Rpl22l1 (ribosomal protein L22 like 1)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Rpl22l1 (ribosomal protein L22 like 1) Rattus norvegicus

Analyze

Symbol:

Rpl22l1

Name:

ribosomal protein L22 like 1

RGD ID:

1309517

Description:

Predicted to enable RNA binding activity. Predicted to be a structural constituent of ribosome. Predicted to be involved in cytoplasmic translation. Predicted to be located in ribosome. Predicted to be part of ribonucleoprotein complex. Orthologous to human RPL22L1 (ribosomal protein L22 like 1); INTERACTS WITH (+)-schisandrin B; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

60S ribosomal protein L22-like 1; LOC361923; RGD1309517; similar to RIKEN cDNA 3110001N18

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RPL22L1 (ribosomal protein L22 like 1)	HGNC	EggNOG, Ensembl, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Rpl22l1 (ribosomal protein L22 like 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Rpl22l1 (ribosomal protein L22 like 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RPL22L1 (ribosomal protein L22 like 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RPL22L1 (ribosomal protein L22 like 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rpl22l1 (ribosomal protein L22 like 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RPL22L1 (ribosomal protein L22 like 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RPL22L1 (ribosomal protein L22 like 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rpl22l1 (ribosomal protein L22 like 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Rpl22l1 (ribosomal protein L22 like 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	RPL22L1 (ribosomal protein L22 like 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	rpl22l1 (ribosomal protein L22-like 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	rpl-22	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	RPL22A	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	RPL22B	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	RpL22	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	rpl22l1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	2	111,754,687 - 111,756,623 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	111,754,687 - 111,756,625 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	118,407,286 - 118,409,222 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	116,519,825 - 116,521,761 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	111,226,136 - 111,228,072 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	115,362,799 - 115,364,735 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	115,362,799 - 115,364,729 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	135,060,063 - 135,061,999 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	116,168,790 - 116,170,726 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	116,109,992 - 116,115,688 (+)	NCBI
Celera	2	106,940,648 - 106,942,584 (+)	NCBI		Celera
Cytogenetic Map	2	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Fanconi syndrome (ISO)

genetic disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(1->4)-beta-D-glucan (ISO)

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP,ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2-hydroxypropanoic acid (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

acrylamide (EXP)

aflatoxin B1 (EXP,ISO)

antirheumatic drug (ISO)

Aroclor 1254 (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

casticin (ISO)

chromium(6+) (ISO)

clofibric acid (EXP)

copper atom (EXP)

copper(0) (EXP)

crocidolite asbestos (ISO)

cyclosporin A (ISO)

deoxynivalenol (ISO)

dexamethasone (ISO)

dicrotophos (ISO)

disodium selenite (ISO)

dorsomorphin (ISO)

entinostat (ISO)

epoxiconazole (ISO)

ethanol (ISO)

flutamide (EXP)

folic acid (ISO)

formaldehyde (ISO)

genistein (ISO)

gentamycin (EXP)

glafenine (EXP)

hydrogen peroxide (ISO)

hydroxyurea (ISO)

indole-3-methanol (EXP)

indometacin (ISO)

ivermectin (ISO)

lead diacetate (EXP)

methyl methanesulfonate (ISO)

nefazodone (EXP)

nimesulide (EXP)

nitrofen (EXP)

ozone (ISO)

p-anisidine (ISO)

paclitaxel (ISO)

paracetamol (ISO)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

progesterone (ISO)

propiconazole (ISO)

rac-lactic acid (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

sodium dodecyl sulfate (ISO)

tamoxifen (ISO)

testosterone (EXP)

tetrachloroethene (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

tolcapone (EXP)

trichostatin A (ISO)

tris(2-butoxyethyl) phosphate (ISO)

tungsten (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cytoplasmic translation (IBA)

Cellular Component

ribonucleoprotein complex (IEA)

ribosome (IEA)

Molecular Function

protein binding (ISO)

RNA binding (IBA)

structural constituent of ribosome (IBA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932

