ozone (ISO)

paracetamol (ISO)

silicon dioxide (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

testosterone (EXP,ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trichloroethene (EXP)

triclosan (ISO)

triphenyl phosphate (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to pH (ISO)

cellular response to zinc ion (ISO)

monoatomic ion transmembrane transport (IEA)

monoatomic ion transport (IEA)

positive regulation of superoxide anion generation (IMP)

proton transmembrane transport (IBA,IEA,ISO)

regulation of acrosome reaction (ISO)

regulation of intracellular pH (IEA,IMP,ISO)

regulation of reactive oxygen species biosynthetic process (IEA,ISO)

response to pH (IEA,ISO)

response to zinc ion (IEA,ISO)

transmembrane transport (IEA)

Cellular Component

apical plasma membrane (IDA)

membrane (IEA,ISO)

monoatomic ion channel complex (IEA)

phagocytic vesicle membrane (IEA,ISO)

plasma membrane (IBA,IEA,ISO)

sperm flagellum (ISO)

Molecular Function

identical protein binding (ISO)

monoatomic ion channel activity (IEA)

protein binding (ISO)

protein homodimerization activity (IEA,ISO)

voltage-gated monoatomic cation channel activity (ISO)

voltage-gated proton channel activity (IBA,IEA,ISO)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

cerebral edema (IMP)

decreased mean systemic arterial blood pressure (IMP)

decreased systemic arterial blood pressure (IMP)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	HV1 acts as a sodium sensor and promotes superoxide production in medullary thick ascending limb of Dahl salt-sensitive rats.	Jin C, etal., Hypertension. 2014 Sep;64(3):541-50. doi: 10.1161/HYPERTENSIONAHA.114.03549. Epub 2014 Jun 16.
3.	Neurovascular protection in voltage-gated proton channel Hv1 knock-out rats after ischemic stroke: interaction with Na+ /H+ exchanger-1 antagonism.	Li W, etal., Physiol Rep. 2019 Aug;7(13):e14142. doi: 10.14814/phy2.14142.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	GOA pipeline	RGD automated data pipeline
6.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:16554753	PMID:16556803	PMID:18509058	PMID:18583477	PMID:19805063	PMID:22020278

Genomics

Comparative Map Data

Hvcn1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	40,001,205 - 40,030,671 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	12	40,001,498 - 40,042,020 (-)	Ensembl				GRCr8
mRatBN7.2	12	34,341,673 - 34,370,010 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	34,335,190 - 34,370,141 (-)	Ensembl				mRatBN7.2
Rnor_6.0	12	39,822,814 - 39,851,093 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	39,822,637 - 39,850,567 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	12	41,702,567 - 41,731,349 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	12	35,536,954 - 35,556,666 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	12	36,012,998 - 36,041,213 (-)	NCBI		Celera
RGSC_v3.1	12	35,401,133 - 35,431,692 (-)	NCBI
Cytogenetic Map	12	q16	NCBI

HVCN1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	110,648,686 - 110,704,952 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	110,627,841 - 110,704,950 (-)	Ensembl			hg38	GRCh38
GRCh37	12	111,086,491 - 111,127,582 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	109,570,874 - 109,612,000 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	12	110,713,319 - 110,754,445 (-)	NCBI		Celera
Cytogenetic Map	12	q24.11	NCBI
HuRef	12	108,104,197 - 108,145,322 (-)	NCBI		HuRef
CHM1_1	12	111,054,153 - 111,095,269 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	12	110,626,380 - 110,682,642 (-)	NCBI		T2T-CHM13v2.0

Hvcn1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	122,344,872 - 122,380,360 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	122,344,867 - 122,380,360 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	5	122,206,805 - 122,242,297 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	122,206,804 - 122,242,297 (+)	Ensembl			mm10	GRCm38
MGSCv37	5	122,659,746 - 122,692,306 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	5	122,470,904 - 122,502,890 (+)	NCBI		MGSCv36	mm8
Celera	5	119,292,209 - 119,324,695 (+)	NCBI		Celera
Cytogenetic Map	5	F	NCBI
cM Map	5	62.23	NCBI

Hvcn1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955482	7,529,277 - 7,538,363 (-)	Ensembl
ChiLan1.0	NW_004955482	7,529,009 - 7,563,273 (-)	NCBI	ChiLan1.0	ChiLan1.0

HVCN1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	118,708,433 - 118,749,147 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	118,704,838 - 118,745,536 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	108,217,516 - 108,258,210 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	111,611,645 - 111,652,240 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	111,591,050 - 111,645,632 (-)	Ensembl			panPan2	panpan1.1

HVCN1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	26	8,437,032 - 8,474,831 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	26	8,419,269 - 8,466,523 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	26	8,600,377 - 8,638,008 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	26	8,695,233 - 8,733,429 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	26	8,693,835 - 8,730,452 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	26	8,653,672 - 8,691,298 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	26	8,715,797 - 8,753,482 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	26	8,668,380 - 8,703,287 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Hvcn1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	155,869,670 - 155,899,754 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936558	3,579,341 - 3,609,789 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936558	3,581,409 - 3,609,714 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

HVCN1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	31,989,170 - 32,043,744 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	14	32,006,837 - 32,044,165 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	33,930,483 - 33,965,967 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

HVCN1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	105,892,024 - 105,932,671 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666037	139,183,839 - 139,225,073 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Hvcn1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624747	21,256,918 - 21,264,984 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624747	21,237,736 - 21,266,531 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Variants

Variants in Hvcn1
155 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	53
Count of miRNA genes:	51
Interacting mature miRNAs:	52
Transcripts:	ENSRNOT00000001712
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631560	Apr1	Acute phase response QTL 1	6.1		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	24805022	52308831	Rat
70213	Niddm27	Non-insulin dependent diabetes mellitus QTL 27	3.72		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	11200494	52308831	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200494	52308831	Rat
8693635	Alc28	Alcohol consumption QTL 28	2.7	0.439	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	12	28717718	50386405	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
7411643	Foco20	Food consumption QTL 20		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	25989355	52308831	Rat
5684888	Pia42	Pristane induced arthritis QTL 42			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	3489416	48489416	Rat
1641928	Alcrsp5	Alcohol response QTL 5			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	12	18473041	52308831	Rat
1300162	Bp188	Blood pressure QTL 188	3.19		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	37764145	51558799	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200497	52308831	Rat
1549829	Scl48	Serum cholesterol level QTL 48	5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	12	15264248	52308831	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	11743528	52308831	Rat
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200494	52308831	Rat
70169	Eae13	Experimental allergic encephalomyelitis QTL 13		0.032	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	12	29775522	42298555	Rat
1600386	Calcic2	Intracellular calcium level QTL 2		0.001	platelet physiology trait (VT:0005464)	platelet intracellular calcium level (CMO:0000922)	12	33700432	46784661	Rat
61404	Bw120	Body weight QTL 120	5.1		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	12	17464979	46784661	Rat
1556747	Calcic1	Intracellular calcium level QTL 1		3.6	platelet calcium amount (VT:0010500)	platelet intracellular calcium level (CMO:0000922)	12	33700432	46784661	Rat
1300175	Cm5	Cardiac mass QTL 5	3.78		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	12	33700432	51558799	Rat
631829	Alc6	Alcohol consumption QTL 6	4.7		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	12	34243475	43352593	Rat
1331786	Kidm11	Kidney mass QTL 11	3.571		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	12	16187438	52308831	Rat
8693658	Alc33	Alcohol consumption QTL 33	2.1	0.68	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	12	28717718	49212240	Rat
2293699	Bss49	Bone structure and strength QTL 49	5.61	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	12	16135029	52308831	Rat
1331761	Bp218	Blood pressure QTL 218	2.973		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	16187438	51213550	Rat
1331763	Wbc2	White blood cell count QTL 2	3.162		leukocyte quantity (VT:0000217)	total white blood cell count (CMO:0000365)	12	11200494	52308831	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	11200494	52308831	Rat
7387292	Kidm42	Kidney mass QTL 42	3.03	0.0004	kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	12	1	41361854	Rat
1298081	Cia25	Collagen induced arthritis QTL 25	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	2747694	47747694	Rat
2303569	Gluco44	Glucose level QTL 44	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	18473041	52308831	Rat
2303575	Insul14	Insulin level QTL 14	4		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	12	3087180	48087180	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
7243862	Mcs30	Mammary carcinoma susceptibility QTL 30	8.62		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	12	5633306	50633306	Rat
2300186	Bmd59	Bone mineral density QTL 59	7.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	12	16135029	52308831	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat

Markers in Region

RH142503

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	34,345,261 - 34,345,382 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	39,826,352 - 39,826,472	NCBI	Rnor6.0
Rnor_5.0	12	41,706,665 - 41,706,785	UniSTS	Rnor5.0
RGSC_v3.4	12	35,541,262 - 35,541,382	UniSTS	RGSC3.4
Celera	12	36,016,536 - 36,016,656	UniSTS
RH 3.4 Map	12	606.5	UniSTS
Cytogenetic Map	12	q16	UniSTS

BF403268

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	34,342,632 - 34,342,844 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	39,823,724 - 39,823,935	NCBI	Rnor6.0
Rnor_5.0	12	41,704,037 - 41,704,248	UniSTS	Rnor5.0
RGSC_v3.4	12	35,538,634 - 35,538,845	UniSTS	RGSC3.4
Celera	12	36,013,908 - 36,014,119	UniSTS
RH 3.4 Map	12	607.2	UniSTS
Cytogenetic Map	12	q16	UniSTS

RH130165

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	34,340,503 - 34,340,704 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	39,821,595 - 39,821,795	NCBI	Rnor6.0
Rnor_5.0	12	41,701,908 - 41,702,108	UniSTS	Rnor5.0
RGSC_v3.4	12	35,536,505 - 35,536,705	UniSTS	RGSC3.4
Celera	12	36,011,779 - 36,011,979	UniSTS
RH 3.4 Map	12	598.8	UniSTS
Cytogenetic Map	12	q16	UniSTS

AU046881

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	12	40,011,166 - 40,011,445 (+)	Marker Load Pipeline
mRatBN7.2	12	34,350,413 - 34,350,692 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	39,831,504 - 39,831,782	NCBI	Rnor6.0
Rnor_5.0	12	41,711,817 - 41,712,095	UniSTS	Rnor5.0
RGSC_v3.4	12	35,546,414 - 35,546,692	UniSTS	RGSC3.4
Celera	12	36,021,688 - 36,021,966	UniSTS
Cytogenetic Map	12	q16	UniSTS

Genetic Models

This gene Hvcn1 is modified in the following models/strains:

SS-Hvcn1^em2Mcwi-/- SS-Hvcn1^em1Mcwi

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	160	91	90	59	92	59	6	344	192	10	139	69	92	31	16	16

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001431735	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001431736	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006221350	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006221351	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006249369	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017598518	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017604484	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063271892	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC127875	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000001712 ⟹ ENSRNOP00000001712

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	40,002,091 - 40,030,775 (-)	Ensembl
mRatBN7.2 Ensembl	12	34,335,190 - 34,370,141 (-)	Ensembl
Rnor_6.0 Ensembl	12	39,822,637 - 39,850,567 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000130165 ⟹ ENSRNOP00000100312

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	40,001,498 - 40,015,265 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000130199 ⟹ ENSRNOP00000107152

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	40,001,498 - 40,042,020 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000136202 ⟹ ENSRNOP00000110311

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	40,001,798 - 40,030,454 (-)	Ensembl

RefSeq Acc Id:

XM_017598518 ⟹ XP_017454007

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	40,001,205 - 40,030,671 (-)	NCBI
mRatBN7.2	12	34,341,673 - 34,369,849 (-)	NCBI
Rnor_6.0	12	39,822,814 - 39,850,982 (-)	NCBI

Sequence:

show sequence

AGGATGGGGTTGGGGGGAGGTCAGGGCGCTCCTCTTCCCTCCAGCTTCAGTGGCATCTTGCCCT
GAGGGCTGCCACGATCTGCTCCGCACCCTGCACACCCGCCAGCAGCGGGGTCACGGAGGGAGGA
AGGAAGCCCTGGCCACCCTCCATCCTCGTGATTCCCCGCTGTTCCTTTGTCCATTCTGGCTTGC
AGGGAGGGGAGGACCAGGCCAGGGGATACTGTGGGGGTGACCAAGGCCCTGGCTGCTTCTTGAA
CTGTGGCTACCCACTCCGCTGTCCTCCCCCTGGGGAACTGAGCATTGACAAGCGCCTCCTCTCC
CGGTGGAGAGAGCCAGCCGCTCCAAAGGAGACAGAAGTAGAACTACTAGCAGTTTTAGGCGCTG
CTCAAAGGGACCTGTGAGGACAGATTGCCAAGTGTCCAACTCAGGACAGCGGCGTGACAAGTCT
GCTTTCGGGGTACTCTCGCTGGATCCTGAGACAACAGGAAAATGACTTCCCATGACCAAAAGGC
CGTCACTCGCAGAACCAAGGTGGCTCCCACCAAGAGGATGAGCAGGTTCTTGAAGCACTTCACA
GTGGTGGGGGACGACTACCACACCTGGAATGTCAACTACAAGAAGTGGGAGAACGAGGAGGATG
AGGAGGAGCCCGCCCCCACGTCTGCGGAGGGCGAGGGCAGTGCTGTGGGCCCAGACGCTGAGGC
TGGCTCTGCCTCCACACCCAGGCCATCCCTGGACTTCAGGAGCCGGCTAAGGAAACTCTTCAGT
TCCCACAGGTTTCAGGTCATCATCATCTGCCTGGTGGTCCTGGACGCCCTCCTGGTGCTGGCTG
AGCTCCTTCTGGATTTGAGGATCATTGAGCCGGATCTTTCGGTCAAGAAGTATTCCACGAAGGT
ATTCCACTATCTGAGTTTAGCCATCCTGGCCTTCTTCGTGCTGGAGATCTCCCTTAAAGTCTTT
GTCTTCCGCTTGGAGTTCTTCCACCACAAGTTTGAGATCCTGGATGCCATTGTGGTGGTGGTGT
CCTTTGTCCTTGACCTCATCCTCCTGTTTAAAAACCACCATTTTGAAGCTCTTGGTCTGCTGAT
TCTGCTTCGGCTCTGGAGGGTGGCCCGGATCATCAACGGTATCATCATCTCAGTGAAGACACGC
TCTGAACGGCAGATCTTACGGTTAAAGCAGATAAACCTCCAACTGGCCACCAAGATCCAGCATC
TGGAATTCAGCTGCTCCGAGAAGGAACAAGAAATTGAGCGACTGAGCAAGCTGTTGAGACAGAA
CGGACTTCTTGAGGACGTGAACGTGAACTAAGCCTTCCAGAAGCTCCATCCAG

hide sequence

RefSeq Acc Id:

XM_063271892 ⟹ XP_063127962

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	40,002,799 - 40,030,575 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001418664	(Get FASTA)	NCBI Sequence Viewer
	NP_001418665	(Get FASTA)	NCBI Sequence Viewer
	XP_017454007	(Get FASTA)	NCBI Sequence Viewer
	XP_063127962	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000001712.6
	ENSRNOP00000107152
	ENSRNOP00000110311

RefSeq Acc Id:

XP_017454007 ⟸ XM_017598518

- Peptide Label:

isoform X1

- Sequence:

show sequence

MTSHDQKAVTRRTKVAPTKRMSRFLKHFTVVGDDYHTWNVNYKKWENEEDEEEPAPTSAEGEGS
AVGPDAEAGSASTPRPSLDFRSRLRKLFSSHRFQVIIICLVVLDALLVLAELLLDLRIIEPDLS
VKKYSTKVFHYLSLAILAFFVLEISLKVFVFRLEFFHHKFEILDAIVVVVSFVLDLILLFKNHH
FEALGLLILLRLWRVARIINGIIISVKTRSERQILRLKQINLQLATKIQHLEFSCSEKEQEIER
LSKLLRQNGLLEDVNVN

hide sequence

Ensembl Acc Id:

ENSRNOP00000001712 ⟸ ENSRNOT00000001712

RefSeq Acc Id:	XP_063127962 ⟸ XM_063271892
- Peptide Label:	isoform X2

Ensembl Acc Id:

ENSRNOP00000110311 ⟸ ENSRNOT00000136202

Ensembl Acc Id:

ENSRNOP00000100312 ⟸ ENSRNOT00000130165

Ensembl Acc Id:

ENSRNOP00000107152 ⟸ ENSRNOT00000130199

Protein Domains

Ion transport Voltage-gated hydrogen channel 1 C-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZIU8-F1-model_v2	AlphaFold	D3ZIU8	1-273	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1310788	AgrOrtholog
BioCyc Gene	G2FUF-19238	BioCyc
Ensembl Genes	ENSRNOG00000001270	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000001712.7	UniProtKB/TrEMBL
	ENSRNOT00000130199	ENTREZGENE
	ENSRNOT00000136202	ENTREZGENE
Gene3D-CATH	1.20.120.350	UniProtKB/TrEMBL
	1.20.5.170	UniProtKB/TrEMBL
InterPro	Hvcn1	UniProtKB/TrEMBL
	Ion_trans	UniProtKB/TrEMBL
	VGPC1_C	UniProtKB/TrEMBL
	Volt_channel_dom_sf	UniProtKB/TrEMBL
KEGG Report	rno:304485	UniProtKB/TrEMBL
NCBI Gene	304485	ENTREZGENE
PANTHER	PTHR46480	UniProtKB/TrEMBL
	VOLTAGE-GATED HYDROGEN CHANNEL 1	UniProtKB/TrEMBL
Pfam	Ion_trans	UniProtKB/TrEMBL
	VGPC1_C	UniProtKB/TrEMBL
PhenoGen	Hvcn1	PhenoGen
RatGTEx	ENSRNOG00000001270	RatGTEx
Superfamily-SCOP	Voltage-gated potassium channels	UniProtKB/TrEMBL
UniProt	A6J1B3	ENTREZGENE, UniProtKB/TrEMBL
	D3ZIU8	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2012-08-24	Hvcn1	hydrogen voltage-gated channel 1	RGD1310788	similar to RIKEN cDNA 0610039P13	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	RGD1310788	similar to RIKEN cDNA 0610039P13	RGD1310788_predicted	similar to RIKEN cDNA 0610039P13 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-20	RGD1310788_predicted	similar to RIKEN cDNA 0610039P13 (predicted)	LOC304485_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC304485_predicted	similar to RIKEN cDNA 0610039P13 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Mammalian Phenotype