Sugct (succinylCoA:glutarate-CoA transferase)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Sugct (succinylCoA:glutarate-CoA transferase) Rattus norvegicus

Analyze

Symbol:

Sugct

Name:

succinylCoA:glutarate-CoA transferase

RGD ID:

1308114

Description:

Predicted to enable succinate-hydroxymethylglutarate CoA-transferase activity. Predicted to be located in mitochondrion. Human ortholog(s) of this gene implicated in glutaric acidemia type 3. Orthologous to human SUGCT (succinyl-CoA:glutarate-CoA transferase); INTERACTS WITH (+)-schisandrin B; 1-nitropropane; 17beta-estradiol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

caiB/baiF CoA-transferase family protein C7orf10 homolog; hypothetical protein LOC361253; LOC361253; RGD1308114; similar to cDNA sequence AF397014; succinate--hydroxymethylglutarate CoA-transferase

RGD Orthologs

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	17	47,376,392 - 48,234,362 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	47,376,521 - 48,234,376 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	17	50,573,882 - 51,440,720 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	54,576,779 - 55,443,610 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	48,678,690 - 49,542,022 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	49,991,314 - 51,030,950 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_5.0	17	48,313,139 - 49,097,298 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	17	55,271,485 - 56,354,931 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	17	55,274,325 - 56,357,765 (+)	NCBI
Celera	17	43,461,380 - 44,309,778 (+)	NCBI		Celera
Cytogenetic Map	17	q11-q12.1	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Familial Prostate Cancer (ISO)

genetic disease (ISO)

glutaric acidemia type 3 (ISO,ISS)

Greig cephalopolysyndactyly syndrome (ISO)

migraine (ISO)

pancreatic cancer (ISO)

pleomorphic xanthoastrocytoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(1->4)-beta-D-glucan (ISO)

1,1-dichloroethene (ISO)

1,4-dioxane (ISO)

1-nitropropane (EXP)

17beta-estradiol (EXP)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,4-diaminotoluene (EXP)

2,6-diaminotoluene (EXP)

2-acetamidofluorene (EXP)

2-nitro-p-phenylenediamine (EXP)

2-nitropropane (EXP)

3,3',4,4',5-pentachlorobiphenyl (EXP)

4-acetylaminofluorene (EXP)

4-hydroxyphenyl retinamide (ISO)

4-nitro-1,2-phenylenediamine (EXP)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

aflatoxin B1 (ISO)

Aflatoxin B2 alpha (ISO)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

avobenzone (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bis(2-chloroethyl) sulfide (ISO)

bisphenol A (EXP,ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

chloropicrin (ISO)

chlorpyrifos (ISO)

cisplatin (EXP,ISO)

clofibrate (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

ethanol (ISO)

ethyl methanesulfonate (ISO)

finasteride (EXP)

flutamide (EXP)

formaldehyde (ISO)

furan (EXP)

genistein (EXP)

glyphosate (EXP)

indole-3-methanol (EXP)

inulin (ISO)

Lasiocarpine (ISO)

lead(0) (ISO)

methoxychlor (EXP)

methyl methanesulfonate (ISO)

N-methyl-4-phenylpyridinium (EXP)

N-nitrosodiethylamine (ISO)

N-Nitrosopyrrolidine (ISO)

O-methyleugenol (ISO)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

propanal (ISO)

quercitrin (ISO)

rotenone (EXP)

sodium dichromate (EXP)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

toluene (ISO)

triclosan (ISO)

triphenyl phosphate (EXP)

triptonide (ISO)

urethane (ISO)

valproic acid (ISO)

vinclozolin (EXP)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Cellular Component

mitochondrion (ISO,ISS)

Molecular Function

succinate-hydroxymethylglutarate CoA-transferase activity (ISO,ISS)

References

References - curated

#	Reference Title	Reference Citation
1.	GOA pipeline	RGD automated data pipeline
2.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
4.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:15489334	PMID:18614015	PMID:23893049

Genomics

Comparative Map Data

Sugct
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	17	47,376,392 - 48,234,362 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	47,376,521 - 48,234,376 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	17	50,573,882 - 51,440,720 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	54,576,779 - 55,443,610 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	48,678,690 - 49,542,022 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	49,991,314 - 51,030,950 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_5.0	17	48,313,139 - 49,097,298 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	17	55,271,485 - 56,354,931 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	17	55,274,325 - 56,357,765 (+)	NCBI
Celera	17	43,461,380 - 44,309,778 (+)	NCBI		Celera
Cytogenetic Map	17	q11-q12.1	NCBI

SUGCT
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	40,135,005 - 41,038,816 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	40,135,005 - 40,860,763 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	7	40,174,604 - 40,900,362 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	40,141,100 - 40,866,882 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	7	39,947,814 - 40,673,597	NCBI
Celera	7	40,162,765 - 40,891,115 (+)	NCBI		Celera
Cytogenetic Map	7	p14.1	NCBI
HuRef	7	40,058,468 - 40,785,616 (+)	NCBI		HuRef
CHM1_1	7	40,177,089 - 40,902,748 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	7	40,292,462 - 41,196,673 (+)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	40,213,004 - 40,940,183 (+)	NCBI

Sugct
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	13	17,032,057 - 17,869,380 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	13	17,032,057 - 17,870,138 (-)	Ensembl		GRCm39 Ensembl
GRCm38	13	16,857,472 - 17,694,795 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	13	16,857,472 - 17,695,553 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	13	16,949,306 - 17,786,599 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	13	16,642,614 - 17,479,881 (-)	NCBI		MGSCv36	mm8
Celera	13	17,138,701 - 17,997,954 (-)	NCBI		Celera
Cytogenetic Map	13	A2	NCBI
cM Map	13	5.92	NCBI

Sugct
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955460	2,866,877 - 3,559,615 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955460	2,866,466 - 3,559,625 (-)	NCBI	ChiLan1.0	ChiLan1.0

SUGCT
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	7	95,904,710 - 96,624,028 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	43,381,156 - 44,100,614 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	43,421,327 - 44,139,815 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	43,421,615 - 44,139,738 (-)	Ensembl	panpan1.1		panPan2

SUGCT
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	18	9,051,920 - 9,766,342 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	18	9,030,745 - 9,766,277 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	18	8,900,180 - 9,614,482 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	18	9,100,042 - 9,814,780 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	18	9,098,492 - 9,814,767 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	18	9,078,291 - 9,792,521 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	18	9,047,630 - 9,762,322 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	18	9,162,495 - 9,876,803 (-)	NCBI		UU_Cfam_GSD_1.0

Sugct
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	96,212,245 - 96,890,719 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936478	15,424,041 - 16,102,024 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936478	15,424,010 - 16,102,401 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SUGCT
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	18	53,639,872 - 54,283,251 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	18	53,639,588 - 54,283,272 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	18	58,827,834 - 59,169,709 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SUGCT
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	21	17,621,886 - 18,511,591 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	21	18,151,535 - 18,511,310 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666062	3,896,493 - 4,667,726 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Sugct
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624740	20,305,329 - 21,071,641 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624740	20,268,868 - 21,071,723 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Sugct
3566 total Variants

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354658	Spl8	Serum phospholipid level QTL 8	3.8		blood VLDL phospholipid amount (VT:0010507)	blood very low density lipoprotein phospholipid level (CMO:0001571)	17	1	60781592	Rat
1354581	Bp247	Blood pressure QTL 247	4.5		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	17	1	69599340	Rat
1354662	Rf49	Renal function QTL 49	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	17	1	69599340	Rat
1354596	Bw32	Body weight QTL 32	4.5		body mass (VT:0001259)	body weight (CMO:0000012)	17	4299130	60781592	Rat
1354630	Cm34	Cardiac mass QTL 34	8.7		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	17	4299130	69599340	Rat
1354638	Insul1	Insulin level QTL 1	4.8		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	17	4299130	69599340	Rat
1354651	Lmblg2	Limb length QTL 2	6		tibia length (VT:0004357)	tibia length (CMO:0000450)	17	4299130	69599340	Rat
2303627	Vencon8	Ventilatory control QTL 8		0.001	respiration trait (VT:0001943)	tidal volume (CMO:0000222)	17	4528038	49528038	Rat
10054088	Scort28	Serum corticosterone level QTL 28	2.04	0.0102	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	17	4528038	49528038	Rat
2303561	Bw91	Body weight QTL 91	2		body mass (VT:0001259)	body weight (CMO:0000012)	17	8868462	53868462	Rat
1331765	Hrtrt15	Heart rate QTL 15	4.094		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	17	15330613	55836425	Rat
1354640	Scl32	Serum cholesterol level QTL 32	5.4		blood HDL cholesterol amount (VT:0000184)	blood high density lipoprotein cholesterol level (CMO:0000052)	17	15781592	60781592	Rat
1354659	Scl68	Serum cholesterol level QTL 68	3.9		blood VLDL cholesterol amount (VT:0005144)	blood very low density lipoprotein cholesterol level (CMO:0000648)	17	15781592	60781592	Rat
7394837	Memor18	Memory QTL 18			exploratory behavior trait (VT:0010471)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	17	18640182	63640182	Rat
1354628	Stl13	Serum triglyceride level QTL 13	3.8		blood triglyceride amount (VT:0002644)	blood triglyceride level (CMO:0000118)	17	21293039	60781592	Rat
70157	Niddm32	Non-insulin dependent diabetes mellitus QTL 32	4.34		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	17	22454924	50909196	Rat
61394	Bp8	Blood pressure QTL 8	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	23080567	59555013	Rat
7488966	Bp370	Blood pressure QTL 370		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	23653184	57246843	Rat
12903978	Cm118	Cardiac mass QTL 118		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	17	23653184	68653184	Rat
12903979	Cm119	Cardiac mass QTL 119		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	17	23653184	68653184	Rat
12903980	Cm120	Cardiac mass QTL 120		0.002	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	17	23653184	68653184	Rat
12903981	Am17	Aortic mass QTL 17		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	17	23653184	68653184	Rat
1559055	Bp278	Blood pressure QTL 278		0.04	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	23653184	68653184	Rat
12903982	Kidm70	Kidney mass QTL 70		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	17	23653184	70974005	Rat
1354619	Bp242	Blood pressure QTL 242	6.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	24599340	69599340	Rat
1581512	Cm55	Cardiac mass QTL 55	2.8	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	17	27027949	56836890	Rat
4889955	Bss93	Bone structure and strength QTL 93	4.4		tibia size trait (VT:0100001)	tibia cortical bone volume to tibia total bone volume ratio (CMO:0001727)	17	27027949	60463643	Rat
2302377	Scl61	Serum cholesterol level QTL 61	4.36		blood HDL cholesterol amount (VT:0000184)	serum high density lipoprotein cholesterol level (CMO:0000361)	17	27389946	53481766	Rat
8552928	Pigfal9	Plasma insulin-like growth factor 1 level QTL 9	9		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	17	28409147	73409147	Rat
9590107	Sffal7	Serum free fatty acids level QTL 7	4.81	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	17	28409147	73409147	Rat
10450503	Bp386	Blood pressure QTL 386		0.28	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	31368391	62109574	Rat
2324621	Coatc5	Coat color QTL 5			coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	17	31368391	73951021	Rat
2313854	Bp343	Blood pressure QTL 343	3.9		life span trait (VT:0005372)	age at time of death (CMO:0001193)	17	31990784	50909196	Rat
724549	Niddm56	Non-insulin dependent diabetes mellitus QTL 56		0.03	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	17	31990784	76990784	Rat
1354663	Bvd5	Brain ventricular dilatation QTL 5	3.51	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	17	31990784	81292925	Rat
1300148	Bp192	Blood pressure QTL 192	3.47		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	17	34550843	73951021	Rat
724528	Uae4	Urinary albumin excretion QTL 4	4.9	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	17	35837085	69599340	Rat
2301412	Kidm40	Kidney mass QTL 40		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	17	37479847	82479847	Rat
2317054	Aia12	Adjuvant induced arthritis QTL 12	4.24		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	17	38281509	83281509	Rat
2317060	Aia26	Adjuvant induced arthritis QTL 26	3.22		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	17	38281509	83281509	Rat
1598871	Memor5	Memory QTL 5	5.3		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	17	40540041	80387013	Rat
1358295	Aocep1	Aortic cell protein QTL 1	6.1	0.00000071	thoracic aorta cellular protein amount (VT:0010598)	aortic cell percentage	17	40990005	85990005	Rat
631497	Bp98	Blood pressure QTL 98	3.66		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	41354651	60463643	Rat
1354635	Bp245	Blood pressure QTL 245	6		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	17	42073160	69599340	Rat
1354635	Bp245	Blood pressure QTL 245	6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	42073160	69599340	Rat

Markers in Region

D17Rat21

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	17	48,043,531 - 48,043,665 (+)	MAPPER	mRatBN7.2
Rnor_6.0	17	50,839,434 - 50,839,567	NCBI	Rnor6.0
Rnor_5.0	17	48,905,725 - 48,905,858	UniSTS	Rnor5.0
RGSC_v3.4	17	56,163,436 - 56,163,570	RGD	RGSC3.4
RGSC_v3.4	17	56,163,437 - 56,163,570	UniSTS	RGSC3.4
RGSC_v3.1	17	56,166,278 - 56,166,411	RGD
Celera	17	44,119,786 - 44,119,919	UniSTS
RH 3.4 Map	17	485.19	RGD
RH 3.4 Map	17	485.19	UniSTS
RH 2.0 Map	17	368.2	RGD
SHRSP x BN Map	17	30.3699	RGD
Cytogenetic Map	17	q12.1	UniSTS

D17Rat22

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	17	47,666,945 - 47,667,122 (+)	MAPPER	mRatBN7.2
Rnor_6.0	17	50,446,749 - 50,446,925	NCBI	Rnor6.0
Rnor_5.0	17	48,516,679 - 48,516,855	UniSTS	Rnor5.0
RGSC_v3.4	17	55,773,039 - 55,773,216	RGD	RGSC3.4
RGSC_v3.4	17	55,773,040 - 55,773,216	UniSTS	RGSC3.4
RGSC_v3.1	17	55,775,880 - 55,776,057	RGD
Celera	17	43,752,261 - 43,752,437	UniSTS
RH 2.0 Map	17	372.8	RGD
SHRSP x BN Map	17	30.3699	RGD
FHH x ACI Map	17	35.5899	RGD
Cytogenetic Map	17	q12.1	UniSTS

D17Rat23

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	17	47,999,773 - 47,999,948 (+)	MAPPER	mRatBN7.2
Rnor_6.0	17	50,795,693 - 50,795,867	NCBI	Rnor6.0
Rnor_5.0	17	48,861,888 - 48,862,062	UniSTS	Rnor5.0
RGSC_v3.4	17	56,119,309 - 56,119,484	RGD	RGSC3.4
RGSC_v3.4	17	56,119,310 - 56,119,484	UniSTS	RGSC3.4
RGSC_v3.1	17	56,122,150 - 56,122,325	RGD
Celera	17	44,076,084 - 44,076,258	UniSTS
RH 2.0 Map	17	366.1	RGD
SHRSP x BN Map	17	30.3699	RGD
FHH x ACI Map	17	35.5499	RGD
Cytogenetic Map	17	q12.1	UniSTS

D17Rat121

Rat Assembly	Chr	Position (strand)	Source
Celera	17	43,805,606 - 43,805,765	UniSTS
SHRSP x BN Map	17	30.3699	RGD
SHRSP x BN Map	17	30.3699	UniSTS
Cytogenetic Map	17	q12.1	UniSTS

RH132746

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	17	48,234,061 - 48,234,266 (+)	MAPPER	mRatBN7.2
Rnor_6.0	17	51,030,650 - 51,030,854	NCBI	Rnor6.0
Rnor_5.0	17	49,096,998 - 49,097,202	UniSTS	Rnor5.0
RGSC_v3.4	17	56,354,631 - 56,354,835	UniSTS	RGSC3.4
Celera	17	44,309,478 - 44,309,682	UniSTS
RH 3.4 Map	17	488.7	UniSTS
Cytogenetic Map	17	q12.1	UniSTS

Expression

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001014146	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039095898	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039095899	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039095900	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039095901	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039095902	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039095903	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039095904	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039095905	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039095906	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039095907	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039095909	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC079348	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474030	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000293	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000108763 ⟹ ENSRNOP00000079174

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	17	47,376,521 - 48,234,376 (+)	Ensembl

RefSeq Acc Id:

NM_001014146 ⟹ NP_001014168

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	17	47,376,522 - 48,234,362 (+)	NCBI
Rnor_6.0	17	49,991,314 - 51,030,950 (+)	NCBI
Rnor_5.0	17	48,313,139 - 49,097,298 (+)	NCBI
RGSC_v3.4	17	55,271,485 - 56,354,931 (+)	RGD
Celera	17	43,461,380 - 44,309,778 (+)	RGD

Sequence:

show sequence

GGGCGATGCTGCGGATGCTGGCCAGGGCGGTGGCTTTTCGGAGATCCGGCCGAGGCCAGGCCGG
CGGGAGGGGGCTGTGGACCGGCCGCCCACAGTCAGATTGTGACAGTATGAAGCCACTGGAGGGT
GTGAGAATTCTGGATCTAACAAGAGTTCTGGCTGGACCTTTTGCCACGATGAATTTAGGAGATC
TGGGAGCAGAAGTTATAAAAGTGGAGAGACCAGGAGCTGGTGATGACACACGATCTTGGGGACC
TCCTTTTGTGAACACAGAAAGTACATATTTTCTTAGTGTTAATCGAAATAAAAAAAGTATAGCT
GTTAATATCAAGGATCCAAGAGGAGTGAGAATCGTCAAAGAGCTTGCAGCCATTTGTGATGTGT
TTGTGGAAAACTATGTCCCTGGGAAGCTTTCTGAGATGGGCCTAGGATATGCAGATATAGATAA
GATTGCGCCTCACATCGTCTACTGCTCCATCACAGGATATGGCCAGACAGGGCCCATGTCTCAC
AGAGCAGGCTATGATGCTATTGCCTCTGCTATGTCTGGTCTAATGCACATCACAGGACCTGAGG
ATGGAGATCCTGTTCGCCCAGGAGTGGCCATGACTGATCTTGCCACTGGCCTTTTTGCCTATGG
GGCGATTATGGCTGGCCTCATACAACGTTACAGAACTGGAAAAGGATTGTTTATCGATTGTAAT
CTACTGTCATCCCAGGTGGCATGTTTGACCCAAGTAGCTGCCAATTATCTTATTGGACAAAAGG
AAGCCAAACGCTGGGGCACAGCTCATGGCAGTATTGTTCCGTATCAGGCCTTTAAGACCAAGGA
CGGCTATCTTGTCATTGGAGCAGGAAATAACCAGCAGTTTGCTGTTTTATGCAAGATCTTGAAT
TTGCCTGAATTGATTGATGACAGCAAGTATAGAACGAACCACCTTCGGGTACAGAATAGAAAAG
AGCTTGTGAAAATCCTATCGGCACGGTTTGCAGAAGAAGTGACTGCCAAGTGGCTTTGTCTCTT
TGAAGGAAGTGGGATCCCATATGGCCCAATCAACAGTCTGAAGGATGTGTTTTCCGAAGCCCAG
GTATTGCACAATGGCCTCGTTATGGAGATGAATCATCCCACTGTGGGGAAGATTTCGGTCCCAG
GTCCAGCTGTGAGATACAGCAAGTTCAAGATGTCAGAGGCAAAGCCACCCCCCCTGCTGGGACA
ACACACAAGGCACATCCTGAAGGAGGTCCTTAGATATGATGAGGGGGTCATTGGAGAGCTACTC
TGCTCTGGTGTAATAGAGCAACATGAAACCGAGTGACAGAGAAGAATGCGTCAGAAAACTTCAC
TTGGCCAGCCCAGACAGTGAGTGCTCTGTGCGTGCCTTTCCCCAGTCTTGATCCCACTACAAAG
CATGGTGAGGAGAACTGAAGATTACTTGCCTGGCATCTCTGGGGTAACTTTAGAATTAAAGTCT
AATGCCCATTTAGAAACTTACTGTTTTGAATTCCCCCCGCCCCAGAATATAATTTGTTTATTTG
TGGACTTTGATTAATTCTAATTTTTTCATCCAAAAGAAGTGATAACTGTTTGGTGATGGTATGT
TGTTCTGATTTAATTCCTCCACAATGTATACATGTATGGAAACATCAAATTATAAATTGTAGTT
TTGATTAGTCAGTTGAAAAATAAAACAAAACATAAAAATAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAA

hide sequence

RefSeq Acc Id:

XM_039095898 ⟹ XP_038951826

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	17	47,376,392 - 48,234,362 (+)	NCBI

RefSeq Acc Id:

XM_039095899 ⟹ XP_038951827

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	17	47,376,392 - 48,234,362 (+)	NCBI

RefSeq Acc Id:

XM_039095900 ⟹ XP_038951828

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	17	47,380,484 - 48,234,362 (+)	NCBI

RefSeq Acc Id:

XM_039095901 ⟹ XP_038951829

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	17	47,376,495 - 48,234,362 (+)	NCBI

RefSeq Acc Id:

XM_039095902 ⟹ XP_038951830

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	17	47,376,392 - 48,234,362 (+)	NCBI

RefSeq Acc Id:

XM_039095903 ⟹ XP_038951831

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	17	47,376,392 - 48,234,362 (+)	NCBI

RefSeq Acc Id:

XM_039095904 ⟹ XP_038951832

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	17	47,415,942 - 48,234,362 (+)	NCBI

RefSeq Acc Id:

XM_039095905 ⟹ XP_038951833

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	17	47,415,942 - 48,234,362 (+)	NCBI

RefSeq Acc Id:

XM_039095906 ⟹ XP_038951834

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	17	47,415,942 - 48,234,362 (+)	NCBI

RefSeq Acc Id:

XM_039095907 ⟹ XP_038951835

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	17	47,460,777 - 48,234,362 (+)	NCBI

RefSeq Acc Id:

XM_039095909 ⟹ XP_038951837

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	17	47,477,289 - 48,234,362 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001014168	(Get FASTA)	NCBI Sequence Viewer
	XP_038951826	(Get FASTA)	NCBI Sequence Viewer
	XP_038951827	(Get FASTA)	NCBI Sequence Viewer
	XP_038951828	(Get FASTA)	NCBI Sequence Viewer
	XP_038951829	(Get FASTA)	NCBI Sequence Viewer
	XP_038951830	(Get FASTA)	NCBI Sequence Viewer
	XP_038951831	(Get FASTA)	NCBI Sequence Viewer
	XP_038951832	(Get FASTA)	NCBI Sequence Viewer
	XP_038951833	(Get FASTA)	NCBI Sequence Viewer
	XP_038951834	(Get FASTA)	NCBI Sequence Viewer
	XP_038951835	(Get FASTA)	NCBI Sequence Viewer
	XP_038951837	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH79348	(Get FASTA)	NCBI Sequence Viewer
	EDL87401	(Get FASTA)	NCBI Sequence Viewer
	EDL87402	(Get FASTA)	NCBI Sequence Viewer
	Q68FU4	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001014168 ⟸ NM_001014146

- UniProtKB:

