Advanced Search (OLGA)

Gene: Arpc5l (actin related protein 2/3 complex, subunit 5-like) Rattus norvegicus

Analyze

Symbol:

Arpc5l

Name:

actin related protein 2/3 complex, subunit 5-like

RGD ID:

1308867

Description:

Predicted to enable actin filament binding activity. Predicted to be involved in Arp2/3 complex-mediated actin nucleation and cell migration. Predicted to be part of Arp2/3 protein complex. Predicted to be active in cytoplasm and glutamatergic synapse. Orthologous to human ARPC5L (actin related protein 2/3 complex subunit 5 like); PARTICIPATES IN Fc gamma receptor mediated signaling pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

actin related protein 2/3 complex, subunit 5-like 1; actin-related protein 2/3 complex subunit 5-like protein; ARC16-2; arp2/3 complex 16 kDa subunit 2; Arpc5l1; LOC296710; MGC112865

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Related Pseudogenes:

Arpc5l-ps1

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	43,169,518 - 43,177,224 (+)	NCBI		GRCr8
mRatBN7.2	3	22,758,710 - 22,767,520 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	45,262,374 - 45,264,366 (-)	Ensembl		mRatBN7.2 Ensembl
mRatBN7.2 Ensembl	3	22,759,876 - 22,767,538 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	26,228,380 - 26,236,003 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	34,813,364 - 34,820,987 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	32,626,072 - 32,633,695 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	23,301,455 - 23,309,077 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	23,301,455 - 23,309,072 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	28,523,281 - 28,530,903 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	18,798,930 - 18,801,987 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	18,687,517 - 18,698,957 (+)	NCBI
Celera	3	21,193,183 - 21,200,804 (+)	NCBI		Celera
Cytogenetic Map	3	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (EXP)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2,4,6-tribromophenol (ISO)

2,6-dinitrotoluene (EXP)

2-palmitoylglycerol (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

acrolein (ISO)

acrylamide (ISO)

all-trans-retinoic acid (ISO)

alpha-pinene (ISO)

amitrole (EXP)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

bisphenol F (ISO)

butanal (ISO)

casticin (ISO)

chlorpyrifos (EXP)

choline (ISO)

copper(II) sulfate (ISO)

decabromodiphenyl ether (ISO)

dexamethasone (ISO)

diarsenic trioxide (ISO)

diazinon (ISO)

Dibutyl phosphate (ISO)

dicrotophos (ISO)

diethylstilbestrol (ISO)

finasteride (EXP)

flutamide (EXP)

folic acid (ISO)

FR900359 (ISO)

gentamycin (EXP)

glafenine (EXP)

indometacin (ISO)

ivermectin (ISO)

L-methionine (ISO)

metformin (ISO)

methimazole (EXP)

N-methyl-4-phenylpyridinium (EXP)

nefazodone (EXP)

nickel atom (ISO)

nimesulide (EXP)

nitrates (ISO)

okadaic acid (ISO)

ozone (ISO)

pirinixic acid (EXP)

potassium chromate (ISO)

resveratrol (ISO)

sarin (EXP)

saxitoxin (ISO)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

thiram (ISO)

titanium dioxide (ISO)

triptonide (ISO)

valproic acid (ISO)

zinc atom (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

Arp2/3 complex-mediated actin nucleation (IBA,IEA)

cell migration (IBA)

regulation of actin filament polymerization (IEA)

Cellular Component

actin cytoskeleton (IEA)

Arp2/3 protein complex (IBA,IEA)

cytoplasm (IBA,IEA)

cytoskeleton (IEA)

glutamatergic synapse (ISO)

synapse (ISO)

Molecular Function

actin binding (IEA)

actin filament binding (IBA)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

Fc gamma receptor mediated signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:8889548	PMID:12477932	PMID:15489334	PMID:19056867	PMID:20458337	PMID:21423176	PMID:23376485	PMID:24413018

Genomics

Comparative Map Data

Arpc5l
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	43,169,518 - 43,177,224 (+)	NCBI		GRCr8
mRatBN7.2	3	22,758,710 - 22,767,520 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	45,262,374 - 45,264,366 (-)	Ensembl		mRatBN7.2 Ensembl
mRatBN7.2 Ensembl	3	22,759,876 - 22,767,538 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	26,228,380 - 26,236,003 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	34,813,364 - 34,820,987 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	32,626,072 - 32,633,695 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	23,301,455 - 23,309,077 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	23,301,455 - 23,309,072 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	28,523,281 - 28,530,903 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	18,798,930 - 18,801,987 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	18,687,517 - 18,698,957 (+)	NCBI
Celera	3	21,193,183 - 21,200,804 (+)	NCBI		Celera
Cytogenetic Map	3	q12	NCBI

ARPC5L
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	124,862,130 - 124,877,733 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	124,862,130 - 124,877,733 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	9	127,624,409 - 127,640,012 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	126,671,305 - 126,679,517 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	9	124,711,037 - 124,719,249	NCBI
Celera	9	98,279,433 - 98,287,649 (+)	NCBI		Celera
Cytogenetic Map	9	q33.3	NCBI
HuRef	9	97,243,876 - 97,252,092 (+)	NCBI		HuRef
CHM1_1	9	127,780,255 - 127,788,468 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	9	137,060,438 - 137,076,046 (+)	NCBI		T2T-CHM13v2.0

Arpc5l
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	38,895,283 - 38,905,889 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	38,895,360 - 38,905,889 (+)	Ensembl		GRCm39 Ensembl
GRCm38	2	39,008,066 - 39,015,878 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	39,005,348 - 39,015,877 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	38,863,659 - 38,871,392 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	38,830,148 - 38,837,881 (+)	NCBI		MGSCv36	mm8
Celera	2	40,733,885 - 40,741,618 (+)	NCBI		Celera
Cytogenetic Map	2	B	NCBI
cM Map	2	24.42	NCBI

Arpc5l
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955419	3,360,189 - 3,367,531 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955419	3,360,189 - 3,367,531 (-)	NCBI	ChiLan1.0	ChiLan1.0

ARPC5L
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	11	14,480,948 - 14,489,327 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	9	14,483,292 - 14,491,669 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	9	95,989,650 - 95,998,340 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	9	124,505,769 - 124,515,396 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	9	124,505,769 - 124,515,396 (+)	Ensembl	panpan1.1		panPan2

ARPC5L
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	58,142,001 - 58,149,285 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	9	58,142,389 - 58,149,236 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	57,340,842 - 57,348,123 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	59,062,448 - 59,069,717 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	59,062,836 - 59,069,659 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	57,821,454 - 57,828,735 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	58,137,063 - 58,144,338 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	58,227,991 - 58,235,278 (-)	NCBI		UU_Cfam_GSD_1.0

Arpc5l
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	193,296,420 - 193,304,836 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936487	13,065,338 - 13,073,053 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936487	13,064,206 - 13,073,363 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ARPC5L
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	265,642,260 - 265,654,018 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	265,645,800 - 265,653,513 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	299,468,496 - 299,479,052 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ARPC5L
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	12	13,268,223 - 13,284,590 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	12	13,268,025 - 13,283,515 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666079	2,823,995 - 2,832,582 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Arpc5l
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624760	10,322,034 - 10,329,616 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624760	10,322,034 - 10,333,234 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Arpc5l
14 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	533
Count of miRNA genes:	280
Interacting mature miRNAs:	352
Transcripts:	ENSRNOT00000019405
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1358357	Srcrtb1	Stress Responsive Cort Basal QTL 1	6.36	0.002	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	29056275	47904329	Rat
6893355	Bw101	Body weight QTL 101	0.4	0.38	body mass (VT:0001259)	body weight (CMO:0000012)	3	5766390	50766390	Rat
634306	Bp140	Blood pressure QTL 140	3.3	0.0013	arterial blood pressure trait (VT:2000000)	body weight (CMO:0000012)	3	37772258	55937853	Rat
10401810	Kidm53	Kidney mass QTL 53			kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	28625339	67641995	Rat
1298526	Arunc3	Aerobic running capacity QTL 3	2.2		exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	3	6125437	51125437	Rat
2298542	Neuinf11	Neuroinflammation QTL 11	3.9		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	3	35403199	97383526	Rat
1558657	Cm43	Cardiac mass QTL 43	6.6	3e-08	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	22677150	50766390	Rat
631568	Bp92	Blood pressure QTL 92	2.2	0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	15272348	60272348	Rat
6893363	Bw105	Body weight QTL 105	2.6	0.0036	body mass (VT:0001259)	body weight (CMO:0000012)	3	5766390	50766390	Rat
1300169	Bp177	Blood pressure QTL 177	2.96		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	3	36425116	81425116	Rat
631831	Alc8	Alcohol consumption QTL 8	2.7		consumption behavior trait (VT:0002069)	calculated ethanol drink intake rate (CMO:0001615)	3	37796919	53640235	Rat
1558647	Cm46	Cardiac mass QTL 46	5.4	0.0000055	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	22677150	50766390	Rat
10450811	Scl73	Serum cholesterol level QTL 73	4.7	0.001	blood LDL cholesterol amount (VT:0000181)	blood low density lipoprotein cholesterol level (CMO:0000053)	3	2904329	47904329	Rat
4889966	Bss95	Bone structure and strength QTL 95	4.4		tibia area (VT:1000281)	tibia-fibula cross-sectional area (CMO:0001718)	3	37796919	82796919	Rat
2292615	Ept17	Estrogen-induced pituitary tumorigenesis QTL 17	6.7		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	6556347	51556347	Rat
10450808	Scl72	Serum cholesterol level QTL 72	4.4	0.001	blood LDL cholesterol amount (VT:0000181)	blood low density lipoprotein cholesterol level (CMO:0000053)	3	2904329	47904329	Rat
12879852	Cm93	Cardiac mass QTL 93		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	3	38708931	67641995	Rat
10450806	Scl71	Serum cholesterol level QTL 71	5.8	0.001	blood LDL cholesterol amount (VT:0000181)	blood low density lipoprotein cholesterol level (CMO:0000053)	3	2904329	47904329	Rat
1558654	Bw56	Body weight QTL 56	4.5	0.0000171	body mass (VT:0001259)	body weight (CMO:0000012)	3	5766390	50766390	Rat
12879853	Am5	Aortic mass QTL 5		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	3	38708931	67641995	Rat
12879854	Kidm63	Kidney mass QTL 63		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	38708931	67641995	Rat
1358905	Hrtrt17	Heart rate QTL 17	5.9	0.000014	heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	36721849	110333156	Rat
12879849	Bw180	Body weight QTL 180		0.037	body mass (VT:0001259)	body weight (CMO:0000012)	3	38708931	67641995	Rat
12879850	Cm91	Cardiac mass QTL 91		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	3	38708931	67641995	Rat
12879851	Cm92	Cardiac mass QTL 92		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	38708931	67641995	Rat
731172	Bp151	Blood pressure QTL 151		0.04	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	38708931	67641995	Rat
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	1	141509147	Rat
1354597	Kidm13	Kidney mass QTL 13	2.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	3	42158111	124558371	Rat
2325840	Bp345	Blood pressure QTL 345		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	38708931	83708931	Rat
631676	Cm8	Cardiac mass QTL 8	7.03	0.0001	aorta mass (VT:0002845)	aorta weight (CMO:0000076)	3	37363734	82363734	Rat
631679	Cm10	Cardiac mass QTL 10	7.34	0.0001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	6556347	51556347	Rat
2290452	Scl56	Serum cholesterol level QTL 56	2.26		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	3	36101403	81101403	Rat
1354604	Bw36	Body weight QTL 36	2.9		body mass (VT:0001259)	body weight (CMO:0000012)	3	42158111	124558371	Rat
70203	Gcr2	Gastric cancer resistance QTL 2	2.6		stomach morphology trait (VT:0000470)	stomach tumor susceptibility score (CMO:0002043)	3	29056275	47904329	Rat
70202	Alc19	Alcohol consumption QTL 19	2.5		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	3	37796919	47904329	Rat
2312664	Scl62	Serum cholesterol level QTL 62		0.05	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	37796919	59119581	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	5675975	141509147	Rat
1358185	Ept6	Estrogen-induced pituitary tumorigenesis QTL 6	6.7		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	6556347	51556347	Rat

Markers in Region

RH143512

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	22,767,671 - 22,767,954 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	23,309,229 - 23,309,511	NCBI	Rnor6.0
Rnor_5.0	3	28,531,055 - 28,531,337	UniSTS	Rnor5.0
RGSC_v3.4	3	18,802,407 - 18,802,689	UniSTS	RGSC3.4
Celera	3	21,200,956 - 21,201,238	UniSTS
RH 3.4 Map	3	239.31	UniSTS
Cytogenetic Map	3	q11	UniSTS

AI852867

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	22,767,315 - 22,767,442 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	23,308,873 - 23,308,999	NCBI	Rnor6.0
Rnor_5.0	3	28,530,699 - 28,530,825	UniSTS	Rnor5.0
RGSC_v3.4	3	18,802,051 - 18,802,177	UniSTS	RGSC3.4
Celera	3	21,200,600 - 21,200,726	UniSTS
Cytogenetic Map	3	q11	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001037767	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039104789	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039104791	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039104793	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039104794	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063283529	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063283530	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063283531	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC098820	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC127445	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FM029541	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000019405 ⟹ ENSRNOP00000019405

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	22,759,900 - 22,767,538 (+)	Ensembl
Rnor_6.0 Ensembl	3	23,301,455 - 23,309,072 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000096562 ⟹ ENSRNOP00000089031

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	22,759,876 - 22,767,517 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000112049 ⟹ ENSRNOP00000083929

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	9	45,262,374 - 45,264,366 (-)	Ensembl

RefSeq Acc Id:

NM_001037767 ⟹ NP_001032856

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	43,169,602 - 43,177,224 (+)	NCBI
mRatBN7.2	3	22,759,898 - 22,767,520 (+)	NCBI
Rnor_6.0	3	23,301,455 - 23,309,077 (+)	NCBI
Rnor_5.0	3	28,523,281 - 28,530,903 (+)	NCBI
RGSC_v3.4	3	18,798,930 - 18,801,987 (+)	RGD
Celera	3	21,193,183 - 21,200,804 (+)	NCBI

Sequence:

show sequence

GCGGAGGGAGCCGGTACGGAGCGAAGCCTAGGCGGCTGGGCGGCCGCCGCGCTCCCGCCATGGC
CCGGAACACACTGTCCTCACGCTTCCGCCGAGTGGATATCGACGAATTTGACGAGAACAAATTC
GTAGACGAGCACGAAGAGGCGGCGGCGGCGTCGGGCGAGCCAGGCCCCGACCCCTGCGAGGTAG
ACGGGCTCCTGCGGCAAGGGGACATGCTTCGGGCATTCCATGCAGCCTTGCGGAACTCTCCAAT
CAACACCAAGAATCAAGCTGTGAAGGAACGAGCCCAGGGTATAGTCCTGAAAGTACTCACAAAC
TTCAAGAGCAGCGAGATTGAGCAGGCTGTGCAGTCACTGGACAGGAATGGCATTGACTTGCTAA
TGAAGTACATTTATAAAGGGTTTGAGAAGCCCACAGAAAATAGCAGTGCAGTGTTACTCCAGTG
GCATGAAAAGGCTTTAGCTGTTGGAGGACTAGGCTCCATTATAAGAGTTCTTACAGCAAGAAAG
ACTGTTTAAAAAAAAAAAAAGAATCCTGTTACCTTGAGAAGAATTTTGGATGCCCAGGCTAGTG
AAGAAGGGACTGACAATGGACCATCTTCCTAGAACTCCCAACTAAATACTTCAGGACACATCTG
CTGGAATGTATTTTACTTTTGAGGTGGAGGGAGAAATTGTCTTATTGATTCCTAAATTCTTTGC
AGGACCAGAGTGTCTGCCTTTGTCTACAGAGTAACACAGAACCAACACTTGACTATCTGGCTGA
CTGGCCAGATTATGTGAGGTGTACCTGTGAGCACTGTCTGTTTGGAATGGGGAGGGACTATTTG
GGCAGGTGCAGACCCAAGGGCTGTGGTGAAAAGGAGAGCTTGGGTTCTGAAGTGGAAAAAACCT
GATGAGAGTTTGTACAGACATCCTGTCTTCTCAGAGAAGGCAGGCTCTCTTGGGTTCATTGTAA
AGTGCCTGCTGCATCAATAAAGCTCTTGGCTTATTAGTCTATTCATTGAAGTGTGTTCTCTGTA
TGTTAAATGGTAAAGAAAGGGATAGCAATGAATGATGACAGTTTGGTTTGGAAAGCTGATGTCC
CTGTCCTGCCATCCTTGGGGACGGGGAAAGCGAGCATGGTGATACCACAGCTATGCCATACTTT
AACTGCAGTGGTGCTGGATGCTACCGAGAGACATTTTGCTGAGTGTTTATTTTTCTTACTCTTT
TGATTTGTATGTAATTTTGGAGCTTATTTAATAAAGTGCCAAACCTTTAATGAAAAAAAAAAAA
AAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039104789 ⟹ XP_038960717

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	43,169,518 - 43,177,224 (+)	NCBI
mRatBN7.2	3	22,758,710 - 22,767,520 (+)	NCBI

RefSeq Acc Id:

XM_039104791 ⟹ XP_038960719

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	43,169,570 - 43,177,224 (+)	NCBI
mRatBN7.2	3	22,760,368 - 22,767,520 (+)	NCBI

RefSeq Acc Id:

XM_039104793 ⟹ XP_038960721

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	43,169,570 - 43,177,224 (+)	NCBI
mRatBN7.2	3	22,760,320 - 22,767,520 (+)	NCBI

RefSeq Acc Id:

XM_039104794 ⟹ XP_038960722

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	43,170,249 - 43,177,224 (+)	NCBI
mRatBN7.2	3	22,760,816 - 22,767,520 (+)	NCBI

RefSeq Acc Id:

XM_063283529 ⟹ XP_063139599

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	43,169,570 - 43,177,224 (+)	NCBI

RefSeq Acc Id:

XM_063283530 ⟹ XP_063139600

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	43,169,570 - 43,177,224 (+)	NCBI

RefSeq Acc Id:

XM_063283531 ⟹ XP_063139601

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	43,169,570 - 43,177,224 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001032856	(Get FASTA)	NCBI Sequence Viewer
	XP_038960717	(Get FASTA)	NCBI Sequence Viewer
	XP_038960719	(Get FASTA)	NCBI Sequence Viewer
	XP_038960721	(Get FASTA)	NCBI Sequence Viewer
	XP_038960722	(Get FASTA)	NCBI Sequence Viewer
	XP_063139599	(Get FASTA)	NCBI Sequence Viewer
	XP_063139600	(Get FASTA)	NCBI Sequence Viewer
	XP_063139601	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	A1L108	(Get FASTA)	NCBI Sequence Viewer
	AAH98820	(Get FASTA)	NCBI Sequence Viewer
	AAI27446	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000019405
	ENSRNOP00000083929.1
	ENSRNOP00000089031.1

RefSeq Acc Id:	NP_001032856 ⟸ NM_001037767
- UniProtKB:	Q4KM42 (UniProtKB/Swiss-Prot), A1L108 (UniProtKB/Swiss-Prot), A0A8L2QA00 (UniProtKB/TrEMBL), A6JEW0 (UniProtKB/TrEMBL)
- Sequence:	show sequence MARNTLSSRFRRVDIDEFDENKFVDEHEEAAAASGEPGPDPCEVDGLLRQGDMLRAFHAALRNS PINTKNQAVKERAQGIVLKVLTNFKSSEIEQAVQSLDRNGIDLLMKYIYKGFEKPTENSSAVLL QWHEKALAVGGLGSIIRVLTARKTV hide sequence

Ensembl Acc Id:

ENSRNOP00000019405 ⟸ ENSRNOT00000019405

RefSeq Acc Id:	XP_038960717 ⟸ XM_039104789
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038960721 ⟸ XM_039104793
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038960719 ⟸ XM_039104791
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038960722 ⟸ XM_039104794
- Peptide Label:	isoform X1

Ensembl Acc Id:

ENSRNOP00000089031 ⟸ ENSRNOT00000096562

Ensembl Acc Id:

ENSRNOP00000083929 ⟸ ENSRNOT00000112049

RefSeq Acc Id:	XP_063139599 ⟸ XM_063283529
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_063139600 ⟸ XM_063283530
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_063139601 ⟸ XM_063283531
- Peptide Label:	isoform X1

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-A1L108-F1-model_v2	AlphaFold	A1L108	1-153	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692056

Promoter ID:

EPDNEW_R2581

Type:

initiation region

Name:

Arpc5l_1

Description:

actin related protein 2/3 complex, subunit 5-like

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	23,301,429 - 23,301,489	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1308867	AgrOrtholog
BioCyc Gene	G2FUF-49885	BioCyc
Ensembl Genes	ENSRNOG00000014317	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOG00000067388	Ensembl, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000019405	ENTREZGENE
	ENSRNOT00000096562.1	UniProtKB/Swiss-Prot
	ENSRNOT00000112049.1	UniProtKB/Swiss-Prot
Gene3D-CATH	1.25.40.190	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7367835	IMAGE-MGC_LOAD
InterPro	ARPC5	UniProtKB/Swiss-Prot
	ARPC5_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:296710	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:156477	IMAGE-MGC_LOAD
NCBI Gene	296710	ENTREZGENE
PANTHER	PTHR12644	UniProtKB/Swiss-Prot
Pfam	P16-Arc	UniProtKB/Swiss-Prot
PhenoGen	Arpc5l	PhenoGen
PIRSF	p16-ARC	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000014317	RatGTEx
	ENSRNOG00000067388	RatGTEx
Superfamily-SCOP	SSF69103	UniProtKB/Swiss-Prot
UniProt	A0A8L2QA00	ENTREZGENE, UniProtKB/TrEMBL
	A1L108	ENTREZGENE
	A6JEW0	ENTREZGENE, UniProtKB/TrEMBL
	ARP5L_RAT	UniProtKB/Swiss-Prot
	Q4KM42	ENTREZGENE
UniProt Secondary	Q4KM42	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2022-04-08	Arpc5l	actin related protein 2/3 complex, subunit 5-like	Arpc5l1	actin related protein 2/3 complex, subunit 5-like 1	Name and Symbol changed	629549	APPROVED
2022-03-22	Arpc5l1	actin related protein 2/3 complex, subunit 5-like 1	Arpc5l	actin related protein 2/3 complex, subunit 5-like	Name and Symbol changed	629549	APPROVED
2005-12-06	Arpc5l	actin related protein 2/3 complex, subunit 5-like	Arpc5l_predicted	actin related protein 2/3 complex, subunit 5-like (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Arpc5l_predicted	actin related protein 2/3 complex, subunit 5-like (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Annotations - KEGG (archival)