Genomics

Comparative Map Data

Rpl22l1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	2	111,754,687 - 111,756,623 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	111,754,687 - 111,756,625 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	118,407,286 - 118,409,222 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	116,519,825 - 116,521,761 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	111,226,136 - 111,228,072 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	115,362,799 - 115,364,735 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	115,362,799 - 115,364,729 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	135,060,063 - 135,061,999 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	116,168,790 - 116,170,726 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	116,109,992 - 116,115,688 (+)	NCBI
Celera	2	106,940,648 - 106,942,584 (+)	NCBI		Celera
Cytogenetic Map	2	q24	NCBI

RPL22L1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	170,864,875 - 170,870,195 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	170,864,875 - 170,870,208 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	3	170,582,664 - 170,587,984 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	172,065,358 - 172,070,739 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	3	168,982,460 - 168,987,841 (-)	NCBI		Celera
Cytogenetic Map	3	q26.2	NCBI
HuRef	3	167,952,691 - 167,958,071 (-)	NCBI		HuRef
CHM1_1	3	170,545,839 - 170,551,220 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	3	173,649,212 - 173,654,530 (-)	NCBI		T2T-CHM13v2.0

Rpl22l1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	28,859,660 - 28,861,573 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	28,859,585 - 28,861,573 (+)	Ensembl		GRCm39 Ensembl
GRCm38	3	28,805,508 - 28,807,424 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	28,805,436 - 28,807,424 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	3	28,704,433 - 28,706,337 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	3	28,996,584 - 28,998,488 (+)	NCBI		MGSCv36	mm8
Celera	3	28,766,405 - 28,768,309 (+)	NCBI		Celera
Cytogenetic Map	3	A3	NCBI
cM Map	3	12.27	NCBI

Rpl22l1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955420	1,015,952 - 1,020,626 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955420	1,016,175 - 1,020,028 (-)	NCBI	ChiLan1.0	ChiLan1.0

RPL22L1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	3	168,758,645 - 168,762,535 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	167,879,172 - 167,883,064 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	176,065,204 - 176,069,274 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	176,065,204 - 176,069,274 (-)	Ensembl	panpan1.1		panPan2

RPL22L1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	34	35,298,980 - 35,302,728 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	34	35,298,907 - 35,302,688 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	34	44,311,471 - 44,315,185 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	34	35,381,631 - 35,385,361 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	34	35,381,564 - 35,385,335 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	34	35,323,532 - 35,327,261 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	34	35,293,089 - 35,296,838 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	34	35,557,115 - 35,560,831 (-)	NCBI		UU_Cfam_GSD_1.0

Rpl22l1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	101,939,131 - 101,943,283 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936593	1,678,425 - 1,682,904 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936593	1,678,781 - 1,682,834 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RPL22L1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	109,495,553 - 109,499,921 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	13	109,495,771 - 109,499,495 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	118,438,193 - 118,443,130 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RPL22L1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	15	18,571,113 - 18,575,066 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	15	18,571,116 - 18,575,090 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666063	27,347,528 - 27,351,697 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rpl22l1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624730	48,928,225 - 48,931,508 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624730	48,928,225 - 48,931,532 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Rpl22l1
6 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	6
Count of miRNA genes:	6
Interacting mature miRNAs:	6
Transcripts:	ENSRNOT00000015756
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1302794	Stl27	Serum triglyceride level QTL 27	4.4	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	2	25413423	143657569	Rat
1358894	Kidm24	Kidney mass QTL 24	4.03		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358899	Kidm23	Kidney mass QTL 23	3.88		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358901	Cm38	Cardiac mass QTL 38	2		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	157142209	Rat
1358904	Cm39	Cardiac mass QTL 39	2.26		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	157142209	Rat
1358910	Kidm27	Kidney mass QTL 27	5.77		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358911	Kidm28	Kidney mass QTL 28	5.42		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
1358887	Bw50	Body weight QTL 50	2.39		body mass (VT:0001259)	body weight (CMO:0000012)	2	25413652	157142078	Rat
1358908	Bw49	Body weight QTL 49	3.36		body mass (VT:0001259)	body weight (CMO:0000012)	2	25413652	157142078	Rat
1354603	Bp243	Blood pressure QTL 243	3.9		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	26917817	127469484	Rat
2290453	Scl55	Serum cholesterol level QTL 55	2.83		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	2	26917817	136917119	Rat
2293835	Kiddil5	Kidney dilation QTL 5	3.8		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	42804607	157142209	Rat
2293843	Kiddil6	Kidney dilation QTL 6	3.1		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	42804607	182042367	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	43154682	202446871	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	43154682	202446871	Rat
2293671	Bss44	Bone structure and strength QTL 44	10.97	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	2	43162366	148478373	Rat
1354601	Slep1	Serum leptin concentration QTL 1	5.39		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	2	43171017	184114403	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	46123260	202447032	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	56043031	202447032	Rat
1558648	Smcn1	Smooth muscle cell number QTL 1		0.039	blood vessel smooth muscle cell quantity (VT:0010525)	aorta smooth muscle cell count per unit vessel length (CMO:0001646)	2	59134147	127460910	Rat
61438	Cia7	Collagen induced arthritis QTL 7	4.6	0.0001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	2	59324377	141596857	Rat
1298080	Bp163	Blood pressure QTL 163		0.02	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118275	202447032	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118463	226797303	Rat
7411551	Bw131	Body weight QTL 131	29.6	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	2	67942638	112942638	Rat
1558653	Prcr1	Prostate cancer resistance QTL 1	5		prostate integrity trait (VT:0010571)	area of ventral prostate occupied by tumorous lesions to total ventral prostate area ratio (CMO:0000899)	2	72532993	157142209	Rat
1354605	Rf48	Renal function QTL 48	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	2	74786664	206665859	Rat
631198	Cm22	Cardiac mass QTL 22	4.3	0.0008	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	76539322	150540526	Rat
61374	Edpm2	Estrogen-dependent pituitary mass QTL 2	4.42	0.86	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	76539322	202447032	Rat
2299162	Iddm32	Insulin dependent diabetes mellitus QTL 32	2.36		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	2	78665616	143657569	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	78665619	219826953	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	78665619	249053267	Rat
61392	Bp6	Blood pressure QTL 6	7		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	2	80270434	125270434	Rat
1598865	Bp296	Blood pressure QTL 296	2.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	81018907	126018907	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	81689826	221035911	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	81754530	222436696	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	81754530	227146641	Rat
1578772	Stresp14	Stress response QTL 14	5	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	2	82345893	130923501	Rat
7207808	Bmd89	Bone mineral density QTL 89	4.1		femur strength trait (VT:0010010)	femoral neck ultimate force (CMO:0001703)	2	88862519	133862519	Rat
2300165	Bmd49	Bone mineral density QTL 49	4.8	0.0001	lumbar vertebra mineral mass (VT:0010511)	bone mineral density (CMO:0001226)	2	88862519	133862519	Rat
2300170	Bmd45	Bone mineral density QTL 45	12.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	2	88862519	133862519	Rat
2300185	Bmd46	Bone mineral density QTL 46	8.4	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	2	88862519	133862519	Rat
1598862	Glom9	Glomerulus QTL 9	3.5		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	2	92337601	137337601	Rat
1598863	Cm65	Cardiac mass QTL 65	2.3		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	92337601	137337601	Rat
631566	Bp90	Blood pressure QTL 90		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	102803808	147803808	Rat
8662836	Vetf8	Vascular elastic tissue fragility QTL 8	0.66		thoracic aorta molecular composition trait (VT:0010568)	aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003)	2	104559726	149559726	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	43	57	41	19	41	8	11	74	35	41	11	8
Low
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001108548	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC167114	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473961	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ210535	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ211167	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221224	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221258	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221490	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221726	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221812	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221852	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221904	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ223163	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ223463	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ223753	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228314	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228345	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229046	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000067	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000015756 ⟹ ENSRNOP00000015756

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	111,754,687 - 111,756,623 (+)	Ensembl
Rnor_6.0 Ensembl	2	115,362,799 - 115,364,729 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000103930 ⟹ ENSRNOP00000093098

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	111,754,841 - 111,756,625 (+)	Ensembl

RefSeq Acc Id:

NM_001108548 ⟹ NP_001102018

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	2	111,754,687 - 111,756,623 (+)	NCBI
Rnor_6.0	2	115,362,799 - 115,364,735 (+)	NCBI
Rnor_5.0	2	135,060,063 - 135,061,999 (+)	NCBI
RGSC_v3.4	2	116,168,790 - 116,170,726 (+)	RGD
Celera	2	106,940,648 - 106,942,584 (+)	RGD

Sequence:

show sequence

GGTTCCGAGTTGCGCAGCGCGCACGCTCTGCGTATGACGCAGCACGTTCCTATATAAAAGCGTG
CGTACAGCGGAGGCCCGTCCTCTTCTCAAGGCTGCTGCTCATCATGGCGCCGCAGAAAGACAAG
AAGCCTAAGAAGTCAACCTGGAGGTTTCATTTGGACCTTACTCATCCAGTAGAAGATGGAATTT
TTGATTCTGGAAATTTTGAACAGTTTCTACGGGAGAAGGTTAAAGTCAATGGAAAAACTGGAAA
TCTTGGAAATGTTGTTCACATTGAACGCCTGAAGAATAAAATCACAGTTGTTTCTGAGAAACAG
TTCTCAAAAAGGTATTTGAAATATCTTACCAAGAAATACCTTAAGAAGAATAATCTCCGTGATT
GGCTTCGTGTGGTCGCATCTGACAAGGAGACTTACGAACTTCGTTACTTCCAAATTAGTCAAGA
TGAAGATGGTTCAGAGTCTGAGGACTAATTGGCCTTTGCTTTTAATAAAATGGAAATATGCTAA
AGAAACCTAAAATCAGACTTGTTGAGCAAATAAAAATCATTTTACTCTATAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001102018	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI67114	(Get FASTA)	NCBI Sequence Viewer
	EDM01142	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001102018 ⟸ NM_001108548
- UniProtKB:	B2RZD5 (UniProtKB/TrEMBL), A6IHJ4 (UniProtKB/TrEMBL), A0A8I6GK43 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAPQKDKKPKKSTWRFHLDLTHPVEDGIFDSGNFEQFLREKVKVNGKTGNLGNVVHIERLKNKI TVVSEKQFSKRYLKYLTKKYLKKNNLRDWLRVVASDKETYELRYFQISQDEDGSESED hide sequence

RefSeq Acc Id:

ENSRNOP00000015756 ⟸ ENSRNOT00000015756

RefSeq Acc Id:

ENSRNOP00000093098 ⟸ ENSRNOT00000103930

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B2RZD5-F1-model_v2	AlphaFold	B2RZD5	1-122	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1309517	AgrOrtholog
BioCyc Gene	G2FUF-53482	BioCyc
Ensembl Genes	ENSRNOG00000011817	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000015756	ENTREZGENE
	ENSRNOP00000015756.4	UniProtKB/TrEMBL
	ENSRNOP00000093098.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000015756	ENTREZGENE
	ENSRNOT00000015756.7	UniProtKB/TrEMBL
	ENSRNOT00000103930.1	UniProtKB/TrEMBL
Gene3D-CATH	3.30.1360.210	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:6919691	IMAGE-MGC_LOAD
InterPro	Ribosomal_L22e	UniProtKB/TrEMBL
	Ribosomal_L22e_sf	UniProtKB/TrEMBL
KEGG Report	rno:361923	UniProtKB/TrEMBL
MGC_CLONE	MGC:189578	IMAGE-MGC_LOAD
NCBI Gene	361923	ENTREZGENE
PANTHER	PTHR10064:SF1	UniProtKB/TrEMBL
	Ribosomal_L22e	UniProtKB/TrEMBL
Pfam	Ribosomal_L22e	UniProtKB/TrEMBL
PhenoGen	Rpl22l1	PhenoGen
UniProt	A0A8I6GK43	ENTREZGENE, UniProtKB/TrEMBL
	A6IHJ4	ENTREZGENE, UniProtKB/TrEMBL
	B2RZD5	ENTREZGENE
	F7EY34_RAT	UniProtKB/TrEMBL
UniProt Secondary	B2RZD5	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-04-30	Rpl22l1	ribosomal protein L22 like 1	Rpl22l1_predicted	ribosomal protein L22 like 1 (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-30	Rpl22l1_predicted	ribosomal protein L22 like 1 (predicted)	RGD1309517_predicted	similar to RIKEN cDNA 3110001N18 (predicted)	Symbol and Name updated	1299863	APPROVED
2005-01-20	RGD1309517_predicted	similar to RIKEN cDNA 3110001N18 (predicted)	LOC361923_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC361923_predicted	similar to RIKEN cDNA 3110001N18 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar