Advanced Search (OLGA)

Gene: Polr1c (RNA polymerase I and III subunit C) Rattus norvegicus

Analyze

Symbol:

Polr1c

Name:

RNA polymerase I and III subunit C

RGD ID:

1309689

Description:

Predicted to enable DNA binding activity and protein dimerization activity. Predicted to be involved in transcription by RNA polymerase I and transcription by RNA polymerase III. Predicted to be located in cytoplasm; fibrillar center; and nucleoplasm. Predicted to be part of RNA polymerase I complex and RNA polymerase III complex. Human ortholog(s) of this gene implicated in Treacher Collins syndrome 3 and hypomyelinating leukodystrophy 11. Orthologous to human POLR1C (RNA polymerase I and III subunit C); PARTICIPATES IN RNA polymerase I transcription pathway; RNA polymerase III transcription pathway; purine metabolic pathway; INTERACTS WITH (+)-schisandrin B; 17beta-estradiol; 2,4-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Ac2-127; DNA-directed RNA polymerases I and III subunit RPAC1; LOC301246; MGC105583; polymerase (RNA) I polypeptide C; polymerase (RNA) I subunit C; RNA polymerase 1-1; RNA polymerase I subunit; RNA polymerase I subunit C; Rpo1-1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	POLR1C (RNA polymerase I and III subunit C)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Polr1c (polymerase (RNA) I polypeptide C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Polr1c (RNA polymerase I and III subunit C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	POLR1C (RNA polymerase I and III subunit C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	POLR1C (RNA polymerase I and III subunit C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Polr1c (RNA polymerase I and III subunit C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	POLR1C (RNA polymerase I and III subunit C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	POLR1C (RNA polymerase I and III subunit C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Polr1c (RNA polymerase I and III subunit C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	MXI1 (MAX interactor 1, dimerization protein)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	POLR1C (RNA polymerase I and III subunit C)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Polr1c (polymerase (RNA) I polypeptide C)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	polr1c (RNA polymerase I and III subunit C)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	rpac-40	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG3756	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	RPC40	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	polr1c	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	22,233,318 - 22,237,430 (+)	NCBI		GRCr8
mRatBN7.2	9	14,735,740 - 14,739,852 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	14,735,714 - 14,739,852 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	9	23,319,979 - 23,324,091 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	28,382,463 - 28,386,575 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	26,683,367 - 26,687,479 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	17,120,759 - 17,124,871 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	17,120,759 - 17,124,871 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	9	16,017,436 - 16,021,548 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	9	10,298,309 - 10,302,421 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	9	10,295,630 - 10,299,743 (+)	NCBI
Celera	9	12,483,058 - 12,487,170 (+)	NCBI		Celera
Cytogenetic Map	9	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

CAKUT (ISO)

combined oxidative phosphorylation deficiency (ISO)

combined oxidative phosphorylation deficiency 8 (ISO)

genetic disease (ISO)

Hearing Loss (ISO)

hypomyelinating leukodystrophy 11 (ISO)

hypomyelinating leukodystrophy 26 (ISO)

infantile Refsum disease (ISO)

Mandibulofacial Dysostosis (ISO)

neurodegeneration with brain iron accumulation (ISO)

progressive leukoencephalopathy with ovarian failure (ISO)

spondyloepimetaphyseal dysplasia with joint laxity (ISO)

Treacher Collins syndrome 3 (ISO)

Zellweger syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP,ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4,6-tribromophenol (ISO)

2,4-dinitrotoluene (EXP)

3,3',5,5'-tetrabromobisphenol A (ISO)

4,4'-sulfonyldiphenol (ISO)

actinomycin D (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

antimycin A (ISO)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

Aroclor 1254 (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (EXP,ISO)

cadmium dichloride (ISO)

clobetasol (ISO)

clofibric acid (EXP)

cylindrospermopsin (ISO)

DDE (ISO)

decabromodiphenyl ether (ISO)

doxorubicin (ISO)

flutamide (EXP)

folic acid (ISO)

formaldehyde (ISO)

hydrogen peroxide (ISO)

ivermectin (ISO)

leflunomide (ISO)

maneb (ISO)

menadione (ISO)

methotrexate (ISO)

methylmercury chloride (ISO)

miconazole (ISO)

mono(2-ethylhexyl) phthalate (ISO)

N-acetyl-L-cysteine (ISO)

N-nitrosodiethylamine (EXP)

nickel atom (ISO)

Nutlin-3 (ISO)

paracetamol (ISO)

paraquat (ISO)

perfluorooctane-1-sulfonic acid (ISO)

resveratrol (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (ISO)

tebufenpyrad (ISO)

temozolomide (ISO)

testosterone (EXP)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

thiram (ISO)

triptonide (ISO)

tungsten (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

transcription by RNA polymerase I (IEA)

transcription by RNA polymerase III (IEA)

Cellular Component

cytoplasm (ISO)

fibrillar center (IEA,ISO)

nucleoplasm (IEA,ISO)

nucleus (ISO)

RNA polymerase I complex (ISO)

RNA polymerase III complex (ISO)

Molecular Function

DNA binding (IEA)

obsolete RNA polymerase I activity (IEA)

obsolete RNA polymerase III activity (IEA)

protein binding (ISO)

protein dimerization activity (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

purine metabolic pathway (IEA)

pyrimidine metabolic pathway (IEA)

RNA polymerase I transcription pathway (ISO)

RNA polymerase III transcription pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Cell growth- and differentiation-dependent regulation of RNA polymerase III transcription.	Dumay-Odelot H, etal., Cell Cycle. 2010 Sep 15;9(18):3687-99. Epub 2010 Sep 1.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Characterization of human RNA polymerase III identifies orthologues for Saccharomyces cerevisiae RNA polymerase III subunits.	Hu P, etal., Mol Cell Biol. 2002 Nov;22(22):8044-55.
4.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
5.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
6.	GOA pipeline	RGD automated data pipeline
7.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	Comprehensive gene review and curation	RGD comprehensive gene curation
10.	RNA polymerase I activity is regulated at multiple steps in the transcription cycle: recent insights into factors that influence transcription elongation.	Schneider DA Gene. 2012 Feb 10;493(2):176-84. doi: 10.1016/j.gene.2011.08.006. Epub 2011 Aug 26.
11.	Conservation between the RNA polymerase I, II, and III transcription initiation machineries.	Vannini A and Cramer P, Mol Cell. 2012 Feb 24;45(4):439-46. doi: 10.1016/j.molcel.2012.01.023.

Additional References at PubMed

PMID:7929437	PMID:12477932	PMID:24107381

Genomics

Comparative Map Data

Polr1c
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	22,233,318 - 22,237,430 (+)	NCBI		GRCr8
mRatBN7.2	9	14,735,740 - 14,739,852 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	14,735,714 - 14,739,852 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	9	23,319,979 - 23,324,091 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	28,382,463 - 28,386,575 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	26,683,367 - 26,687,479 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	17,120,759 - 17,124,871 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	17,120,759 - 17,124,871 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	9	16,017,436 - 16,021,548 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	9	10,298,309 - 10,302,421 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	9	10,295,630 - 10,299,743 (+)	NCBI
Celera	9	12,483,058 - 12,487,170 (+)	NCBI		Celera
Cytogenetic Map	9	q12	NCBI

POLR1C
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	43,517,089 - 43,562,407 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	43,509,702 - 43,562,419 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	43,484,827 - 43,530,144 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	43,592,769 - 43,605,092 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	6	45,036,412 - 45,048,735 (+)	NCBI		Celera
Cytogenetic Map	6	p21.1	NCBI
HuRef	6	43,202,730 - 43,208,225 (+)	NCBI		HuRef
CHM1_1	6	43,487,909 - 43,492,383 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	6	43,345,828 - 43,391,139 (+)	NCBI		T2T-CHM13v2.0

Polr1c
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	46,554,846 - 46,558,971 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	17	46,554,846 - 46,558,980 (-)	Ensembl		GRCm39 Ensembl
GRCm38	17	46,243,920 - 46,248,045 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	46,243,920 - 46,248,054 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	17	46,380,869 - 46,384,994 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	17	45,707,509 - 45,711,545 (-)	NCBI		MGSCv36	mm8
Celera	17	49,677,058 - 49,681,183 (-)	NCBI		Celera
Cytogenetic Map	17	C	NCBI
cM Map	17	22.9	NCBI

Polr1c
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955437	9,346,397 - 9,350,591 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955437	9,346,397 - 9,350,591 (+)	NCBI	ChiLan1.0	ChiLan1.0

POLR1C
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	58,009,906 - 58,029,793 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	53,879,703 - 53,899,579 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	43,101,771 - 43,121,460 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	44,399,936 - 44,404,420 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	44,395,787 - 44,412,257 (+)	Ensembl	panpan1.1		panPan2

POLR1C
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	12	11,978,337 - 11,982,265 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	12	11,978,422 - 12,008,579 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	12	12,004,514 - 12,008,441 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	12	12,461,954 - 12,465,881 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	12	12,462,031 - 12,509,169 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	12	11,987,354 - 11,991,281 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	12	12,074,263 - 12,078,191 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	12	12,167,748 - 12,171,676 (+)	NCBI		UU_Cfam_GSD_1.0

Polr1c
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	47,472,764 - 47,476,677 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936476	16,480,835 - 16,487,424 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936476	16,483,203 - 16,487,360 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

POLR1C
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	38,507,073 - 38,537,943 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	7	38,511,521 - 38,531,938 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	44,092,595 - 44,111,879 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

POLR1C
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	17	28,637,868 - 28,649,898 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666044	43,572,869 - 43,577,363 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Polr1c
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624754	16,122,935 - 16,136,395 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624754	16,125,322 - 16,129,339 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Polr1c
6 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	28
Count of miRNA genes:	28
Interacting mature miRNAs:	28
Transcripts:	ENSRNOT00000025787
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631211	Bw4	Body weight QTL4	5.31		retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	9	5109826	50109826	Rat
2303559	Gluco54	Glucose level QTL 54	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	9	1254084	46254084	Rat
7411609	Foco16	Food consumption QTL 16	25.6	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	9	8952560	53952560	Rat
61450	Ciaa3	CIA Autoantibody QTL 3	6.5		blood autoantibody amount (VT:0003725)	calculated serum anti-type 2 collagen antibody titer (CMO:0001279)	9	7954720	22071169	Rat
9589055	Scfw5	Subcutaneous fat weight QTL 5	5.55	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	9	1	37999212	Rat
1641911	Alcrsp13	Alcohol response QTL 13			response to alcohol trait (VT:0010489)	brain neurotensin receptor 1 density (CMO:0002068)	9	1	43718459	Rat
1354650	Despr5	Despair related QTL 5	4.01	0.0017	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	9	1254084	46254084	Rat
1300124	Cm4	Cardiac mass QTL 4	3.55		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	9	1	40594091	Rat
61425	Cia15	Collagen induced arthritis QTL 15	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	9	5109826	42921101	Rat
70226	Eae4	Experimental allergic encephalomyelitis QTL 4			nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	9	1	25661317	Rat
9589158	Gluco65	Glucose level QTL 65	6.82	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	9	1	37999212	Rat
10054125	Srcrt7	Stress Responsive Cort QTL 7	3.33	0.0011	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	9	1	87073594	Rat
1600365	Mcs20	Mammary carcinoma susceptibility QTL 20	3		mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	9	13533770	42791750	Rat
11353947	Bp392	Blood pressure QTL 392			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	7283252	52283252	Rat
7411592	Foco8	Food consumption QTL 8	7.4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	9	1	37999212	Rat
1331757	Cdexp1	CD45RC expression in CD8 T cells QTL 1	4.3		CD8-positive T cell quantity (VT:0008077)	blood CD45RC(high) CD8 T cell count to CD45RC(low) CD8 T cell count ratio (CMO:0001990)	9	1024537	67509080	Rat
1298088	Edpm11	Estrogen-dependent pituitary mass QTL 11	2.5		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	9	1	43718459	Rat
9589133	Insul26	Insulin level QTL 26	17.96	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	9	8952560	53952560	Rat

Markers in Region

RH127411

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	9	22,236,942 - 22,237,251 (+)	Marker Load Pipeline
mRatBN7.2	9	14,739,364 - 14,739,673 (+)	MAPPER	mRatBN7.2
Rnor_6.0	9	17,124,384 - 17,124,692	NCBI	Rnor6.0
Rnor_5.0	9	16,021,061 - 16,021,369	UniSTS	Rnor5.0
RGSC_v3.4	9	10,301,934 - 10,302,242	UniSTS	RGSC3.4
Celera	9	12,486,683 - 12,486,991	UniSTS
RH 3.4 Map	9	63.8	UniSTS
Cytogenetic Map	9	q12	UniSTS

BF386341

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	9	14,736,564 - 14,736,714 (+)	MAPPER	mRatBN7.2
Rnor_6.0	9	17,121,584 - 17,121,733	NCBI	Rnor6.0
Rnor_5.0	9	16,018,261 - 16,018,410	UniSTS	Rnor5.0
RGSC_v3.4	9	10,299,134 - 10,299,283	UniSTS	RGSC3.4
Celera	9	12,483,883 - 12,484,032	UniSTS
RH 3.4 Map	9	63.5	UniSTS
Cytogenetic Map	9	q12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001008330	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AY325219	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC086597	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473987	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000009	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000025787 ⟹ ENSRNOP00000025787

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	9	14,735,714 - 14,739,849 (+)	Ensembl
Rnor_6.0 Ensembl	9	17,120,759 - 17,124,871 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000077749 ⟹ ENSRNOP00000073552

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	9	14,735,763 - 14,739,852 (+)	Ensembl
Rnor_6.0 Ensembl	9	17,122,284 - 17,124,675 (+)	Ensembl

RefSeq Acc Id:

NM_001008330 ⟹ NP_001008331

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	22,233,318 - 22,237,430 (+)	NCBI
mRatBN7.2	9	14,735,740 - 14,739,852 (+)	NCBI
Rnor_6.0	9	17,120,759 - 17,124,871 (+)	NCBI
Rnor_5.0	9	16,017,436 - 16,021,548 (+)	NCBI
RGSC_v3.4	9	10,298,309 - 10,302,421 (+)	RGD
Celera	9	12,483,058 - 12,487,170 (+)	RGD

Sequence:

show sequence

GGCCGCTAGCACGCACGCGCTAACTTGGAGCCTCCTCTCACGGCTGATGGTGGAAGATGGCGGC
TGCTCAGGCGGTGGAGGAAATGCGGACTCGCGTGGTTCTGGGAGAGTTTGGGGTTCGCAATGTC
CACACCACTGACTTTCCCGGTAACTACTCCGGTTATGATGATGCCTGGGACCAGGACCGGTTCG
AGAAGAACTTCCGTGTGGACGTGGTGCATATGGACGAGAGCACACTGGAGTTCGACATGGTGGG
GATTGATGCTGCCATTGCCAATGCCTTCCGGAGGATTCTGTTAGCTGAGGTGCCAACAATGGCT
GTGGAAAAGGTTTTGGTGTATAACAACACATCCATCGTCCAGGATGAGATCCTTGCTCACCGCC
TGGGGCTTATCCCCATTCTTGCTGATCCACGTCTCTTTGAATATCGGAACCCAGGAGAGGAGGA
GGGAACAGAGATAGATACACTACAGTTTCGGCTGCAGGTCAGGTGTACCAGGAACCCCAGTGCT
GCTAAGGATTCTTCCGACCCCAATGAACTCTATGTGAACCACAAAGTTTATACCAGGCACATGA
CGTGGGTGCCCTTGGGAAACCAGGCTGATGTCTTCCCGGAGGGCACGGTTCGCCCTGTGCATGA
CGACATCCTCATTGCCCAGCTTCGGCCCGGCCAGGAGATTGACCTGATGATGCACTGCGTCAAG
GGCATCGGCAAAGACCATGCCAAGTTCTCACCGGTGGCCACAGCCAGCTACAGGCTCCTGCCGG
ACATCACCCTGCTTGAACCTGTAGAAGGGGAAGCAGCCGAGGAGCTGAGCCAGTGCTTCTCACC
CGGCGTGATTGCGGTGCAGGAAGTACAAGGTAAAAAGGTGGCCAGGGTTGCCAATGCTCGGCTG
GATACCTTCAGCAGGGAGATCTTCCGTCATGAGAAGCTCAAGAAGGCCGTGCGGCTTGCCCGTG
TTCGGGACCATTACATCTTTTCTGTGGAGTCAACTGGGGTTTTGCCACCAGATGTGTTGGTGAG
TGAAGCTATCAAGATCCTGATGGGGAAGTGCCGGCGGTTCTTGGATGAACTAGATGCAGTTGAG
ATGGACTGAGGCTTCCACAGTACTTCTGGAAGGGCTTGGCTGCTCTTGGAGTTTGACCTTTTCC
CAACTGCTCCGCTATGCCCGGTGTTAACTGGAGGTCTGATTTCAGTCTCATTTCTAGTTACTAC
ATTTTATTAAATGTGCCACAGACTAAGATGCCTTTGTAAGGCCTTTGCTGTAAATAAATTGGTC
TTAAAAGTTTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001008331	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH86597	(Get FASTA)	NCBI Sequence Viewer
	AAP92620	(Get FASTA)	NCBI Sequence Viewer
	EDM18804	(Get FASTA)	NCBI Sequence Viewer
	EDM18805	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000025787.3
	ENSRNOP00000073552.2

RefSeq Acc Id:

NP_001008331 ⟸ NM_001008330

- UniProtKB:

Q5RJK9 (UniProtKB/TrEMBL), A6JIS7 (UniProtKB/TrEMBL), A6JIS8 (UniProtKB/TrEMBL), F7F2K8 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAAAQAVEEMRTRVVLGEFGVRNVHTTDFPGNYSGYDDAWDQDRFEKNFRVDVVHMDESTLEFD
MVGIDAAIANAFRRILLAEVPTMAVEKVLVYNNTSIVQDEILAHRLGLIPILADPRLFEYRNPG
EEEGTEIDTLQFRLQVRCTRNPSAAKDSSDPNELYVNHKVYTRHMTWVPLGNQADVFPEGTVRP
VHDDILIAQLRPGQEIDLMMHCVKGIGKDHAKFSPVATASYRLLPDITLLEPVEGEAAEELSQC
FSPGVIAVQEVQGKKVARVANARLDTFSREIFRHEKLKKAVRLARVRDHYIFSVESTGVLPPDV
LVSEAIKILMGKCRRFLDELDAVEMD

hide sequence

Ensembl Acc Id:

ENSRNOP00000073552 ⟸ ENSRNOT00000077749

Ensembl Acc Id:

ENSRNOP00000025787 ⟸ ENSRNOT00000025787

Protein Domains

DNA-directed RNA polymerase RpoA/D/Rpb3-type

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5RJK9-F1-model_v2	AlphaFold	Q5RJK9	1-346	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13696530

Promoter ID:

EPDNEW_R7053

Type:

multiple initiation site

Name:

Polr1c_1

Description:

RNA polymerase I subunit C

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	9	17,120,793 - 17,120,853	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1309689	AgrOrtholog
BioCyc Gene	G2FUF-28210	BioCyc
Ensembl Genes	ENSRNOG00000019079	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000025787.5	UniProtKB/TrEMBL
	ENSRNOT00000077749.2	UniProtKB/TrEMBL
Gene3D-CATH	2.170.120.12	UniProtKB/TrEMBL
	3.30.1360.10	UniProtKB/TrEMBL
	3.30.70.20	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7312277	IMAGE-MGC_LOAD
InterPro	DNA-dir_RNA_pol_30-40kDasu_CS	UniProtKB/TrEMBL
	DNA-dir_RNA_pol_insert	UniProtKB/TrEMBL
	DNA-dir_RNA_pol_RpoA/D/Rpb3	UniProtKB/TrEMBL
	RBP11-like	UniProtKB/TrEMBL
	RNAP_Rpo3/Rpb3/RPAC1	UniProtKB/TrEMBL
	RNAPI/II_AC40	UniProtKB/TrEMBL
	RNApol_insert_sf	UniProtKB/TrEMBL
	Rpo3/RPB3_RNA_Pol_subunit	UniProtKB/TrEMBL
KEGG Report	rno:301246	UniProtKB/TrEMBL
MGC_CLONE	MGC:105583	IMAGE-MGC_LOAD
NCBI Gene	301246	ENTREZGENE
PANTHER	DNA-DIRECTED RNA POLYMERASE	UniProtKB/TrEMBL
	PTHR11800:SF13	UniProtKB/TrEMBL
Pfam	RNA_pol_A_bac	UniProtKB/TrEMBL
	RNA_pol_L	UniProtKB/TrEMBL
PhenoGen	Polr1c	PhenoGen
PROSITE	RNA_POL_D_30KD	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000019079	RatGTEx
SMART	RPOLD	UniProtKB/TrEMBL
Superfamily-SCOP	RNAP_insert	UniProtKB/TrEMBL
	RNAP_RBP11-like	UniProtKB/TrEMBL
UniProt	A0A0G2K5T6_RAT	UniProtKB/TrEMBL
	A6JIS7	ENTREZGENE, UniProtKB/TrEMBL
	A6JIS8	ENTREZGENE, UniProtKB/TrEMBL
	F7F2K8	ENTREZGENE, UniProtKB/TrEMBL
	Q5RJK9	ENTREZGENE
UniProt Secondary	Q5RJK9	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2018-03-16	Polr1c	RNA polymerase I and III subunit C	Polr1c	RNA polymerase I subunit C	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-07-21	Polr1c	RNA polymerase I subunit C	Polr1c	polymerase (RNA) I subunit C	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-03-09	Polr1c	polymerase (RNA) I subunit C	Polr1c	polymerase (RNA) I polypeptide C	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-11-06	Polr1c	polymerase (RNA) I polypeptide C	Rpo1-1	RNA polymerase 1-1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Rpo1-1	RNA polymerase 1-1	Rpo1-1_predicted	RNA polymerase 1-1 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Rpo1-1_predicted	RNA polymerase 1-1 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)