F1LXJ6 (UniProtKB/Swiss-Prot), Q68FU4 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MLRMLARAVAFRRSGRGQAGGRGLWTGRPQSDCDSMKPLEGVRILDLTRVLAGPFATMNLGDLG
AEVIKVERPGAGDDTRSWGPPFVNTESTYFLSVNRNKKSIAVNIKDPRGVRIVKELAAICDVFV
ENYVPGKLSEMGLGYADIDKIAPHIVYCSITGYGQTGPMSHRAGYDAIASAMSGLMHITGPEDG
DPVRPGVAMTDLATGLFAYGAIMAGLIQRYRTGKGLFIDCNLLSSQVACLTQVAANYLIGQKEA
KRWGTAHGSIVPYQAFKTKDGYLVIGAGNNQQFAVLCKILNLPELIDDSKYRTNHLRVQNRKEL
VKILSARFAEEVTAKWLCLFEGSGIPYGPINSLKDVFSEAQVLHNGLVMEMNHPTVGKISVPGP
AVRYSKFKMSEAKPPPLLGQHTRHILKEVLRYDEGVIGELLCSGVIEQHETE

hide sequence

RefSeq Acc Id:	XP_038951827 ⟸ XM_039095899
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_038951830 ⟸ XM_039095902
- Peptide Label:	isoform X4

RefSeq Acc Id:	XP_038951826 ⟸ XM_039095898
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038951831 ⟸ XM_039095903
- Peptide Label:	isoform X5

RefSeq Acc Id:	XP_038951829 ⟸ XM_039095901
- Peptide Label:	isoform X3

RefSeq Acc Id:	XP_038951828 ⟸ XM_039095900
- Peptide Label:	isoform X3

RefSeq Acc Id:	XP_038951833 ⟸ XM_039095905
- Peptide Label:	isoform X6

RefSeq Acc Id:	XP_038951832 ⟸ XM_039095904
- Peptide Label:	isoform X6

RefSeq Acc Id:	XP_038951834 ⟸ XM_039095906
- Peptide Label:	isoform X7

RefSeq Acc Id:	XP_038951835 ⟸ XM_039095907
- Peptide Label:	isoform X7

RefSeq Acc Id:	XP_038951837 ⟸ XM_039095909
- Peptide Label:	isoform X8

RefSeq Acc Id:

ENSRNOP00000079174 ⟸ ENSRNOT00000108763

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q68FU4-F1-model_v2	AlphaFold	Q68FU4	1-436	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1308114	AgrOrtholog
BioCyc Gene	G2FUF-9111	BioCyc
Ensembl Genes	ENSRNOG00000066247	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Protein	ENSRNOP00000079174	ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000108763	ENTREZGENE, UniProtKB/Swiss-Prot
Gene3D-CATH	3.30.1540.10	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7107655	IMAGE-MGC_LOAD
InterPro	CoA-Trfase_fam_III	UniProtKB/Swiss-Prot
	CoA-Trfase_III_dom3_sf	UniProtKB/Swiss-Prot
	CoA-Trfase_III_dom_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:361253	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:94802	IMAGE-MGC_LOAD
NCBI Gene	361253	ENTREZGENE
PANTHER	SUCCINATE--HYDROXYMETHYLGLUTARATE COA-TRANSFERASE	UniProtKB/Swiss-Prot
	SUCCINATE--HYDROXYMETHYLGLUTARATE COA-TRANSFERASE	UniProtKB/Swiss-Prot
Pfam	CoA_transf_3	UniProtKB/Swiss-Prot
PhenoGen	Sugct	PhenoGen
Superfamily-SCOP	SSF89796	UniProtKB/Swiss-Prot
UniProt	F1LXJ6	ENTREZGENE
	Q68FU4	ENTREZGENE, UniProtKB/Swiss-Prot
UniProt Secondary	F1LXJ6	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-12-31	Sugct	succinylCoA:glutarate-CoA transferase	RGD1308114	similar to cDNA sequence AF397014	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	RGD1308114	similar to cDNA sequence AF397014	RGD1308114_predicted	similar to cDNA sequence AF397014 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-20	RGD1308114_predicted	similar to cDNA sequence AF397014 (predicted)	LOC361253_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC361253_predicted	similar to cDNA sequence AF397014 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM