Advanced Search (OLGA)

Gene: Mrpl50 (mitochondrial ribosomal protein L50) Rattus norvegicus

Analyze

Symbol:

Mrpl50

Name:

mitochondrial ribosomal protein L50

RGD ID:

1308008

Description:

Predicted to be located in cytosol and mitochondrion. Predicted to be part of mitochondrial large ribosomal subunit. Orthologous to human MRPL50 (mitochondrial ribosomal protein L50); INTERACTS WITH alpha-Zearalanol; amitrole; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

39S ribosomal protein L50, mitochondrial; large ribosomal subunit protein mL50; LOC362517

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	68,662,933 - 68,668,087 (-)	NCBI		GRCr8
mRatBN7.2	5	63,867,437 - 63,872,591 (-)	NCBI	mRatBN7.2	mRatBN7.2
UTH_Rnor_SHR_Utx	5	65,798,163 - 65,803,310 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	67,617,495 - 67,622,642 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	67,586,875 - 67,592,022 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	64,784,164 - 64,789,318 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	64,784,170 - 64,789,318 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	69,275,573 - 69,280,730 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	66,261,553 - 66,266,710 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	66,267,116 - 66,271,803 (-)	NCBI
Celera	5	63,735,392 - 63,740,545 (+)	NCBI		Celera
Cytogenetic Map	5	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

fructose-1,6-bisphosphatase deficiency (ISO)

hereditary fructose intolerance syndrome (ISO)

intellectual disability (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-dexrazoxane (ISO)

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

4,4'-sulfonyldiphenol (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

amitrole (EXP)

Aroclor 1254 (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

chloropicrin (ISO)

chromium(6+) (ISO)

ciguatoxin CTX1B (ISO)

cyclosporin A (ISO)

cylindrospermopsin (ISO)

Dibutyl phosphate (ISO)

dicrotophos (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

enzyme inhibitor (ISO)

ethanol (ISO)

ethyl methanesulfonate (ISO)

fenthion (ISO)

finasteride (EXP)

flutamide (EXP)

folic acid (ISO)

fulvestrant (ISO)

ivermectin (ISO)

ketamine (EXP)

leflunomide (EXP)

lipopolysaccharide (ISO)

methimazole (EXP)

methyl methanesulfonate (ISO)

nefazodone (EXP)

nickel atom (ISO)

nimesulide (EXP)

oxaliplatin (EXP)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP)

phenobarbital (ISO)

pirinixic acid (ISO)

propiconazole (ISO)

quercetin (ISO)

resorcinol (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

succimer (ISO)

sulfadimethoxine (EXP)

sunitinib (ISO)

thimerosal (ISO)

thiram (ISO)

topotecan (EXP)

trichloroethene (ISO)

trichostatin A (ISO)

triphenyl phosphate (ISO)

urethane (ISO)

valproic acid (ISO)

vincristine (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Cellular Component

cytosol (ISO)

mitochondrial large ribosomal subunit (ISO)

mitochondrion (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:14651853	PMID:18614015	PMID:25278503	PMID:28892042

Genomics

Comparative Map Data

Mrpl50
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	68,662,933 - 68,668,087 (-)	NCBI		GRCr8
mRatBN7.2	5	63,867,437 - 63,872,591 (-)	NCBI	mRatBN7.2	mRatBN7.2
UTH_Rnor_SHR_Utx	5	65,798,163 - 65,803,310 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	67,617,495 - 67,622,642 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	67,586,875 - 67,592,022 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	64,784,164 - 64,789,318 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	64,784,170 - 64,789,318 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	69,275,573 - 69,280,730 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	66,261,553 - 66,266,710 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	66,267,116 - 66,271,803 (-)	NCBI
Celera	5	63,735,392 - 63,740,545 (+)	NCBI		Celera
Cytogenetic Map	5	q22	NCBI

MRPL50
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	101,387,633 - 101,398,618 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	101,387,633 - 101,398,618 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	9	104,149,915 - 104,160,900 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	103,192,070 - 103,200,717 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	9	101,231,803 - 101,240,451	NCBI
Celera	9	74,665,854 - 74,674,524 (-)	NCBI		Celera
Cytogenetic Map	9	q31.1	NCBI
HuRef	9	73,751,699 - 73,760,369 (-)	NCBI		HuRef
CHM1_1	9	104,298,663 - 104,307,332 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	9	113,559,613 - 113,570,593 (-)	NCBI		T2T-CHM13v2.0

Mrpl50
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	49,512,597 - 49,521,083 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	49,512,596 - 49,521,093 (-)	Ensembl		GRCm39 Ensembl
GRCm38	4	49,512,597 - 49,521,083 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	49,512,596 - 49,521,093 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	49,525,469 - 49,533,955 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	49,533,697 - 49,542,183 (-)	NCBI		MGSCv36	mm8
Celera	4	49,540,851 - 49,549,337 (-)	NCBI		Celera
Cytogenetic Map	4	B1	NCBI
cM Map	4	26.54	NCBI

Mrpl50
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955419	24,416,556 - 24,425,288 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955419	24,416,556 - 24,425,288 (+)	NCBI	ChiLan1.0	ChiLan1.0

MRPL50
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	11	37,963,998 - 37,974,042 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	9	37,966,381 - 37,976,417 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	9	72,598,030 - 72,607,297 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	9	100,592,607 - 100,601,435 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	9	100,592,607 - 100,601,435 (-)	Ensembl	panpan1.1		panPan2

MRPL50
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	11	58,126,242 - 58,129,171 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	11	58,126,547 - 58,129,123 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	11	56,571,953 - 56,574,915 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	11	59,263,004 - 59,265,966 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	11	59,263,072 - 59,265,911 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	11	57,772,750 - 57,775,710 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	11	57,785,796 - 57,788,783 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	11	58,483,375 - 58,486,338 (-)	NCBI		UU_Cfam_GSD_1.0

Mrpl50
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	173,010,718 - 173,016,859 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936524	9,558,835 - 9,564,452 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936524	9,558,298 - 9,564,414 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MRPL50
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	243,100,372 - 243,107,084 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	243,100,365 - 243,106,831 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	271,655,691 - 271,660,590 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

MRPL50
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	12	38,042,285 - 38,050,896 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	12	38,042,317 - 38,050,527 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666035	4,503,857 - 4,511,616 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Mrpl50
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624758	9,901,143 - 9,916,504 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624758	9,901,076 - 9,915,639 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Mrpl50
13 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	313
Count of miRNA genes:	188
Interacting mature miRNAs:	211
Transcripts:	ENSRNOT00000009678
Prediction methods:	Microtar, Miranda
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578776	Stresp18	Stress response QTL 18	2.9		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	5	27955440	72955440	Rat
1298067	Scl15	Serum cholesterol level QTL 15	4.8	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	33215665	78215665	Rat
1300115	Hrtrt7	Heart rate QTL 7	2.76		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	5	47869062	90099692	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	40128307	148607290	Rat
70212	Niddm25	Non-insulin dependent diabetes mellitus QTL 25	3.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	1	131345958	Rat
1358353	Srcrtb2	Stress Responsive Cort Basal QTL 2	3.48	0.003	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	18873947	74251464	Rat
1598814	Mcs13	Mammary carcinoma susceptibility QTL 13		0.0001	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	63190890	69927503	Rat
634305	Mamtr1	Mammary tumor resistance QTL 1		0.0001	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	12789751	113558310	Rat
61386	Bp49	Blood pressure QTL 49	16.6		cerebrum integrity trait (VT:0010549)	brain infarction volume (CMO:0001013)	5	60293434	98603051	Rat
1331801	Rf33	Renal function QTL 33	4.149		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	43726656	129132602	Rat
1598807	Glom12	Glomerulus QTL 12	2.7		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	5	33215665	78215665	Rat
1302786	Kidm8	Kidney mass QTL 8	28.15		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	5	33215665	78215665	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	60293434	161481680	Rat
6903292	Stl28	Serum triglyceride level QTL 28	2.6	0.0073	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	5	28515489	73515489	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	46711509	161317411	Rat
1578767	Stresp17	Stress response QTL 17	4.3	0.01	blood aldosterone amount (VT:0005346)	plasma aldosterone level (CMO:0000551)	5	27955440	72955440	Rat
7411561	Bw134	Body weight QTL 134	24	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	49463600	94463600	Rat
1641922	Alcrsp8	Alcohol response QTL 8			alcohol metabolism trait (VT:0015089)	blood ethanol level (CMO:0000535)	5	35189153	68564008	Rat
2303615	Vencon7	Ventilatory control QTL 7		0.001	respiration trait (VT:0001943)	respiration rate (CMO:0000289)	5	50983895	95983895	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	50328551	141643988	Rat
1641912	Alcrsp18	Alcohol response QTL 18			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	35189153	141643988	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
6903306	Scl35	Serum cholesterol QTL 35	2.6	0.0073	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	28515489	73515489	Rat
1576317	Eutr2	Estrogen induced uterine response QTL 2		0.01	uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	34730116	104251008	Rat
7394712	Emca13	Estrogen-induced mammary cancer QTL 13			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	9823266	99753708	Rat
1331773	Scl26	Serum cholesterol level QTL 26	3.065		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	43726656	86724018	Rat
70189	Mcs5	Mammary carcinoma susceptibility QTL 5	10.51		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	55805606	132207589	Rat
1331771	Rf35	Renal function QTL 35	4.36965		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	729470	86724018	Rat
61359	Eaex	Experimental allergic encephalomyelitis QTL x	3		nervous system integrity trait (VT:0010566)	post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422)	5	55715622	100715622	Rat
8662454	Vetf3	Vascular elastic tissue fragility QTL 3	27.4		artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	5	2282226	69540447	Rat
2290448	Scl54	Serum cholesterol level QTL 54	2.93		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	31663789	131345958	Rat
61426	Scl2	Serum cholesterol level QTL 2	7.3	0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	59793399	143070159	Rat
9589025	Epfw7	Epididymal fat weight QTL 7	20.66	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	5	49463600	94463600	Rat
2303574	Gluco42	Glucose level QTL 42	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	53496719	98496719	Rat
1331756	Rf34	Renal function QTL 34	4.16275		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	1	90450412	Rat
8552954	Pigfal14	Plasma insulin-like growth factor 1 level QTL 14	9		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	21226744	66226744	Rat
2316954	Rf57	Renal function QTL 57	0		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	5	59793528	90450144	Rat
1358895	Bp254	Blood pressure QTL 254	3.6	0.0003	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	5	58829236	128034027	Rat
2316959	Gluco59	Glucose level QTL 59	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	34944474	113558310	Rat
1600358	Mamtr5	Mammary tumor resistance QTL 5			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	18873947	63873947	Rat
2316957	Pur21	Proteinuria QTL 21	6.2		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	5	59793528	113558156	Rat

Markers in Region

RH127654

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	51,209,874 - 51,210,093 (+)	MAPPER	mRatBN7.2
mRatBN7.2	5	63,867,959 - 63,868,161 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	64,784,687 - 64,784,888	NCBI	Rnor6.0
Rnor_6.0	7	58,576,579 - 58,576,797	NCBI	Rnor6.0
Rnor_5.0	7	58,585,045 - 58,585,263	UniSTS	Rnor5.0
Rnor_5.0	5	69,276,096 - 69,276,300	UniSTS	Rnor5.0
RGSC_v3.4	5	66,262,076 - 66,262,280	UniSTS	RGSC3.4
RGSC_v3.4	7	54,862,074 - 54,862,292	UniSTS	RGSC3.4
Celera	7	47,998,278 - 47,998,496	UniSTS
Celera	5	63,739,822 - 63,740,023	UniSTS
RH 3.4 Map	5	563.39	UniSTS
Cytogenetic Map	7	q22	UniSTS
Cytogenetic Map	5	q22	UniSTS

RH137145

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	51,210,570 - 51,210,778 (+)	MAPPER	mRatBN7.2
mRatBN7.2	5	63,868,653 - 63,868,861 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	64,785,381 - 64,785,588	NCBI	Rnor6.0
Rnor_6.0	7	58,577,275 - 58,577,482	NCBI	Rnor6.0
Rnor_5.0	7	58,585,741 - 58,585,948	UniSTS	Rnor5.0
Rnor_5.0	5	69,276,793 - 69,277,000	UniSTS	Rnor5.0
RGSC_v3.4	5	66,262,773 - 66,262,980	UniSTS	RGSC3.4
RGSC_v3.4	7	54,862,770 - 54,862,977	UniSTS	RGSC3.4
Celera	7	47,998,974 - 47,999,181	UniSTS
Celera	5	63,739,122 - 63,739,329	UniSTS
Cytogenetic Map	7	q22	UniSTS
Cytogenetic Map	5	q22	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001108665	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC111278	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474056	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000078957 ⟹ ENSRNOP00000071446

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	5	64,784,170 - 64,789,318 (-)	Ensembl

RefSeq Acc Id:

NM_001108665 ⟹ NP_001102135

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	68,662,933 - 68,668,087 (-)	NCBI
mRatBN7.2	5	63,867,437 - 63,872,591 (-)	NCBI
Rnor_6.0	5	64,784,164 - 64,789,318 (-)	NCBI
Rnor_5.0	5	69,275,573 - 69,280,730 (-)	NCBI
RGSC_v3.4	5	66,261,553 - 66,266,710 (-)	RGD
Celera	5	63,735,392 - 63,740,545 (+)	RGD

Sequence:

show sequence

ACGTCGGCGCTTTGGGGAGCTTGTCGAAGATGGCGGCGCTGTGTGTGTGTCGGTTTGCAAGAAG
AGGCTGGCTGTGGAAGCCTCCCTTGGCTACACGTAGAGAATTCTGGTCTAGATCCAGGAAGGAG
AAGGAGCTGGTGGTGGCCGAGACAGTGGAAGAAGTGAAAAAAGCACCTGCTTTGGTGTGTCCAC
CCTTACGAAGCCGAGCATACACACCACCCAGTGATCTCCAGAGTCGCTTGGAATCTCATATTAA
AGAAGTTCTTGGTTCATCTCTTCCTAATAATTGGCAAGATATCTCCCTGGATGATGGACATGTG
AAGTTCAGACTCCTAGCAAATTTAGCTGATGACTTAGGCCATGCAGTACCTAACTCCAGGCTTC
ACCAAATGTGCAGGGTCAGAGATGTTCTTGATTTCTATAATGTTCCTGTTCAAGACAGATCTAA
ATTTGATGAACTCATTGCTAGTAATTTACCTCCCAATTTGAAAATCAGTTGGAATTACTGAGCA
GTCCAGTCAGAACACAGTGAGATCATTCTCATTCTTCTCATTGGGTGACTGACAGCGAACTTTG
TGAGATGTTACCTATTAGAACTTGTTTCAGAACTTCCTTTTTTTTTTCTTTTCTCCTTGTAGAA
GAACACATTTTTTTTTTCTCTCATGGAGCATCAACAAAGAAAACATTATCACATTTGCTAAAGC
TATTTATCCCCAATAAAATCAAGTCTTGATAATTTATGAAAACATTCTTATTCCATGGTATATA
GTCAGGGTTGTTGAGAGGAACAGAAGTGGTAGCATGGAAGCCTATTTAAATGGGATTTATTATG
TTAGCTTACATTAGGATCTGGGTAGTCCATCAATGACTGTCTCACACCAGAGAGGCCAAGAACC
TCAGGCACATACTTGTACCCTTCATGAGGCGGACAGTCTCGGTAGTAGCAAGCCGCTGCTGAAG
GCCTCGGGGAGTCTTTGAAGAGCTTACTGGTCTTCAGTCCATGCTGGCTCCCTGAAGAAGCTGT
TCTGATACAAACGAAGAGATGCAGCAATGGCAGGAACGAGATACATGTATTTGCCAGGACAGAG
AAGGCAAGCAGGCAGAAAGCATGGTTCTGCCCACATTTACTGTACACTTCCCTCTTGAGAGATA
ATCCCCCAGTGGAATGGCCAGCTGCTTGTCTTTTAGTTGACTCCAGATCAGTCAAGTTGACAAC
CAAGATTAACCATCACAGGAAAATGCTAAGTAACTTGGGTTTCAGATAAGAGGCCATTGCAAGT
TCAAATGTTTTCTTTGCCCTTCATATGGCTAAAGTAGTTTCAATAAAATGTTCTAATCTTATTA
AGGCTCAAAGATATGGGATGATATATATATATATTTTGTTTTCCTTTTAATACTAGGTGTGGGA
TATGGGGCAGCTTCTGATTGTCCACTGCAGCTGACTAGGATTTGCCTTGGGGTCTAGCAGGGGC
GTGTTATTTTCCAATTGTAGATAGTTTCTACGATTGTGTGAGGTTTGGAATTCTGGGGATTCTT
CAGAGGGTAAAGGTTAGGGCCCTAAGAGGGGTGAGTTGTTGATTGTTGTGTTTGATAAGCAGTC
ATGAACAAACAAGAAACAAGAAGAAGAAATTAGATGTCCCAATGATGAAGATCACACTTGCCCC
AAGGAACATGATGGCCTTTGATTGGCAGAGTGTAATGATAACATCACCGCCTTTCTCCTCTGTC
CTTTTTTCTGTGCTATCTAGGGGGTTGAAGGGATGGAAGAAGAGTGAAGAAGGGTGGAGGGAAA
AAG

hide sequence

Protein Sequences


Protein RefSeqs	NP_001102135	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL78182	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001102135 ⟸ NM_001108665
- UniProtKB:	A6KJE4 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAALCVCRFARRGWLWKPPLATRREFWSRSRKEKELVVAETVEEVKKAPALVCPPLRSRAYTPP SDLQSRLESHIKEVLGSSLPNNWQDISLDDGHVKFRLLANLADDLGHAVPNSRLHQMCRVRDVL DFYNVPVQDRSKFDELIASNLPPNLKISWNY hide sequence

Ensembl Acc Id:

ENSRNOP00000071446 ⟸ ENSRNOT00000078957

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZYL4-F1-model_v2	AlphaFold	D3ZYL4	1-159	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13693729

Promoter ID:

EPDNEW_R4254

Type:

multiple initiation site

Name:

Mrpl50_1

Description:

mitochondrial ribosomal protein L50

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	64,789,296 - 64,789,356	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1308008	AgrOrtholog
BioCyc Gene	G2FUF-41328	BioCyc
Ensembl Genes	ENSRNOG00000053615	Ensembl
InterPro	Ribosomal_L50_mt	UniProtKB/TrEMBL
KEGG Report	rno:362517	UniProtKB/TrEMBL
NCBI Gene	362517	ENTREZGENE
PANTHER	39A RIBOSOMAL PROTEIN L50, MITOCHONDRIAL	UniProtKB/TrEMBL
	39S RIBOSOMAL PROTEIN L50, MITOCHONDRIAL	UniProtKB/TrEMBL
Pfam	Ribosomal_L50	UniProtKB/TrEMBL
PhenoGen	Mrpl50	PhenoGen
RatGTEx	ENSRNOG00000053615	RatGTEx
UniProt	A6KJE4	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-04-30	Mrpl50	mitochondrial ribosomal protein L50	Mrpl50_predicted	mitochondrial ribosomal protein L50 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Mrpl50_predicted	mitochondrial ribosomal protein L50 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar