Advanced Search (OLGA)

Gene: Vnn1 (vanin 1) Rattus norvegicus

Analyze

Symbol:

Vnn1

Name:

vanin 1

RGD ID:

1310075

Description:

Predicted to enable pantetheine hydrolase activity. Predicted to be involved in several processes, including coenzyme A catabolic process; positive regulation of T cell differentiation in thymus; and positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway. Predicted to be located in plasma membrane and side of membrane. Orthologous to human VNN1 (vanin 1); PARTICIPATES IN pantothenic acid metabolic pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 17beta-estradiol; 2,2',4,4'-Tetrabromodiphenyl ether.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

MGC114385; pantetheinase; Tiff66

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	VNN1 (vanin 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Vnn1 (vanin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Vnn1 (vanin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	VNN1 (vanin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	VNN1 (vanin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Vnn1 (vanin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	VNN1 (vanin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	VNN1 (vanin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Vnn1 (vanin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	VNN2 (vanin 2)	HGNC	OrthoDB
Homo sapiens (human):	SLC36A2 (solute carrier family 36 member 2)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	VNN1 (vanin 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Vnn1 (vanin 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Btnd	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG32750	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG32751	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	vanin-like	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	vnn1	Alliance	DIOPT (OMA\|OrthoFinder\|PANTHER)

Allele / Splice:

Vnn1^em2Mcwi ; Vnn1^em1Mcwi

Genetic Models:

SS-Vnn1^em1Mcwi ; SS-Vnn1^em2Mcwi

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	23,356,324 - 23,366,629 (-)	NCBI		GRCr8
mRatBN7.2	1	21,537,084 - 21,547,395 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	21,537,094 - 21,547,395 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	21,316,351 - 21,326,676 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	27,316,396 - 27,326,721 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	21,513,723 - 21,524,007 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	22,614,832 - 22,625,134 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	22,614,783 - 22,625,204 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	24,089,365 - 24,099,667 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	22,087,290 - 22,097,592 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	22,090,508 - 22,100,537 (-)	NCBI
Celera	1	20,280,201 - 20,290,503 (-)	NCBI		Celera
Cytogenetic Map	1	p12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

RGD Manual Disease Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Vnn1	Rat	pancreatic ductal adenocarcinoma	disease_progression	ISO	RGD:1320770	151660329	protein:increased expression:blood (human)	RGD

Imported Disease Annotations - CTD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Vnn1	Rat	atopic dermatitis		ISO	RGD:1320770	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:19322213
Vnn1	Rat	celiac disease		ISO	RGD:1320770	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:30097691
Vnn1	Rat	Dyslipidemias		ISO	RGD:1320770	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:17873875
Vnn1	Rat	inflammatory bowel disease		ISO	RGD:1320770	11554173	CTD Direct Evidence: therapeutic	CTD	PMID:17145956
Vnn1	Rat	psoriasis		ISO	RGD:1320770	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:19322213

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Vnn1	Rat	(1->4)-beta-D-glucan	multiple interactions	ISO	RGD:1320771	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of VNN1 mRNA	CTD	PMID:36331819
Vnn1	Rat	1,1-dichloroethene	decreases expression	ISO	RGD:1320771	6480464	vinylidene chloride results in decreased expression of VNN1 mRNA	CTD	PMID:26682919
Vnn1	Rat	1,2-dichloroethane	increases expression	ISO	RGD:1320771	6480464	ethylene dichloride results in increased expression of VNN1 mRNA	CTD	PMID:28189721\|PMID:28960355
Vnn1	Rat	1,2-dimethylhydrazine	decreases expression	ISO	RGD:1320771	6480464	1,2-Dimethylhydrazine results in decreased expression of VNN1 mRNA	CTD	PMID:22206623
Vnn1	Rat	1-naphthyl isothiocyanate	decreases expression	EXP		6480464	1-Naphthylisothiocyanate results in decreased expression of VNN1 mRNA	CTD	PMID:30723492
Vnn1	Rat	17beta-estradiol	multiple interactions	ISO	RGD:1320770	6480464	[Estradiol co-treated with Norethindrone Acetate] results in increased expression of VNN1 mRNA; [Estradiol co-treated with more ...	CTD	PMID:20660070\|PMID:22217510
Vnn1	Rat	17beta-estradiol	affects expression	ISO	RGD:1320771	6480464	Estradiol affects the expression of VNN1 mRNA	CTD	PMID:39298647
Vnn1	Rat	17beta-estradiol	decreases expression	EXP		6480464	Estradiol results in decreased expression of VNN1 mRNA	CTD	PMID:32145629
Vnn1	Rat	2,2',4,4',5,5'-hexachlorobiphenyl	multiple interactions	ISO	RGD:1320771	6480464	[Tetrachlorodibenzodioxin co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with Diethylhexyl Phthalate co-treated with bisphenol A] results in increased more ...	CTD	PMID:28433925
Vnn1	Rat	2,2',4,4'-Tetrabromodiphenyl ether	increases expression	EXP		6480464	2,2',4,4'-tetrabromodiphenyl ether results in increased expression of VNN1 mRNA	CTD	PMID:27291303
Vnn1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	EXP		6480464	Tetrachlorodibenzodioxin affects the expression of VNN1 mRNA	CTD	PMID:22298810
Vnn1	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of VNN1 mRNA	CTD	PMID:33387578
Vnn1	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	RGD:1320771	6480464	[Tetrachlorodibenzodioxin co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with Diethylhexyl Phthalate co-treated with bisphenol A] results in increased more ...	CTD	PMID:28433925
Vnn1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	RGD:1320771	6480464	Tetrachlorodibenzodioxin affects the expression of VNN1 mRNA	CTD	PMID:26377647
Vnn1	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	RGD:1320771	6480464	Tetrachlorodibenzodioxin results in increased expression of VNN1 mRNA	CTD	PMID:15034205\|PMID:19770486\|PMID:19933214
Vnn1	Rat	2,4,6-trinitrobenzenesulfonic acid	increases expression	EXP		6480464	Trinitrobenzenesulfonic Acid results in increased expression of VNN1 mRNA; Trinitrobenzenesulfonic Acid results in increased expression more ...	CTD	PMID:23307618
Vnn1	Rat	2,4-dibromophenyl 2,4,5-tribromophenyl ether	affects expression	ISO	RGD:1320771	6480464	2,2',4,4',5-brominated diphenyl ether affects the expression of VNN1 mRNA	CTD	PMID:38648751
Vnn1	Rat	2,4-dinitrotoluene	affects expression	EXP		6480464	2,4-dinitrotoluene affects the expression of VNN1 mRNA	CTD	PMID:21346803
Vnn1	Rat	2,6-dinitrotoluene	affects expression	EXP		6480464	2,6-dinitrotoluene affects the expression of VNN1 mRNA	CTD	PMID:21346803
Vnn1	Rat	2-amino-2-deoxy-D-glucopyranose	increases expression	ISO	RGD:1320771	6480464	Glucosamine results in increased expression of VNN1 mRNA	CTD	PMID:17178593
Vnn1	Rat	3,3',4,4'-tetrachlorobiphenyl	multiple interactions	ISO	RGD:1320771	6480464	3,4,3',4'-tetrachlorobiphenyl inhibits the reaction [Dietary Fats results in increased expression of VNN1 mRNA]	CTD	PMID:19467301
Vnn1	Rat	3-chloropropane-1,2-diol	decreases expression	EXP		6480464	alpha-Chlorohydrin results in decreased expression of VNN1 protein	CTD	PMID:34915118
Vnn1	Rat	4,4'-diaminodiphenylmethane	decreases expression	ISO	RGD:1320771	6480464	4,4'-diaminodiphenylmethane results in decreased expression of VNN1 mRNA	CTD	PMID:18648102
Vnn1	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	RGD:1320771	6480464	bisphenol S results in increased expression of VNN1 mRNA	CTD	PMID:30951980\|PMID:34850234\|PMID:39298647
Vnn1	Rat	4-hydroxyphenyl retinamide	decreases expression	ISO	RGD:1320771	6480464	Fenretinide results in decreased expression of VNN1 mRNA	CTD	PMID:28973697
Vnn1	Rat	5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole	affects expression	EXP		6480464	Omeprazole affects the expression of VNN1 mRNA	CTD	PMID:19483382
Vnn1	Rat	6-propyl-2-thiouracil	affects expression	EXP		6480464	Propylthiouracil affects the expression of VNN1 mRNA	CTD	PMID:19483382
Vnn1	Rat	acetamide	decreases expression	EXP		6480464	acetamide results in decreased expression of VNN1 mRNA	CTD	PMID:31881176
Vnn1	Rat	aldehydo-D-glucosamine	increases expression	ISO	RGD:1320771	6480464	Glucosamine results in increased expression of VNN1 mRNA	CTD	PMID:17178593
Vnn1	Rat	allyl alcohol	increases expression	ISO	RGD:1320770	6480464	allyl alcohol results in increased expression of VNN1 mRNA	CTD	PMID:21907259
Vnn1	Rat	alpha-Zearalanol	multiple interactions	EXP		6480464	[Zeranol co-treated with perfluorooctanoic acid] results in increased expression of VNN1 mRNA	CTD	PMID:35163327
Vnn1	Rat	amiodarone	affects expression	EXP		6480464	Amiodarone affects the expression of VNN1 mRNA	CTD	PMID:19483382
Vnn1	Rat	amiodarone	increases expression	ISO	RGD:1320771	6480464	Amiodarone results in increased expression of VNN1 mRNA	CTD	PMID:24535564
Vnn1	Rat	amphotericin B	decreases expression	ISO	RGD:1320770	6480464	Amphotericin B analog results in decreased expression of VNN1 mRNA	CTD	PMID:28534445
Vnn1	Rat	arsenous acid	decreases expression	ISO	RGD:1320770	6480464	Arsenic Trioxide results in decreased expression of VNN1 mRNA	CTD	PMID:15761015
Vnn1	Rat	azathioprine	increases expression	ISO	RGD:1320770	6480464	Azathioprine results in increased expression of VNN1 mRNA	CTD	PMID:22623647
Vnn1	Rat	benzbromarone	affects expression	EXP		6480464	Benzbromarone affects the expression of VNN1 mRNA	CTD	PMID:19483382
Vnn1	Rat	benzo[a]pyrene	increases expression	ISO	RGD:1320770	6480464	Benzo(a)pyrene results in increased expression of VNN1 mRNA	CTD	PMID:20106945\|PMID:21632981\|PMID:21871943
Vnn1	Rat	benzo[a]pyrene	decreases expression	ISO	RGD:1320771	6480464	Benzo(a)pyrene results in decreased expression of VNN1 mRNA	CTD	PMID:32417428
Vnn1	Rat	benzo[a]pyrene	increases methylation	ISO	RGD:1320770	6480464	Benzo(a)pyrene results in increased methylation of VNN1 promoter	CTD	PMID:27901495
Vnn1	Rat	benzo[a]pyrene	increases expression	ISO	RGD:1320771	6480464	Benzo(a)pyrene results in increased expression of VNN1 mRNA	CTD	PMID:15034205
Vnn1	Rat	benzo[a]pyrene	multiple interactions	ISO	RGD:1320771	6480464	AHR protein promotes the reaction [Benzo(a)pyrene results in increased expression of VNN1 mRNA]	CTD	PMID:15034205
Vnn1	Rat	beta-D-glucosamine	increases expression	ISO	RGD:1320771	6480464	Glucosamine results in increased expression of VNN1 mRNA	CTD	PMID:17178593
Vnn1	Rat	beta-naphthoflavone	multiple interactions	EXP		6480464	[Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of VNN1 mRNA	CTD	PMID:18164116
Vnn1	Rat	bis(2-ethylhexyl) phthalate	multiple interactions	ISO	RGD:1320771	6480464	[Tetrachlorodibenzodioxin co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with Diethylhexyl Phthalate co-treated with bisphenol A] results in increased more ...	CTD	PMID:19850644\|PMID:28433925
Vnn1	Rat	bis(2-ethylhexyl) phthalate	increases expression	ISO	RGD:1320771	6480464	Diethylhexyl Phthalate results in increased expression of VNN1 mRNA	CTD	PMID:19245819\|PMID:19850644\|PMID:33754040
Vnn1	Rat	bisphenol A	decreases expression	ISO	RGD:1320771	6480464	bisphenol A results in decreased expression of VNN1 mRNA	CTD	PMID:26063408\|PMID:30951980\|PMID:33221593
Vnn1	Rat	bisphenol A	increases expression	ISO	RGD:1320771	6480464	bisphenol A results in increased expression of VNN1 mRNA	CTD	PMID:38701888
Vnn1	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of VNN1 mRNA	CTD	PMID:33296240
Vnn1	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of VNN1 mRNA	CTD	PMID:30816183\|PMID:32528016
Vnn1	Rat	bisphenol A	multiple interactions	ISO	RGD:1320771	6480464	[Tetrachlorodibenzodioxin co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with Diethylhexyl Phthalate co-treated with bisphenol A] results in increased more ...	CTD	PMID:28433925
Vnn1	Rat	bisphenol A	affects expression	EXP		6480464	bisphenol A affects the expression of VNN1 mRNA	CTD	PMID:25181051\|PMID:32145629
Vnn1	Rat	bisphenol AF	increases expression	ISO	RGD:1320771	6480464	bisphenol AF results in increased expression of VNN1 mRNA	CTD	PMID:34850234
Vnn1	Rat	bisphenol F	increases expression	ISO	RGD:1320771	6480464	bisphenol F results in increased expression of VNN1 mRNA	CTD	PMID:30951980
Vnn1	Rat	bosentan	affects expression	ISO	RGD:1320770	6480464	Bosentan affects the expression of VNN1 mRNA	CTD	PMID:29761207
Vnn1	Rat	buspirone	increases expression	EXP		6480464	Buspirone results in increased expression of VNN1 mRNA	CTD	PMID:24136188
Vnn1	Rat	butanal	increases expression	ISO	RGD:1320770	6480464	butyraldehyde results in increased expression of VNN1 mRNA	CTD	PMID:26079696
Vnn1	Rat	cadmium atom	multiple interactions	ISO	RGD:1320770	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of VNN1 more ...	CTD	PMID:35301059
Vnn1	Rat	cadmium dichloride	decreases expression	ISO	RGD:1320771	6480464	Cadmium Chloride results in decreased expression of VNN1 mRNA	CTD	PMID:24982889
Vnn1	Rat	cadmium dichloride	multiple interactions	ISO	RGD:1320770	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of VNN1 more ...	CTD	PMID:35301059
Vnn1	Rat	cadmium dichloride	increases expression	ISO	RGD:1320770	6480464	Cadmium Chloride results in increased expression of VNN1 mRNA	CTD	PMID:38382870
Vnn1	Rat	carbon nanotube	affects expression	ISO	RGD:1320771	6480464	Nanotubes, Carbon affects the expression of VNN1 mRNA	CTD	PMID:25554681\|PMID:25620056
Vnn1	Rat	carbon nanotube	increases expression	ISO	RGD:1320771	6480464	Nanotubes, Carbon analog results in increased expression of VNN1 mRNA	CTD	PMID:25554681\|PMID:25620056
Vnn1	Rat	chlordecone	decreases expression	ISO	RGD:1320771	6480464	Chlordecone results in decreased expression of VNN1 mRNA	CTD	PMID:33711761
Vnn1	Rat	chloroform	increases expression	ISO	RGD:1320770	6480464	Chloroform results in increased expression of VNN1 mRNA	CTD	PMID:21907259
Vnn1	Rat	chlorpyrifos	increases expression	EXP		6480464	Chlorpyrifos results in increased expression of VNN1 mRNA	CTD	PMID:20691718
Vnn1	Rat	chlorpyrifos	increases expression	ISO	RGD:1320771	6480464	Chlorpyrifos results in increased expression of VNN1 mRNA	CTD	PMID:37019170
Vnn1	Rat	choline	multiple interactions	ISO	RGD:1320771	6480464	[Dietary Fats co-treated with Choline deficiency] results in increased expression of VNN1 mRNA; [Methionine co-treated more ...	CTD	PMID:29246445\|PMID:33549593
Vnn1	Rat	ciglitazone	multiple interactions	ISO	RGD:1320770	6480464	[ciglitazone binds to PPARG protein alternative form] which results in increased expression of VNN1 mRNA	CTD	PMID:16197558
Vnn1	Rat	cisplatin	increases expression	ISO	RGD:1320770	6480464	Cisplatin results in increased expression of VNN1	CTD	PMID:27317936
Vnn1	Rat	Citreoviridin	decreases expression	ISO	RGD:1320771	6480464	citreoviridin results in decreased expression of VNN1 mRNA	CTD	PMID:28645467
Vnn1	Rat	Citreoviridin	decreases expression	ISO	RGD:1320770	6480464	citreoviridin results in decreased expression of VNN1 mRNA	CTD	PMID:28645467
Vnn1	Rat	clofibrate	multiple interactions	ISO	RGD:1320771	6480464	[Clofibrate co-treated with Acetaminophen] affects the expression of VNN1 mRNA; PPARA affects the reaction [[Clofibrate more ...	CTD	PMID:17585979
Vnn1	Rat	clofibrate	increases expression	EXP		6480464	Clofibrate results in increased expression of VNN1 mRNA	CTD	PMID:27665778\|PMID:32741897
Vnn1	Rat	clofibrate	increases expression	ISO	RGD:1320771	6480464	Clofibrate results in increased expression of VNN1 mRNA	CTD	PMID:17585979\|PMID:23811191\|PMID:30629241
Vnn1	Rat	clofibrate	affects expression	EXP		6480464	Clofibrate affects the expression of VNN1 mRNA	CTD	PMID:19483382
Vnn1	Rat	Clofop	multiple interactions	ISO	RGD:1320770	6480464	[fenofibric acid binds to PPARA protein] which results in increased expression of VNN1 mRNA	CTD	PMID:16197558
Vnn1	Rat	cobalt dichloride	decreases expression	EXP		6480464	cobaltous chloride results in decreased expression of VNN1 mRNA	CTD	PMID:24386269
Vnn1	Rat	copper(II) sulfate	increases expression	ISO	RGD:1320770	6480464	Copper Sulfate results in increased expression of VNN1 mRNA	CTD	PMID:19549813
Vnn1	Rat	corn oil	affects expression	EXP		6480464	Corn Oil affects the expression of VNN1 mRNA	CTD	PMID:16360708
Vnn1	Rat	cyanocob(III)alamin	multiple interactions	ISO	RGD:1320771	6480464	[Methionine co-treated with Choline co-treated with Folic Acid co-treated with Betaine co-treated with Vitamin B more ...	CTD	PMID:33549593
Vnn1	Rat	cyclosporin A	decreases expression	ISO	RGD:1320770	6480464	Cyclosporine results in decreased expression of VNN1 mRNA	CTD	PMID:20106945
Vnn1	Rat	cyclosporin A	increases expression	ISO	RGD:1320770	6480464	Cyclosporine results in increased expression of VNN1 mRNA	CTD	PMID:25562108\|PMID:27989131
Vnn1	Rat	cyclosporin A	decreases expression	ISO	RGD:1320771	6480464	Cyclosporine results in decreased expression of VNN1 mRNA	CTD	PMID:19770486
Vnn1	Rat	cysteamine	increases chemical synthesis	ISO	RGD:1320771	6480464	VNN1 results in increased chemical synthesis of Cysteamine	CTD	PMID:11042271
Vnn1	Rat	cysteamine	multiple interactions	ISO	RGD:1320771	6480464	Cysteamine inhibits the reaction [VNN1 gene mutant form results in decreased susceptibility to Paraquat]	CTD	PMID:15282320
Vnn1	Rat	dapagliflozin	multiple interactions	EXP		6480464	dapagliflozin inhibits the reaction [[Streptozocin co-treated with Fructose] results in increased expression of VNN1 mRNA]	CTD	PMID:30551545
Vnn1	Rat	decabromodiphenyl ether	increases expression	EXP		6480464	decabromobiphenyl ether results in increased expression of VNN1 mRNA	CTD	PMID:23640034
Vnn1	Rat	diarsenic trioxide	decreases expression	ISO	RGD:1320770	6480464	Arsenic Trioxide results in decreased expression of VNN1 mRNA	CTD	PMID:15761015
Vnn1	Rat	dibenzofurans	increases expression	ISO	RGD:1320771	6480464	Dibenzofurans results in increased expression of VNN1 mRNA	CTD	PMID:34254344
Vnn1	Rat	Dibutyl phosphate	affects expression	ISO	RGD:1320770	6480464	di-n-butylphosphoric acid affects the expression of VNN1 mRNA	CTD	PMID:37042841
Vnn1	Rat	dibutyl phthalate	increases expression	ISO	RGD:1320771	6480464	Dibutyl Phthalate results in increased expression of VNN1 mRNA	CTD	PMID:21266533
Vnn1	Rat	dichloroacetic acid	increases expression	ISO	RGD:1320771	6480464	Dichloroacetic Acid results in increased expression of VNN1 mRNA	CTD	PMID:28962523
Vnn1	Rat	dicrotophos	decreases expression	ISO	RGD:1320770	6480464	dicrotophos results in decreased expression of VNN1 mRNA	CTD	PMID:28302478
Vnn1	Rat	diethylstilbestrol	decreases expression	ISO	RGD:1320771	6480464	Diethylstilbestrol results in decreased expression of VNN1 mRNA	CTD	PMID:15171707
Vnn1	Rat	dimethylarsinic acid	multiple interactions	ISO	RGD:1320771	6480464	[sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results more ...	CTD	PMID:34876320
Vnn1	Rat	diquat	increases expression	ISO	RGD:1320771	6480464	Diquat results in increased expression of VNN1 mRNA	CTD	PMID:36851058
Vnn1	Rat	diuron	decreases expression	EXP		6480464	Diuron results in decreased expression of VNN1 mRNA	CTD	PMID:21551480\|PMID:25152437
Vnn1	Rat	endosulfan	decreases expression	EXP		6480464	Endosulfan results in decreased expression of VNN1 mRNA	CTD	PMID:29391264
Vnn1	Rat	epoxiconazole	decreases expression	ISO	RGD:1320771	6480464	epoxiconazole results in decreased expression of VNN1 mRNA	CTD	PMID:35436446
Vnn1	Rat	ethylene glycol	increases expression	EXP		6480464	Ethylene Glycol results in increased expression of VNN1 mRNA; Ethylene Glycol results in increased expression more ...	CTD	PMID:21907259
Vnn1	Rat	ethylene glycol	increases expression	ISO	RGD:1320770	6480464	Ethylene Glycol results in increased expression of VNN1 mRNA	CTD	PMID:21907259
Vnn1	Rat	fenofibrate	increases expression	ISO	RGD:1320771	6480464	Fenofibrate results in increased expression of VNN1 mRNA	CTD	PMID:11798191
Vnn1	Rat	fenofibrate	increases expression	EXP		6480464	Fenofibrate results in increased expression of VNN1 mRNA	CTD	PMID:27665778\|PMID:32741897
Vnn1	Rat	fenofibrate	increases expression	ISO	RGD:1320770	6480464	Fenofibrate results in increased expression of VNN1 mRNA	CTD	PMID:25572481
Vnn1	Rat	finasteride	increases expression	EXP		6480464	Finasteride results in increased expression of VNN1 mRNA	CTD	PMID:24136188
Vnn1	Rat	fipronil	increases expression	EXP		6480464	fipronil results in increased expression of VNN1 mRNA	CTD	PMID:31881178
Vnn1	Rat	flutamide	decreases expression	EXP		6480464	Flutamide results in decreased expression of VNN1 mRNA	CTD	PMID:24136188\|PMID:24793618
Vnn1	Rat	folic acid	multiple interactions	ISO	RGD:1320771	6480464	[Methionine co-treated with Choline co-treated with Folic Acid co-treated with Betaine co-treated with Vitamin B more ...	CTD	PMID:33549593
Vnn1	Rat	formaldehyde	increases expression	ISO	RGD:1320770	6480464	Formaldehyde results in increased expression of VNN1 mRNA	CTD	PMID:21907259\|PMID:23649840
Vnn1	Rat	fructose	multiple interactions	EXP		6480464	[Streptozocin co-treated with Fructose] results in increased expression of VNN1 mRNA; dapagliflozin inhibits the reaction more ...	CTD	PMID:30551545
Vnn1	Rat	gemfibrozil	increases expression	EXP		6480464	Gemfibrozil results in increased expression of VNN1 mRNA	CTD	PMID:27665778
Vnn1	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of VNN1 mRNA	CTD	PMID:33387578
Vnn1	Rat	glafenine	decreases expression	EXP		6480464	Glafenine results in decreased expression of VNN1 mRNA	CTD	PMID:24136188
Vnn1	Rat	glutathione	affects abundance	ISO	RGD:1320771	6480464	VNN1 affects the abundance of Glutathione	CTD	PMID:15282320
Vnn1	Rat	glycine betaine	multiple interactions	ISO	RGD:1320771	6480464	[Methionine co-treated with Choline co-treated with Folic Acid co-treated with Betaine co-treated with Vitamin B more ...	CTD	PMID:33549593
Vnn1	Rat	GW 4064	increases expression	ISO	RGD:1320771	6480464	GW 4064 results in increased expression of VNN1 mRNA	CTD	PMID:26655953
Vnn1	Rat	hydrogen peroxide	increases expression	ISO	RGD:1320771	6480464	Hydrogen Peroxide results in increased expression of VNN1 mRNA; Hydrogen Peroxide results in increased expression more ...	CTD	PMID:15282320
Vnn1	Rat	indole-3-methanol	affects expression	EXP		6480464	indole-3-carbinol affects the expression of VNN1 mRNA	CTD	PMID:21396975
Vnn1	Rat	indole-3-methanol	multiple interactions	EXP		6480464	[indole-3-carbinol co-treated with Diethylnitrosamine co-treated with Acetylcysteine] results in increased expression of VNN1 mRNA; [indole-3-carbinol more ...	CTD	PMID:22129741
Vnn1	Rat	inulin	multiple interactions	ISO	RGD:1320771	6480464	[perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of VNN1 mRNA	CTD	PMID:36331819
Vnn1	Rat	L-ethionine	affects expression	EXP		6480464	Ethionine affects the expression of VNN1 mRNA	CTD	PMID:19483382
Vnn1	Rat	L-methionine	multiple interactions	ISO	RGD:1320771	6480464	[Methionine co-treated with Choline co-treated with Folic Acid co-treated with Betaine co-treated with Vitamin B more ...	CTD	PMID:33549593
Vnn1	Rat	leflunomide	increases expression	ISO	RGD:1320770	6480464	leflunomide results in increased expression of VNN1 mRNA	CTD	PMID:28988120
Vnn1	Rat	leflunomide	increases expression	EXP		6480464	leflunomide results in increased expression of VNN1 mRNA	CTD	PMID:24136188
Vnn1	Rat	metformin	multiple interactions	EXP		6480464	Metformin inhibits the reaction [[Streptozocin co-treated with Fructose] results in increased expression of VNN1 mRNA]	CTD	PMID:30551545
Vnn1	Rat	methapyrilene	decreases expression	EXP		6480464	Methapyrilene results in decreased expression of VNN1 mRNA	CTD	PMID:30467583
Vnn1	Rat	methotrexate	affects expression	ISO	RGD:1320771	6480464	Methotrexate affects the expression of VNN1 mRNA	CTD	PMID:18502557
Vnn1	Rat	methylarsonic acid	multiple interactions	ISO	RGD:1320771	6480464	[sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results more ...	CTD	PMID:34876320
Vnn1	Rat	Muraglitazar	increases expression	EXP		6480464	muraglitazar results in increased expression of VNN1 mRNA	CTD	PMID:21515302
Vnn1	Rat	N-acetyl-L-cysteine	multiple interactions	EXP		6480464	[indole-3-carbinol co-treated with Diethylnitrosamine co-treated with Acetylcysteine] results in increased expression of VNN1 mRNA	CTD	PMID:22129741
Vnn1	Rat	N-nitrosodiethylamine	multiple interactions	EXP		6480464	[Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of VNN1 mRNA; [indole-3-carbinol co-treated with Diethylnitrosamine more ...	CTD	PMID:18164116\|PMID:22129741
Vnn1	Rat	N-nitrosodiethylamine	increases expression	ISO	RGD:1320771	6480464	Diethylnitrosamine results in increased expression of VNN1 mRNA	CTD	PMID:24535843
Vnn1	Rat	nefazodone	increases expression	EXP		6480464	nefazodone results in increased expression of VNN1 mRNA	CTD	PMID:24136188
Vnn1	Rat	nimesulide	increases expression	EXP		6480464	nimesulide results in increased expression of VNN1 mRNA	CTD	PMID:24136188
Vnn1	Rat	nitrofen	increases expression	EXP		6480464	nitrofen results in increased expression of VNN1 mRNA	CTD	PMID:33484710
Vnn1	Rat	ochratoxin A	increases expression	EXP		6480464	ochratoxin A results in increased expression of VNN1 mRNA	CTD	PMID:23358140
Vnn1	Rat	oleic acid	multiple interactions	ISO	RGD:1320770	6480464	Oleic Acid promotes the reaction [[Vehicle Emissions results in increased abundance of Particulate Matter] which more ...	CTD	PMID:31340670
Vnn1	Rat	omeprazole	affects expression	EXP		6480464	Omeprazole affects the expression of VNN1 mRNA	CTD	PMID:19483382
Vnn1	Rat	orphenadrine	affects expression	EXP		6480464	Orphenadrine affects the expression of VNN1 mRNA	CTD	PMID:23665939
Vnn1	Rat	ozone	multiple interactions	ISO	RGD:1320771	6480464	[Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased more ...	CTD	PMID:34911549
Vnn1	Rat	paracetamol	multiple interactions	ISO	RGD:1320771	6480464	[Clofibrate co-treated with Acetaminophen] affects the expression of VNN1 mRNA; PANX1 gene mutant form inhibits more ...	CTD	PMID:17585979\|PMID:29246445
Vnn1	Rat	paracetamol	decreases expression	EXP		6480464	Acetaminophen results in decreased expression of VNN1 mRNA	CTD	PMID:33387578
Vnn1	Rat	paracetamol	decreases expression	ISO	RGD:1320771	6480464	Acetaminophen results in decreased expression of VNN1 mRNA	CTD	PMID:29246445
Vnn1	Rat	paracetamol	decreases expression	ISO	RGD:1320770	6480464	Acetaminophen results in decreased expression of VNN1 mRNA	CTD	PMID:21420995\|PMID:29067470
Vnn1	Rat	paraquat	multiple interactions	ISO	RGD:1320771	6480464	Cysteamine inhibits the reaction [VNN1 gene mutant form results in decreased susceptibility to Paraquat]	CTD	PMID:15282320
Vnn1	Rat	paraquat	decreases expression	EXP		6480464	Paraquat results in decreased expression of VNN1 mRNA	CTD	PMID:32680482
Vnn1	Rat	paraquat	decreases response to substance	ISO	RGD:1320771	6480464	VNN1 gene mutant form results in decreased susceptibility to Paraquat	CTD	PMID:15282320
Vnn1	Rat	pentachlorophenol	increases expression	ISO	RGD:1320771	6480464	Pentachlorophenol results in increased expression of VNN1 mRNA	CTD	PMID:23892564
Vnn1	Rat	perfluorononanoic acid	decreases expression	ISO	RGD:1320770	6480464	perfluoro-n-nonanoic acid results in decreased expression of VNN1 mRNA	CTD	PMID:32588087
Vnn1	Rat	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	RGD:1320771	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of VNN1 mRNA; [perfluorooctane sulfonic more ...	CTD	PMID:36331819
Vnn1	Rat	perfluorooctanoic acid	multiple interactions	ISO	RGD:1320771	6480464	PPARA gene mutant form inhibits the reaction [perfluorooctanoic acid results in increased expression of VNN1 more ...	CTD	PMID:32822737
Vnn1	Rat	perfluorooctanoic acid	increases expression	EXP		6480464	perfluorooctanoic acid results in increased expression of VNN1 mRNA; perfluorooctanoic acid results in increased expression more ...	CTD	PMID:28511854\|PMID:34958885
Vnn1	Rat	perfluorooctanoic acid	multiple interactions	EXP		6480464	[Zeranol co-treated with perfluorooctanoic acid] results in increased expression of VNN1 mRNA	CTD	PMID:35163327
Vnn1	Rat	perfluorooctanoic acid	increases expression	ISO	RGD:1320771	6480464	perfluorooctanoic acid results in increased expression of VNN1 mRNA	CTD	PMID:32822737
Vnn1	Rat	permethrin	increases expression	ISO	RGD:1320771	6480464	Permethrin results in increased expression of VNN1 mRNA	CTD	PMID:30629241
Vnn1	Rat	phenformin	increases expression	EXP		6480464	Phenformin results in increased expression of VNN1 mRNA	CTD	PMID:31324951
Vnn1	Rat	phenobarbital	increases expression	ISO	RGD:1320771	6480464	Phenobarbital results in increased expression of VNN1 mRNA	CTD	PMID:19482888
Vnn1	Rat	phenobarbital	multiple interactions	ISO	RGD:1320771	6480464	NR1I3 protein affects the reaction [Phenobarbital results in increased expression of VNN1 mRNA]	CTD	PMID:19482888
Vnn1	Rat	phenol	increases expression	ISO	RGD:1320770	6480464	Phenol results in increased expression of VNN1 mRNA	CTD	PMID:21907259
Vnn1	Rat	piperonyl butoxide	increases expression	EXP		6480464	Piperonyl Butoxide results in increased expression of VNN1 mRNA	CTD	PMID:22484513
Vnn1	Rat	pirinixic acid	affects expression	EXP		6480464	pirinixic acid affects the expression of VNN1 mRNA	CTD	PMID:19483382
Vnn1	Rat	pirinixic acid	increases expression	ISO	RGD:1320771	6480464	pirinixic acid results in increased expression of VNN1 mRNA	CTD	PMID:11798191\|PMID:17426115\|PMID:18301758\|PMID:20059764\|PMID:23811191
Vnn1	Rat	pirinixic acid	increases expression	EXP		6480464	pirinixic acid results in increased expression of VNN1 mRNA	CTD	PMID:22484513\|PMID:27665778\|PMID:32741897
Vnn1	Rat	pirinixic acid	multiple interactions	ISO	RGD:1320771	6480464	PPARA protein promotes the reaction [pirinixic acid results in increased expression of VNN1 mRNA]	CTD	PMID:20059764
Vnn1	Rat	pravastatin	decreases expression	ISO	RGD:1320771	6480464	Pravastatin results in decreased expression of VNN1 mRNA	CTD	PMID:27225895
Vnn1	Rat	progesterone	multiple interactions	ISO	RGD:1320770	6480464	[Estradiol co-treated with Progesterone] results in decreased expression of VNN1 mRNA	CTD	PMID:20660070
Vnn1	Rat	propanal	increases expression	ISO	RGD:1320770	6480464	propionaldehyde results in increased expression of VNN1 mRNA	CTD	PMID:26079696
Vnn1	Rat	quercetin	increases expression	ISO	RGD:1320770	6480464	Quercetin results in increased expression of VNN1 mRNA	CTD	PMID:21632981
Vnn1	Rat	reactive oxygen species	affects abundance	ISO	RGD:1320771	6480464	VNN1 affects the abundance of Reactive Oxygen Species	CTD	PMID:15282320
Vnn1	Rat	resveratrol	multiple interactions	ISO	RGD:1320771	6480464	Resveratrol inhibits the reaction [titanium dioxide results in increased expression of VNN1 mRNA]	CTD	PMID:31298478
Vnn1	Rat	rotenone	increases expression	EXP		6480464	Rotenone results in increased expression of VNN1 mRNA	CTD	PMID:28374803
Vnn1	Rat	silicon dioxide	increases expression	ISO	RGD:1320771	6480464	Silicon Dioxide results in increased expression of VNN1 mRNA	CTD	PMID:23221170\|PMID:29341224\|PMID:38811393
Vnn1	Rat	sodium arsenate	multiple interactions	ISO	RGD:1320771	6480464	[sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results more ...	CTD	PMID:34876320
Vnn1	Rat	sodium arsenite	decreases expression	ISO	RGD:1320771	6480464	sodium arsenite results in decreased expression of VNN1 mRNA	CTD	PMID:37682722
Vnn1	Rat	sodium arsenite	multiple interactions	ISO	RGD:1320771	6480464	[sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results more ...	CTD	PMID:34876320
Vnn1	Rat	spirotetramat	decreases expression	ISO	RGD:1320771	6480464	spirotetramat results in decreased expression of VNN1 mRNA	CTD	PMID:27917277
Vnn1	Rat	streptozocin	multiple interactions	EXP		6480464	[Streptozocin co-treated with Fructose] results in increased expression of VNN1 mRNA; dapagliflozin inhibits the reaction more ...	CTD	PMID:30551545
Vnn1	Rat	Tesaglitazar	increases expression	EXP		6480464	tesaglitazar results in increased expression of VNN1 mRNA	CTD	PMID:21515302
Vnn1	Rat	tetrachloroethene	increases expression	ISO	RGD:1320771	6480464	Tetrachloroethylene results in increased expression of VNN1 mRNA	CTD	PMID:28973375
Vnn1	Rat	tetrachloromethane	decreases expression	ISO	RGD:1320771	6480464	Carbon Tetrachloride results in decreased expression of VNN1 mRNA	CTD	PMID:27339419\|PMID:31919559
Vnn1	Rat	thallium atom	multiple interactions	EXP		6480464	[thallium sulfate results in increased abundance of Thallium] which results in increased expression of VNN1 more ...	CTD	PMID:39361050
Vnn1	Rat	thallium sulfate	multiple interactions	EXP		6480464	[thallium sulfate results in increased abundance of Thallium] which results in increased expression of VNN1 more ...	CTD	PMID:39361050
Vnn1	Rat	thioacetamide	affects expression	EXP		6480464	Thioacetamide affects the expression of VNN1 mRNA	CTD	PMID:19483382
Vnn1	Rat	thioacetamide	decreases expression	EXP		6480464	Thioacetamide results in decreased expression of VNN1 mRNA	CTD	PMID:34492290
Vnn1	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of VNN1 mRNA	CTD	PMID:23411599
Vnn1	Rat	titanium dioxide	increases expression	ISO	RGD:1320771	6480464	titanium dioxide results in increased expression of VNN1 mRNA	CTD	PMID:21259345\|PMID:23557971\|PMID:27760801\|PMID:31298478
Vnn1	Rat	titanium dioxide	multiple interactions	ISO	RGD:1320771	6480464	Resveratrol inhibits the reaction [titanium dioxide results in increased expression of VNN1 mRNA]	CTD	PMID:31298478
Vnn1	Rat	trichloroethene	increases expression	EXP		6480464	Trichloroethylene results in increased expression of VNN1 mRNA	CTD	PMID:17905399
Vnn1	Rat	trichloroethene	increases expression	ISO	RGD:1320771	6480464	Trichloroethylene results in increased expression of VNN1 mRNA	CTD	PMID:19448997\|PMID:25549359\|PMID:28973375
Vnn1	Rat	triphenyl phosphate	affects expression	ISO	RGD:1320770	6480464	triphenyl phosphate affects the expression of VNN1 mRNA	CTD	PMID:37042841
Vnn1	Rat	tris(2-butoxyethyl) phosphate	affects expression	ISO	RGD:1320770	6480464	tris(2-butoxyethyl) phosphate affects the expression of VNN1 mRNA	CTD	PMID:29024780
Vnn1	Rat	troglitazone	increases expression	EXP		6480464	troglitazone results in increased expression of VNN1 mRNA	CTD	PMID:21515302
Vnn1	Rat	troglitazone	increases expression	ISO	RGD:1320770	6480464	troglitazone results in increased expression of VNN1 mRNA	CTD	PMID:25572481
Vnn1	Rat	troglitazone	increases expression	ISO	RGD:1320771	6480464	troglitazone results in increased expression of VNN1 mRNA	CTD	PMID:28973697
Vnn1	Rat	valdecoxib	increases expression	EXP		6480464	valdecoxib results in increased expression of VNN1 mRNA	CTD	PMID:24136188
Vnn1	Rat	valproic acid	affects expression	ISO	RGD:1320771	6480464	Valproic Acid affects the expression of VNN1 mRNA	CTD	PMID:17292431
Vnn1	Rat	valproic acid	increases expression	ISO	RGD:1320771	6480464	Valproic Acid results in increased expression of VNN1 mRNA	CTD	PMID:24535564
Vnn1	Rat	zaragozic acid A	decreases expression	ISO	RGD:1320771	6480464	squalestatin 1 results in decreased expression of VNN1 mRNA	CTD	PMID:27225895
Vnn1	Rat	zaragozic acid A	increases expression	EXP		6480464	squalestatin 1 results in increased expression of VNN1 mRNA	CTD	PMID:27225895
Vnn1	Rat	zinc atom	affects expression	ISO	RGD:1320770	6480464	Zinc affects the expression of VNN1 mRNA	CTD	PMID:16979875
Vnn1	Rat	zinc atom	multiple interactions	ISO	RGD:1320771	6480464	[Methionine co-treated with Choline co-treated with Folic Acid co-treated with Betaine co-treated with Vitamin B more ...	CTD	PMID:33549593
Vnn1	Rat	zinc(0)	affects expression	ISO	RGD:1320770	6480464	Zinc affects the expression of VNN1 mRNA	CTD	PMID:16979875
Vnn1	Rat	zinc(0)	multiple interactions	ISO	RGD:1320771	6480464	[Methionine co-treated with Choline co-treated with Folic Acid co-treated with Betaine co-treated with Vitamin B more ...	CTD	PMID:33549593
Vnn1	Rat	zoledronic acid	increases expression	ISO	RGD:1320770	6480464	zoledronic acid results in increased expression of VNN1 mRNA	CTD	PMID:24714768

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Vnn1	Rat	acute inflammatory response	involved_in	ISO	RGD:1320771	1624291	PMID:14966568	RGD	PMID:14966568
Vnn1	Rat	acute inflammatory response	involved_in	IEA	UniProtKB:Q9Z0K8\|ensembl:ENSMUSP00000040599	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Vnn1	Rat	biological_process		ND		1598407	02/2009: no relevant rat data.	RGD
Vnn1	Rat	cell-cell adhesion	involved_in	ISO	RGD:1320771	1624291	PMID:8934567	RGD	PMID:8934567
Vnn1	Rat	cell-cell adhesion	involved_in	IEA	UniProtKB:Q9Z0K8\|ensembl:ENSMUSP00000040599	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Vnn1	Rat	chronic inflammatory response	involved_in	ISO	RGD:1320771	1624291	PMID:14966568	RGD	PMID:14966568
Vnn1	Rat	chronic inflammatory response	involved_in	IEA	UniProtKB:Q9Z0K8\|ensembl:ENSMUSP00000040599	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Vnn1	Rat	coenzyme A catabolic process	involved_in	ISO	RGD:1320771	1624291	MGI:3027932 PMID:11042271	RGD	PMID:11042271
Vnn1	Rat	coenzyme A catabolic process	involved_in	IEA	UniProtKB:Q9Z0K8\|ensembl:ENSMUSP00000040599	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Vnn1	Rat	inflammatory response	involved_in	IEA	UniProtKB:Q9Z0K8\|ensembl:ENSMUSP00000040599	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Vnn1	Rat	inflammatory response	involved_in	ISO	RGD:1320771	1624291	PMID:15282320	RGD	PMID:15282320
Vnn1	Rat	innate immune response	involved_in	ISO	RGD:1320771	1624291	PMID:14966568	RGD	PMID:14966568
Vnn1	Rat	innate immune response	involved_in	IEA	UniProtKB:Q9Z0K8\|ensembl:ENSMUSP00000040599	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Vnn1	Rat	pantothenate metabolic process	involved_in	IEA	UniProtKB:O95497\|ensembl:ENSP00000356905	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Vnn1	Rat	pantothenate metabolic process	involved_in	IBA	MGI:1347055\|PANTHER:PTN008502038\|UniProtKB:O95497\|UniProtKB:O95498	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Vnn1	Rat	pantothenate metabolic process	involved_in	ISO	RGD:1320770	1624291	PMID:11491533, PMID:25478849	RGD	PMID:11491533\|PMID:25478849
Vnn1	Rat	positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway	involved_in	IEA	UniProtKB:Q9Z0K8\|ensembl:ENSMUSP00000040599	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Vnn1	Rat	positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway	involved_in	ISO	RGD:1320771	1624291	PMID:15282320	RGD	PMID:15282320
Vnn1	Rat	positive regulation of T cell differentiation in thymus	involved_in	ISO	RGD:1320771	1624291	PMID:8934567	RGD	PMID:8934567
Vnn1	Rat	positive regulation of T cell differentiation in thymus	involved_in	IEA	UniProtKB:Q9Z0K8\|ensembl:ENSMUSP00000040599	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Vnn1	Rat	extracellular space	NOT\|located_in	ISO	RGD:1320771	1624291	PMID:11491533	RGD	PMID:11491533
Vnn1	Rat	plasma membrane	located_in	IEA	UniProtKB-SubCell:SL-0039	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Vnn1	Rat	side of membrane	located_in	IEA	UniProtKB-KW:KW-0336	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Vnn1	Rat	hydrolase activity	enables	IEA	UniProtKB-KW:KW-0378	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Vnn1	Rat	hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides	enables	IEA	InterPro:IPR012101	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Vnn1	Rat	hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides	enables	IEA	ARBA:ARBA00026848	1600115	GO_REF:0000117	UniProt	GO_REF:0000117
Vnn1	Rat	pantetheine hydrolase activity	enables	ISO	RGD:1320770	1624291	PMID:11491533, PMID:25478849	RGD	PMID:11491533\|PMID:25478849
Vnn1	Rat	pantetheine hydrolase activity	enables	IEA	UniProtKB:Q9Z0K8\|ensembl:ENSMUSP00000040599	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Vnn1	Rat	pantetheine hydrolase activity	enables	ISO	RGD:1320771	1624291	PMID:11042271	RGD	PMID:11042271
Vnn1	Rat	pantetheine hydrolase activity	enables	IBA	MGI:108395\|MGI:1347055\|PANTHER:PTN008502038\|UniProtKB:O95497\|UniProtKB:O95498	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Vnn1	Rat	pantetheine hydrolase activity	enables	IEA	UniProtKB:O95497\|ensembl:ENSP00000356905	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Molecular Pathway Annotations Click to see Annotation Detail View

Imported Annotations - SMPDB

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Vnn1	Rat	pantothenic acid metabolic pathway		ISO	RGD:1320770	10402751		SMPDB	SMP:00027

Imported Annotations - KEGG (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Vnn1	Rat	pantothenic acid metabolic pathway		IEA		6907045		KEGG	rno:00770

Disease Annotations Click to see Annotation Detail View

atopic dermatitis (ISO)

celiac disease (ISO)

Dyslipidemias (ISO)

inflammatory bowel disease (ISO)

pancreatic ductal adenocarcinoma (ISO)

psoriasis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,1-dichloroethene (ISO)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

1-naphthyl isothiocyanate (EXP)

17beta-estradiol (EXP,ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-trinitrobenzenesulfonic acid (EXP)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

2-amino-2-deoxy-D-glucopyranose (ISO)

3,3',4,4'-tetrachlorobiphenyl (ISO)

3-chloropropane-1,2-diol (EXP)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

aldehydo-D-glucosamine (ISO)

allyl alcohol (ISO)

alpha-Zearalanol (EXP)

amiodarone (EXP,ISO)

amphotericin B (ISO)

arsenous acid (ISO)

azathioprine (ISO)

benzbromarone (EXP)

benzo[a]pyrene (ISO)

beta-D-glucosamine (ISO)

beta-naphthoflavone (EXP)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

bisphenol F (ISO)

bosentan (ISO)

buspirone (EXP)

butanal (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

chlordecone (ISO)

chloroform (ISO)

chlorpyrifos (EXP,ISO)

choline (ISO)

ciglitazone (ISO)

cisplatin (ISO)

Citreoviridin (ISO)

clofibrate (EXP,ISO)

Clofop (ISO)

cobalt dichloride (EXP)

copper(II) sulfate (ISO)

corn oil (EXP)

cyanocob(III)alamin (ISO)

cyclosporin A (ISO)

cysteamine (ISO)

dapagliflozin (EXP)

decabromodiphenyl ether (EXP)

diarsenic trioxide (ISO)

dibenzofurans (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (ISO)

dichloroacetic acid (ISO)

dicrotophos (ISO)

diethylstilbestrol (ISO)

dimethylarsinic acid (ISO)

diquat (ISO)

diuron (EXP)

endosulfan (EXP)

epoxiconazole (ISO)

ethylene glycol (EXP,ISO)

fenofibrate (EXP,ISO)

finasteride (EXP)

fipronil (EXP)

flutamide (EXP)

folic acid (ISO)

formaldehyde (ISO)

fructose (EXP)

gemfibrozil (EXP)

gentamycin (EXP)

glafenine (EXP)

glutathione (ISO)

glycine betaine (ISO)

GW 4064 (ISO)

hydrogen peroxide (ISO)

indole-3-methanol (EXP)

inulin (ISO)

L-ethionine (EXP)

L-methionine (ISO)

leflunomide (EXP,ISO)

metformin (EXP)

methapyrilene (EXP)

methotrexate (ISO)

methylarsonic acid (ISO)

Muraglitazar (EXP)

N-acetyl-L-cysteine (EXP)

N-nitrosodiethylamine (EXP,ISO)

nefazodone (EXP)

nimesulide (EXP)

nitrofen (EXP)

ochratoxin A (EXP)

oleic acid (ISO)

omeprazole (EXP)

orphenadrine (EXP)

ozone (ISO)

paracetamol (EXP,ISO)

paraquat (EXP,ISO)

pentachlorophenol (ISO)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP,ISO)

permethrin (ISO)

phenformin (EXP)

phenobarbital (ISO)

phenol (ISO)

piperonyl butoxide (EXP)

pirinixic acid (EXP,ISO)

pravastatin (ISO)

progesterone (ISO)

propanal (ISO)

quercetin (ISO)

reactive oxygen species (ISO)

resveratrol (ISO)

rotenone (EXP)

silicon dioxide (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

spirotetramat (ISO)

streptozocin (EXP)

Tesaglitazar (EXP)

tetrachloroethene (ISO)

tetrachloromethane (ISO)

thallium atom (EXP)

thallium sulfate (EXP)

thioacetamide (EXP)

titanium dioxide (ISO)

trichloroethene (EXP,ISO)

triphenyl phosphate (ISO)

tris(2-butoxyethyl) phosphate (ISO)

troglitazone (EXP,ISO)

valdecoxib (EXP)

valproic acid (ISO)

zaragozic acid A (EXP,ISO)

zinc atom (ISO)

zinc(0) (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

acute inflammatory response (IEA,ISO)

biological_process (ND)

cell-cell adhesion (IEA,ISO)

chronic inflammatory response (IEA,ISO)

coenzyme A catabolic process (IEA,ISO)

inflammatory response (IEA,ISO)

innate immune response (IEA,ISO)

pantothenate metabolic process (IBA,IEA,ISO)

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway (IEA,ISO)

positive regulation of T cell differentiation in thymus (IEA,ISO)

Cellular Component

extracellular space (ISO)

plasma membrane (IEA)

side of membrane (IEA)

Molecular Function

hydrolase activity (IEA)

hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides (IEA)

pantetheine hydrolase activity (IBA,IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

pantothenic acid metabolic pathway (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
6.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
7.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
8.	GOA pipeline	RGD automated data pipeline
9.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
11.	Comprehensive gene review and curation	RGD comprehensive gene curation
12.	PSMD11, PTPRM and PTPRB as novel biomarkers of pancreatic cancer progression.	Sahni S, etal., Biochim Biophys Acta Gen Subj. 2020 Nov;1864(11):129682. doi: 10.1016/j.bbagen.2020.129682. Epub 2020 Jul 12.

Additional References at PubMed

PMID:8934567	PMID:11491533	PMID:12477932	PMID:14966568	PMID:15282320	PMID:21544065	PMID:22399813	PMID:23376485	PMID:24106341	PMID:25478849	PMID:26932716	PMID:27014792
PMID:30332759	PMID:31514290	PMID:34768879	PMID:35352799

Genomics

Comparative Map Data

Vnn1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	23,356,324 - 23,366,629 (-)	NCBI		GRCr8
mRatBN7.2	1	21,537,084 - 21,547,395 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	21,537,094 - 21,547,395 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	21,316,351 - 21,326,676 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	27,316,396 - 27,326,721 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	21,513,723 - 21,524,007 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	22,614,832 - 22,625,134 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	22,614,783 - 22,625,204 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	24,089,365 - 24,099,667 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	22,087,290 - 22,097,592 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	22,090,508 - 22,100,537 (-)	NCBI
Celera	1	20,280,201 - 20,290,503 (-)	NCBI		Celera
Cytogenetic Map	1	p12	NCBI

VNN1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	132,680,849 - 132,714,055 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	132,680,849 - 132,714,055 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	133,001,988 - 133,035,194 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	133,044,422 - 133,076,881 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	6	133,044,422 - 133,076,881	NCBI
Celera	6	133,748,822 - 133,782,014 (-)	NCBI		Celera
Cytogenetic Map	6	q23.2	NCBI
HuRef	6	130,576,916 - 130,610,106 (-)	NCBI		HuRef
CHM1_1	6	133,265,672 - 133,298,869 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	6	133,875,818 - 133,909,022 (-)	NCBI		T2T-CHM13v2.0

Vnn1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	23,770,586 - 23,781,242 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	23,770,586 - 23,781,241 (+)	Ensembl		GRCm39 Ensembl
GRCm38	10	23,894,688 - 23,905,344 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	23,894,688 - 23,905,343 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	10	23,614,494 - 23,625,149 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	10	23,573,041 - 23,594,755 (+)	NCBI		MGSCv36	mm8
Celera	10	24,828,202 - 24,838,840 (+)	NCBI		Celera
Cytogenetic Map	10	A4	NCBI
cM Map	10	11.33	NCBI

Vnn1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955436	13,238,603 - 13,259,577 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955436	13,238,307 - 13,266,800 (-)	NCBI	ChiLan1.0	ChiLan1.0

VNN1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	152,665,525 - 152,697,484 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	150,572,617 - 150,604,502 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	130,459,268 - 130,491,167 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	134,566,110 - 134,598,784 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	134,566,117 - 134,598,784 (-)	Ensembl	panpan1.1		panPan2

VNN1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	25,678,039 - 25,704,579 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	25,678,042 - 25,696,807 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	26,742,992 - 26,770,993 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	25,767,887 - 25,802,756 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	25,767,890 - 25,796,358 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	25,690,559 - 25,711,049 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	25,596,017 - 25,624,588 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	25,852,617 - 25,901,434 (-)	NCBI		UU_Cfam_GSD_1.0

Vnn1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	120,920,545 - 120,951,976 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936560	701,892 - 729,526 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936560	701,857 - 729,516 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

VNN1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	31,000,255 - 31,024,505 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	31,003,338 - 31,023,731 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	34,520,052 - 34,544,689 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

VNN1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	13	40,819,738 - 40,853,827 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	13	40,819,950 - 40,855,171 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666040	13,003,904 - 13,042,721 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Vnn1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624753	6,867,953 - 6,892,186 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624753	6,869,269 - 6,892,217 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Vnn1
65 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	402
Count of miRNA genes:	231
Interacting mature miRNAs:	266
Transcripts:	ENSRNOT00000021694
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2313090	Bmd69	Bone mineral density QTL 69	4.4	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	5293229	34184556	Rat
631688	Hcas2	Hepatocarcinoma susceptibility QTL 2	3	0.0001	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	7746118	52746118	Rat
4889451	Eae29	Experimental allergic encephalomyelitis QTL 29	5.51		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	1	7746121	52746121	Rat
70179	Xhs2	X-ray hypersensitivity QTL 2	3.2		intestine integrity trait (VT:0010554)	post-insult time to onset of moribundity (CMO:0001896)	1	1	43965634	Rat
1354647	Despr8	Despair related QTL 8		0.0000341	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	1	26564886	Rat
1558642	Prcr2	Prostate cancer resistance QTL 2	4.3		prostate integrity trait (VT:0010571)	area of ventral prostate occupied by tumorous lesions to total ventral prostate area ratio (CMO:0000899)	1	10379492	55379492	Rat
7421626	Bp360	Blood pressure QTL 360		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	6941022	51941022	Rat
2313070	Bss52	Bone structure and strength QTL 52	4.4	0.0001	body length (VT:0001256)	body length (CMO:0000013)	1	5293229	34184556	Rat
1357401	Bw43	Body weight QTL 43	3.75		body mass (VT:0001259)	body weight (CMO:0000012)	1	6909353	51909353	Rat
631494	Bp95	Blood pressure QTL 95	40	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	17315378	51816258	Rat
1600360	Mcs16	Mammary carcinoma susceptibility QTL 16	2.4		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	1	1	26564886	Rat
5684998	Bss101	Bone structure and strength QTL 101	3.6		tibia strength trait (VT:1000284)	tibia ultimate force (CMO:0001734)	1	6909353	51909353	Rat
5684999	Bss102	Bone structure and strength QTL 102	5.5	7e-07	tibia strength trait (VT:1000284)	tibia stiffness (CMO:0001735)	1	6909353	51909353	Rat
2302038	Pia31	Pristane induced arthritis QTL 31	5.5	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111)	1	12820494	57820494	Rat
2317755	Glom22	Glomerulus QTL 22	3.8		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	1	1	34184556	Rat
634353	Rends2	Renal damage susceptibility QTL 2		0.05	kidney blood vessel morphology trait (VT:0000530)	organ lesion measurement (CMO:0000677)	1	20656420	65656420	Rat
1300170	Rf6	Renal function QTL 6	3.14		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	1	1	28483164	Rat
1578756	Iddm22	Insulin dependent diabetes mellitus QTL 22	2.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	20508326	65508326	Rat
631508	Sald1	Serum aldosterone level QTL 1	3.7		blood aldosterone amount (VT:0005346)	serum aldosterone level (CMO:0000487)	1	11684464	56684464	Rat
2313053	Bss51	Bone structure and strength QTL 51	3.8	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	5293229	34184556	Rat

Markers in Region

Vnn1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	21,543,810 - 21,543,926 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	22,621,550 - 22,621,665	NCBI	Rnor6.0
Rnor_5.0	1	24,096,083 - 24,096,198	UniSTS	Rnor5.0
RGSC_v3.4	1	22,094,008 - 22,094,123	UniSTS	RGSC3.4
Celera	1	20,286,919 - 20,287,034	UniSTS
Cytogenetic Map	1	p12	UniSTS

RH131037

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	21,537,626 - 21,537,844 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	22,615,368 - 22,615,585	NCBI	Rnor6.0
Rnor_5.0	1	24,089,901 - 24,090,118	UniSTS	Rnor5.0
RGSC_v3.4	1	22,087,826 - 22,088,043	UniSTS	RGSC3.4
Celera	1	20,280,737 - 20,280,954	UniSTS
RH 3.4 Map	1	217.1	UniSTS
Cytogenetic Map	1	p12	UniSTS

Genetic Models

This gene Vnn1 is modified in the following models/strains:

SS-Vnn1^em1Mcwi SS-Vnn1^em2Mcwi

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001025623	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039103008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC128759	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC098934	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000021694 ⟹ ENSRNOP00000021694

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	21,537,094 - 21,547,395 (-)	Ensembl
Rnor_6.0 Ensembl	1	22,614,783 - 22,625,204 (-)	Ensembl

RefSeq Acc Id:

NM_001025623 ⟹ NP_001020794

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	23,356,327 - 23,366,629 (-)	NCBI
mRatBN7.2	1	21,537,091 - 21,547,395 (-)	NCBI
Rnor_6.0	1	22,614,832 - 22,625,134 (-)	NCBI
Rnor_5.0	1	24,089,365 - 24,099,667 (-)	NCBI
RGSC_v3.4	1	22,087,290 - 22,097,592 (-)	RGD
Celera	1	20,280,201 - 20,290,503 (-)	RGD

Sequence:

show sequence

TTAAAATTAACCTTTTAAATTTATTTTGAAGACACCAAGGTCTGGGCACCACGTGATTCGTGCT
TTTTTTTTTTTTTACCATAAAAGTAGGAAGCTACGTTTTGGTTTTCCGCAGTCTTTGGACTTCA
GCATGAGCCTGTCTCGGTGGCTGGCGTGGGCTGCAGCGTTTTCCGTCTTCTGTGTCTTAAAAGT
CAGCTCTCTGGACACTTTCCTCGCAGCTGTTTACGAGCATGCTGTGATCCTGCCTAAAGTCACC
CTGTTACCTGTGTCTCACAGTGAGGCACTGGCATTAATGAACCAGAATCTGGACCTTCTGGAAG
GAGCGATCTTATCAGCAGCTAAGCAGGGTGCGCACATTATTGTGACTCCAGAAGATGGTATATA
CGGTGTGCAGTTCACCAGGGATACCATCTACCCATACCTGGAGGATATCCCAGACCCTCAAGTA
AACTGGATACCCTGTGATAATCCGGAAAGATTTGGCTCTACCCCGGTGCAGGAGAGACTCAGCT
GCTTGGCCAAGAACAACTCAATCTATGTCGTGGCGAACATGGGAGACAAGAAGCCATGCAACAC
CAGCGACTCTCACTGTCCACCTGACGGCCGATTCCAATACAACACTGATGTGGTGTTTGATTCC
CGGGGTAAATTGGTTGCCAGATACCATAAGCAAAACCTTTTCATGGGAGAAGAGCAATTCAATG
CCCCCCCGGAGCCTGAGGTCGTGACTTTTGACACCCCCTTTGGAAAGTTTGGCATCTTCACCTG
TTTCGATATTCTCTTCCATGATCCTGCTGTCACCCTAGTGACAGAGTTCCAGGTGGACACCATA
CTGTTCCCAACTGCCTGGATGGACGTGCTTCCTCATTTGGCAGCCATTGAATTCCACTCAGCTT
GGGCTATAGGCATGGGAGTCAATTTCCTAGCAGCTAATCTACATATTCCCTTGAGGAGAATGAC
AGGAAGTGGTATCTATGCACCCGATTCTCCACGGGCCTTTCATTATGACAGGAAGACACAGGAA
GGAAAGCTCCTCCTTGCACAGCTGGACTCTCACCCGAGTCACTCCCCAGTGAACTGGACTTCCT
ATGCCAGCAGTGTAGAAGCACCCCCAACTGAAAAGGAGGAATTTCGGAGTTTTGTTTTCTTTGA
TGAGTTTACCTTTGTGGAGCTCAAAGGGATCACAGGAAATTACACTGTTTGCCAGAACGACCTC
TGCTGTCATCTAAGCTACCAGATGTCTGAGAAGCGAGCTGATGAAGTTTATGCTCTTGGGGCTT
TTGACGGGTTGCACACCGTGGAAGGGCAGTATCACCTGCAGATTTGCATTCTGCTAAAGTGTAA
AACTACCAATTTACGCACCTGTGGTAGTTCAGTGGACACAGCTTCTACCAGGTTTGAAATGTTC
TCCCTCAGTGGCACTTTTGGAACGCGGTATGTCTTCCCTGAGGTGTTGCTGAGTGAAGTCAAGC
TTGCTCCTGGGGAGTTTCAGGTGTTGAGTGACGGGCGCCTGGTTAGCCTGAAGCCAACGTCTGG
ACCTGTGTTAACAGTCGGTCTCTTTGGGAGGTTGTATGAGAAGGACTGGGCATCAAATGCTTCC
TCAGACCTCATAGCACACTCACTGATAATAATGCTGATCCTAGCTCCTATTATACATTACTTGT
GTTAATAGAATTTCTACATTTTCTGTTTTATTTAGAACATTTAAAATTGGTAGGTGCAGAAAAA
AAAGTATCTGTTTGCCAACAGTGGACTCTGGGGTAAACAAATAAAGTGCCTCCTCTTTAGAGGA
GCATGCGTCCCAGATACACTTCAGGAAAATTAATAAAACTTTGAGCATTGGTCTATCTTAGAAC
TGAGATGTTGGGCCAAATGAAGGTCACATATATTTGATTCAGTTAAAAGGCACTTCAAAATATC
ATAATATATATTTATAAGACATTTGAATCTATTATACATCTTACTCGGTTATGGTTAAAATTTT
CAGTAAGTTTGTTCATTTGGGCTATTAAGTATATTATCTCAATAAATACATTTCCATTCTCTTA
AGAGGCAAATCCTGTAGCTTTAGTTCTTCAGTTCAAGTCCCAGTTCCCACAACCTCAGAACGTG
ACTGTCTTGGTGTCTTGGGAAATAAATACCTAAGTGACATCCTTAGCATGGGCTTTAATCTGAT
ATGACTGCTATCCTCAGAAGAAATCAGGACAAAGGTGAGAATCAAGTGAAGACCATGTGAACAC
AGAGAAAGATGGCCGTCTACAACAAGGAAAGGGGCCTCAGGAGAAAGCAACCTGCTAACATGTT
GAACTTCCAGGCCCCCAGAATATTGAGGCAATAAATTTCTCTTTTAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039103008 ⟹ XP_038958936

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	23,356,324 - 23,364,217 (-)	NCBI
mRatBN7.2	1	21,537,084 - 21,544,983 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001020794	(Get FASTA)	NCBI Sequence Viewer
	XP_038958936	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH98934	(Get FASTA)	NCBI Sequence Viewer
	EDL87746	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000021694
	ENSRNOP00000021694.4

RefSeq Acc Id:	NP_001020794 ⟸ NM_001025623
- Peptide Label:	precursor
- UniProtKB:	Q4KLZ0 (UniProtKB/TrEMBL), F7FPD6 (UniProtKB/TrEMBL)
- Sequence:	show sequence MSLSRWLAWAAAFSVFCVLKVSSLDTFLAAVYEHAVILPKVTLLPVSHSEALALMNQNLDLLEG AILSAAKQGAHIIVTPEDGIYGVQFTRDTIYPYLEDIPDPQVNWIPCDNPERFGSTPVQERLSC LAKNNSIYVVANMGDKKPCNTSDSHCPPDGRFQYNTDVVFDSRGKLVARYHKQNLFMGEEQFNA PPEPEVVTFDTPFGKFGIFTCFDILFHDPAVTLVTEFQVDTILFPTAWMDVLPHLAAIEFHSAW AIGMGVNFLAANLHIPLRRMTGSGIYAPDSPRAFHYDRKTQEGKLLLAQLDSHPSHSPVNWTSY ASSVEAPPTEKEEFRSFVFFDEFTFVELKGITGNYTVCQNDLCCHLSYQMSEKRADEVYALGAF DGLHTVEGQYHLQICILLKCKTTNLRTCGSSVDTASTRFEMFSLSGTFGTRYVFPEVLLSEVKL APGEFQVLSDGRLVSLKPTSGPVLTVGLFGRLYEKDWASNASSDLIAHSLIIMLILAPIIHYLC hide sequence

Ensembl Acc Id:

ENSRNOP00000021694 ⟸ ENSRNOT00000021694

RefSeq Acc Id:	XP_038958936 ⟸ XM_039103008
- Peptide Label:	isoform X1

Protein Domains

CN hydrolase

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q4KLZ0-F1-model_v2	AlphaFold	Q4KLZ0	1-512	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13689531

Promoter ID:

EPDNEW_R55

Type:

multiple initiation site

Name:

Vnn1_1

Description:

vanin 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	22,625,023 - 22,625,083	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1310075	AgrOrtholog
BioCyc Gene	G2FUF-62078	BioCyc
Ensembl Genes	ENSRNOG00000016219	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000021694	ENTREZGENE
	ENSRNOT00000021694.7	UniProtKB/TrEMBL
Gene3D-CATH	3.60.110.10	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7441890	IMAGE-MGC_LOAD
InterPro	Biotinidase/VNN	UniProtKB/TrEMBL
	Biotinidase_euk	UniProtKB/TrEMBL
	C-N_Hydrolase_sf	UniProtKB/TrEMBL
	Ntlse/CNhydtse	UniProtKB/TrEMBL
	Vanin_C	UniProtKB/TrEMBL
KEGG Report	rno:29142	UniProtKB/TrEMBL
MGC_CLONE	MGC:114385	IMAGE-MGC_LOAD
NCBI Gene	29142	ENTREZGENE
PANTHER	PANTETHEINASE	UniProtKB/TrEMBL
	PTHR10609	UniProtKB/TrEMBL
Pfam	CN_hydrolase	UniProtKB/TrEMBL
	Vanin_C	UniProtKB/TrEMBL
PhenoGen	Vnn1	PhenoGen
PIRSF	Biotinidase	UniProtKB/TrEMBL
PROSITE	CN_HYDROLASE	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000016219	RatGTEx
Superfamily-SCOP	Ntlse/CNhydtse	UniProtKB/TrEMBL
UniProt	F7FPD6	ENTREZGENE, UniProtKB/TrEMBL
	Q4KLZ0	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-12-06	Vnn1	vanin 1	Vnn1_predicted	vanin 1 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Vnn1_predicted	vanin 1 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)