Advanced Search (OLGA)

Gene: Fastkd2 (FAST kinase domains 2) Rattus norvegicus

Analyze

Symbol:

Fastkd2

Name:

FAST kinase domains 2

RGD ID:

1307883

Description:

Predicted to enable rRNA binding activity. Predicted to be involved in several processes, including mitochondrial gene expression; mitochondrial large ribosomal subunit assembly; and post-transcriptional regulation of gene expression. Predicted to be located in mitochondrial nucleoid. Predicted to be active in mitochondrial matrix and ribonucleoprotein granule. Human ortholog(s) of this gene implicated in combined oxidative phosphorylation deficiency 44. Orthologous to human FASTKD2 (FAST kinase domains 2); INTERACTS WITH 3-chloropropane-1,2-diol; 6-propyl-2-thiouracil; alpha-Zearalanol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

FAST kinase domain-containing protein 2; FAST kinase domain-containing protein 2, mitochondrial; LOC301463; MGC94943; RGD1307883; similar to RIKEN cDNA 2810421I24

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	FASTKD2 (FAST kinase domains 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Fastkd2 (FAST kinase domains 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Fastkd2 (FAST kinase domains 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	FASTKD2 (FAST kinase domains 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	FASTKD2 (FAST kinase domains 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Fastkd2 (FAST kinase domains 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	FASTKD2 (FAST kinase domains 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	FASTKD2 (FAST kinase domains 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Fastkd2 (FAST kinase domains 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	CNNM2 (cyclin and CBS domain divalent metal cation transport mediator 2)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	FASTKD2 (FAST kinase domains 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Fastkd2 (FAST kinase domains 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	fastkd2 (FAST kinase domains 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	fastkd2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	fastkd2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	72,659,961 - 72,681,986 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	9	72,661,764 - 72,721,338 (+)	Ensembl				GRCr8
mRatBN7.2	9	65,166,148 - 65,188,184 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	65,168,228 - 65,188,174 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	9	73,672,595 - 73,694,570 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	78,818,358 - 78,838,281 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	77,207,765 - 77,229,777 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	70,448,386 - 70,471,420 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	70,450,444 - 70,470,550 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	9	72,101,988 - 72,124,858 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	9	62,416,429 - 62,438,600 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	9	62,576,636 - 62,598,633 (+)	NCBI		Celera
RGSC_v3.1	9	62,566,880 - 62,585,582 (+)	NCBI
Cytogenetic Map	9	q32	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

combined oxidative phosphorylation deficiency 44 (ISO)

cytochrome-c oxidase deficiency disease (ISO)

genetic disease (ISO)

Leigh disease (ISO)

mitochondrial complex IV deficiency nuclear type 1 (ISO)

Neurodevelopmental Disorders (ISO)

primary pulmonary hypertension (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4,4'-trichlorobiphenyl (ISO)

3-chloropropane-1,2-diol (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

6-propyl-2-thiouracil (EXP)

acrylamide (ISO)

aflatoxin B1 (ISO)

alpha-Zearalanol (EXP)

aristolochic acid A (ISO)

auramine O (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (EXP,ISO)

cadmium dichloride (ISO)

caffeine (ISO)

chlorpyrifos (ISO)

chromium(6+) (ISO)

DDE (ISO)

deoxynivalenol (ISO)

dexamethasone (ISO)

dibutyl phthalate (ISO)

diclofenac (ISO)

dicrotophos (ISO)

flutamide (EXP)

FR900359 (ISO)

ibuprofen (ISO)

indometacin (ISO)

ivermectin (ISO)

methimazole (EXP)

methylmercury chloride (ISO)

paracetamol (EXP,ISO)

paraquat (EXP)

PCB138 (ISO)

perfluorooctanoic acid (EXP,ISO)

pirinixic acid (ISO)

potassium chromate (ISO)

potassium dichromate (ISO)

propiconazole (EXP)

quercetin (ISO)

resveratrol (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

sodium dichromate (EXP)

sulfadimethoxine (EXP)

sunitinib (ISO)

thimerosal (ISO)

thioacetamide (EXP)

trichostatin A (ISO)

triphenyl phosphate (ISO)

triptonide (ISO)

urethane (ISO)

valdecoxib (EXP)

valproic acid (ISO)

vinclozolin (EXP)

vincristine (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

apoptotic process (ISO,ISS)

mitochondrial large ribosomal subunit assembly (ISO,ISS)

mitochondrial RNA processing (IBA)

mitochondrial translation (ISO,ISS)

positive regulation of mitochondrial translation (ISO,ISS)

regulation of mitochondrial mRNA stability (IBA,IEA)

ribosome biogenesis (IEA)

RNA processing (ISO,ISS)

Cellular Component

mitochondrial matrix (IBA,IEA,ISO)

mitochondrial nucleoid (IEA,ISO,ISS)

mitochondrion (IEA,ISO,ISS)

ribonucleoprotein granule (IBA,ISO,ISS)

Molecular Function

protein binding (ISO)

RNA binding (IBA,IEA)

rRNA binding (IEA,ISO,ISS)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
3.	GOA pipeline	RGD automated data pipeline
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	Fast kinase domain-containing protein 3 is a mitochondrial protein essential for cellular respiration.	Simarro M, etal., Biochem Biophys Res Commun. 2010 Oct 22;401(3):440-6. doi: 10.1016/j.bbrc.2010.09.075. Epub 2010 Sep 24.

Additional References at PubMed

PMID:12477932	PMID:15489334	PMID:18614015	PMID:22658674	PMID:22681889	PMID:25683715	PMID:27667664

Genomics

Comparative Map Data

Fastkd2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	72,659,961 - 72,681,986 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	9	72,661,764 - 72,721,338 (+)	Ensembl				GRCr8
mRatBN7.2	9	65,166,148 - 65,188,184 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	65,168,228 - 65,188,174 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	9	73,672,595 - 73,694,570 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	78,818,358 - 78,838,281 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	77,207,765 - 77,229,777 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	70,448,386 - 70,471,420 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	70,450,444 - 70,470,550 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	9	72,101,988 - 72,124,858 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	9	62,416,429 - 62,438,600 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	9	62,576,636 - 62,598,633 (+)	NCBI		Celera
RGSC_v3.1	9	62,566,880 - 62,585,582 (+)	NCBI
Cytogenetic Map	9	q32	NCBI

FASTKD2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	206,765,606 - 206,796,189 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	206,765,357 - 206,796,189 (+)	Ensembl			hg38	GRCh38
GRCh37	2	207,630,330 - 207,660,913 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	207,338,617 - 207,365,475 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	2	207,456,871 - 207,482,734	NCBI
Celera	2	201,391,543 - 201,422,344 (+)	NCBI		Celera
Cytogenetic Map	2	q33.3	NCBI
HuRef	2	199,479,654 - 199,510,786 (+)	NCBI		HuRef
CHM1_1	2	207,635,974 - 207,666,780 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	2	207,247,719 - 207,278,310 (+)	NCBI		T2T-CHM13v2.0

Fastkd2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	63,769,758 - 63,792,544 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	63,769,773 - 63,793,814 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	1	63,730,599 - 63,753,385 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	63,730,614 - 63,754,655 (+)	Ensembl			mm10	GRCm38
MGSCv37	1	63,777,199 - 63,799,959 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	1	63,664,927 - 63,687,661 (+)	NCBI		MGSCv36	mm8
Celera	1	64,257,104 - 64,279,880 (+)	NCBI		Celera
Cytogenetic Map	1	C2	NCBI
cM Map	1	32.31	NCBI

Fastkd2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955457	8,189,558 - 8,211,832 (-)	Ensembl
ChiLan1.0	NW_004955457	8,191,861 - 8,213,003 (-)	NCBI	ChiLan1.0	ChiLan1.0

FASTKD2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	13	109,373,725 - 109,400,247 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2B	109,388,704 - 109,415,920 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2B	93,999,837 - 94,030,683 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2B	212,127,918 - 212,158,723 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2B	212,129,283 - 212,154,329 (+)	Ensembl			panPan2	panpan1.1

FASTKD2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	37	15,287,446 - 15,303,005 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	37	15,287,672 - 15,302,999 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	37	16,171,414 - 16,187,190 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	37	15,224,046 - 15,239,824 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	37	15,224,199 - 15,239,744 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	37	15,169,961 - 15,185,727 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	37	15,142,983 - 15,158,740 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	37	15,147,177 - 15,162,954 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Fastkd2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	163,439,593 - 163,464,229 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936631	3,074,664 - 3,102,079 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936631	3,074,719 - 3,099,233 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

FASTKD2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	15	110,021,469 - 110,043,116 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	15	110,021,398 - 110,041,730 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	15	121,577,669 - 121,597,979 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

FASTKD2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	10	92,550,245 - 92,585,250 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	10	92,549,883 - 92,587,039 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666040	106,788,982 - 106,813,242 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Fastkd2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624765	9,181,087 - 9,208,191 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624765	9,183,490 - 9,209,631 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Variants

Variants in Fastkd2
120 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	9
Count of miRNA genes:	9
Interacting mature miRNAs:	9
Transcripts:	ENSRNOT00000002872
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
7411571	Bw138	Body weight QTL 138	14.3	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	9	32535505	77535505	Rat
11353957	Bmd92	Bone mineral density QTL 92		0.01	tibia mineral mass (VT:1000283)	volumetric bone mineral density (CMO:0001553)	9	46114199	91114199	Rat
631680	Cm11	Cardiac mass QTL 11	3.1	0.00089	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	9	20430519	65430519	Rat
61385	Edpm9	Estrogen-dependent pituitary mass QTL 9	3.43	0.05	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	9	63869687	108869687	Rat
70218	Cm28	Cardiac mass QTL 28	8.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	9	25268044	79271759	Rat
724544	Uae9	Urinary albumin excretion QTL 9	4.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	9	25268044	114175309	Rat
1578760	Cm53	Cardiac mass QTL 53	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	9	56771635	101771635	Rat
631643	Bp120	Blood pressure QTL 120	3	0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	22071200	67071200	Rat
1581580	Uae34	Urinary albumin excretion QTL 34			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	9	62072275	96470995	Rat
12879506	Pur33	Proteinuria QTL 33			urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	9	44649921	89649921	Rat
731164	Uae25	Urinary albumin excretion QTL 25	3.5	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	9	25661188	100929786	Rat
1598849	Memor17	Memory QTL 17	2.2		exploratory behavior trait (VT:0010471)	difference between duration of physical contact or close proximity of test subject and social stimulus during sample phase and test phase (CMO:0002678)	9	49968546	71098346	Rat
10058949	Gmadr5	Adrenal mass QTL 5	2	0.014	adrenal gland mass (VT:0010420)	both adrenal glands wet weight to body weight ratio (CMO:0002411)	9	42791513	87976209	Rat
1578757	Pur6	Proteinuria QTL 6	3.3	0.005	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	9	62072275	96470995	Rat
631656	Bp108	Blood pressure QTL 108	5.97	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	48598251	93598251	Rat
2303170	Bp332	Blood pressure QTL 332	3.73	0.027	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	9	55847841	77026453	Rat
8662828	Vetf6	Vascular elastic tissue fragility QTL 6	3.9		artery integrity trait (VT:0010639)	patent ductus arteriosus score (CMO:0002566)	9	36962359	92058970	Rat
61352	Bp34	Blood pressure QTL 34	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	42495343	79271511	Rat
724515	Uae16	Urinary albumin excretion QTL 16	8		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	9	58163035	100929646	Rat
731171	Glom6	Glomerulus QTL 6	2.8	0.0003	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	9	64573531	109573531	Rat
1598834	Memor11	Memory QTL 11	2.5		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	9	36962359	77814038	Rat
70186	Niddm26	Non-insulin dependent diabetes mellitus QTL 26	3.87		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	9	22071169	86369743	Rat
7207814	Bmd91	Bone mineral density QTL 91	3.5		femur size trait (VT:1000369)	femoral neck cross-sectional area (CMO:0001697)	9	23754144	83851531	Rat
6903941	Pur31	Proteinuria QTL 31		0.036	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	9	40194188	85194188	Rat
2303180	Bp333	Blood pressure QTL 333		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	56627713	78595166	Rat
2290450	Scl57	Serum cholesterol level QTL 57	4.15		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	9	36962359	95410867	Rat
11353949	Bp393	Blood pressure QTL 393			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	40194188	85194188	Rat
11353951	Bp394	Blood pressure QTL 394			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	44649921	89649921	Rat
10054125	Srcrt7	Stress Responsive Cort QTL 7	3.33	0.0011	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	9	1	87073594	Rat
1300134	Bp185	Blood pressure QTL 185	3.73		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	9	61381434	104821652	Rat
1331757	Cdexp1	CD45RC expression in CD8 T cells QTL 1	4.3		CD8-positive T cell quantity (VT:0008077)	blood CD45RC(high) CD8 T cell count to CD45RC(low) CD8 T cell count ratio (CMO:0001990)	9	1024537	67509080	Rat
7411656	Foco26	Food consumption QTL 26	9.8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	9	32535505	77535505	Rat
1578659	Tspe1	Trichinella spiralis expulsion QTL 1	4.8		parasite quantity (VT:0010441)	logarithm of the intestinal adult Trichinella spiralis count (CMO:0002024)	9	61381434	65691299	Rat
1641894	Alcrsp12	Alcohol response QTL 12			response to alcohol trait (VT:0010489)	brain neurotensin receptor 1 density (CMO:0002068)	9	27468639	72468639	Rat

Markers in Region

RH132610

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	9	65,186,932 - 65,188,085 (+)	MAPPER	mRatBN7.2
Rnor_6.0	9	70,469,193 - 70,470,344	NCBI	Rnor6.0
Rnor_5.0	9	72,103,064 - 72,104,215	UniSTS	Rnor5.0
RGSC_v3.4	9	62,437,364 - 62,438,515	UniSTS	RGSC3.4
Celera	9	62,597,397 - 62,598,548	UniSTS
RH 3.4 Map	9	534.0	UniSTS
Cytogenetic Map	9	q32	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	91	59	6	355	191	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001009673	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001398523	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC088416	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473965	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218822	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000009	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000002872 ⟹ ENSRNOP00000017281

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	9	72,662,031 - 72,721,338 (+)	Ensembl
mRatBN7.2 Ensembl	9	65,168,228 - 65,188,174 (+)	Ensembl
Rnor_6.0 Ensembl	9	70,450,444 - 70,470,550 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000159270 ⟹ ENSRNOP00000112158

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	9	72,661,764 - 72,681,986 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000161021 ⟹ ENSRNOP00000105398

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	9	72,661,910 - 72,712,632 (+)	Ensembl

RefSeq Acc Id:

NM_001009673 ⟹ NP_001009673

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	72,659,961 - 72,681,982 (+)	NCBI
mRatBN7.2	9	65,166,148 - 65,188,170 (+)	NCBI
Rnor_6.0	9	70,448,386 - 70,470,429 (+)	NCBI
Rnor_5.0	9	72,101,988 - 72,124,858 (-)	NCBI
RGSC_v3.4	9	62,416,429 - 62,438,600 (+)	RGD
Celera	9	62,576,636 - 62,598,633 (+)	RGD

Sequence:

show sequence

GTTCTAAGGACAGCCCATGGCATGTGCCCTTTTTCAGAAAGAAGTTAACTTGTGTTGCACTTTG
GGTATTTGAAAGTGCGTTTGCAGATATCAAAATGAATAACAGAGCACATACCTTCTTATGGGGC
ATCAGACAATTCAGGACTTCAATTCCAAGAAGCAGAGCTTTGAGGACATATTCTTTGGTATTTT
GCAAACCAGAAGTAATTCATTCAAAACGGAACCCAAGGAACCATCTGCTAAATGGTTTTGATGA
GGGATTGCAGCCATCTGTTAGATACCTCTTTCAGGATATATTTATTTCAAAATCAGTAGCTGGC
TGTACTCAAACTAGAGGCATAATCCATGCAGCTGGTTTTAAACTTGATAGAATACTTTGTCCTA
GAAGACTGTCCTTTGACGCAAAACATTCTTTTGTCTCTGATGGGACATCTGATCATGATTTAAT
GAAAACAAACTTTCATCATACCTCCACTGAAGATGTGCTCACCAAGAAAATGAGACCAACTCCT
GTGAATTATAAAAAGCTGGCCCAGGAGTGCAACTCTCTGAGCGATGTGCTGGACACATTTTCAA
AAGCGCCTACATTTCCTGGTAGTAACTATTTCTTAGCCATGTGGATAATTGCCAAAAGGATTTC
AGAAGACAAGAGGCGCTTTGAGAAACAACTGATGTTCAGTCACCCCGCCTTTAACCAGCTGTGT
GAGCAAATGATGAGAGAAGCCAAGATTATGCGCTATGACCACCTTTTGTTCAGTCTTAATGCTA
TCGTGAAGCTTGGAGTTCCTCAGAATTCTCTTATGGTACAGACTTTGCTGAGGACAATTCAGGA
GCGCATCAGTGAGTGTGATGAGAGATGTCTTTCAATTTTGTCGACTGCTTTAGTGACCATGGAG
CCGTGCATGAATGTGAACGCGCTTCGAGCAGGGTTGCGAATCCTAGTTGATCAGCAAGTTTGGA
ACATAAATGATATCTTCACTTTACAAACGGTGATGAGATGTATTGGGAAAGATATGAAAGCCTT
GAAGGAATTAGGCAGATTTTCTGTCTTGAATAGCCGGCATATGTTTGAAGTCTTAGCTGCCATG
GATCACCGCTCTGTCGTCCTTCTGAATGAGTGCAGTAAGATTGTCATAGATAATATCCATGGGT
GTCCTTTTAAAGTATTAATCAGCATACTGCAGTCCTGTAGAGACCTCCGATACCAAAATGAAGA
TCTTTTCAAAAGCATCGCAGATTATGTGGCTACAACCTTTGACATCTGGAAGTTGAAACACGTT
ATCTTTTTCCTCTTGTCATTTGAAACTCTTGGTTTTCGACCTCCTGGTTTGATGGACAAGCTTC
TGGAGAAAGTAGTCCAGGAGCCTGGCTCTCTGACCGTGAAGAACATTGTTTCTGTCCTTCATGT
GTATTCTTCTCTCAATCATGTCCACAATGTCCAGAACAGAGAGTTCCTAGAAGCTCTGGCAAGT
GCGCTGACTGGCTGTCTTCACCAGATCTCTTCTGAAAGCCTGTTGAATGCTGTGCATTCGTTTT
GCATGATGAATTATTTCCCCCTGGCCCCTATTAACCAGCTTATCAAAGAGAACATCATCCACGA
ACTGCTGACTTCAGGTGACACAGAGAAGAATATTCATAAGCTTCATGTTTTGAATACTTGTCTG
AAACTTGATGAAAGTACTTACAAATGTATACATATACCGTTGCCACAGCTGCCACTGACAGCCT
CACATCCAAACGAGAAGCTTGCAGAGGTGCTCAGCAGGCTTTTGGAAGGGGATGGATGCTTCTC
GAGAAATGTGCAGTTGCCACATAATTATCACATTGATTTTGAAATCAGAATGGATACTAACAGG
ACCCAAGTATTTTCATTTTCTGAGGGAGATGCAAGTTCTGCCACAAACATGCAGAGAGTGGCCG
TGCTGTGTGTTCCTAAGTCTGCTTACTGTTTAAATTCAAACCACCTCAGAGGATTGATGGCCAT
GAAAATTCGACATTTGAATGTAATGGGCTTCCATGTCATCTTGATCCATAACTGGGAGCTGAAG
AAACTAAAGATGGAGGATGCGGTCACATTTGTGAGGAAGAAGATCTATTCAGATGAAGCACTTG
CCACTACTGACGAAAGCGTGTAAAGCTCGTATTAAATCAGACACTTGTCCGAACATGCACAGTT
GTGAAATGACTTTAATAAAGTCTGTGATTCAGTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

NM_001398523 ⟹ NP_001385452

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	72,662,031 - 72,681,986 (+)	NCBI
mRatBN7.2	9	65,168,219 - 65,188,174 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001009673	(Get FASTA)	NCBI Sequence Viewer
	NP_001385452	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH88416	(Get FASTA)	NCBI Sequence Viewer
	EDL98889	(Get FASTA)	NCBI Sequence Viewer
	EDL98890	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000112158
GenBank Protein	Q5M7V7	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001009673 ⟸ NM_001009673
- Peptide Label:	isoform 2
- UniProtKB:	Q5M7V7 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MNNRAHTFLWGIRQFRTSIPRSRALRTYSLVFCKPEVIHSKRNPRNHLLNGFDEGLQPSVRYLF QDIFISKSVAGCTQTRGIIHAAGFKLDRILCPRRLSFDAKHSFVSDGTSDHDLMKTNFHHTSTE DVLTKKMRPTPVNYKKLAQECNSLSDVLDTFSKAPTFPGSNYFLAMWIIAKRISEDKRRFEKQL MFSHPAFNQLCEQMMREAKIMRYDHLLFSLNAIVKLGVPQNSLMVQTLLRTIQERISECDERCL SILSTALVTMEPCMNVNALRAGLRILVDQQVWNINDIFTLQTVMRCIGKDMKALKELGRFSVLN SRHMFEVLAAMDHRSVVLLNECSKIVIDNIHGCPFKVLISILQSCRDLRYQNEDLFKSIADYVA TTFDIWKLKHVIFFLLSFETLGFRPPGLMDKLLEKVVQEPGSLTVKNIVSVLHVYSSLNHVHNV QNREFLEALASALTGCLHQISSESLLNAVHSFCMMNYFPLAPINQLIKENIIHELLTSGDTEKN IHKLHVLNTCLKLDESTYKCIHIPLPQLPLTASHPNEKLAEVLSRLLEGDGCFSRNVQLPHNYH IDFEIRMDTNRTQVFSFSEGDASSATNMQRVAVLCVPKSAYCLNSNHLRGLMAMKIRHLNVMGF HVILIHNWELKKLKMEDAVTFVRKKIYSDEALATTDESV hide sequence

Ensembl Acc Id:

ENSRNOP00000017281 ⟸ ENSRNOT00000002872

RefSeq Acc Id:	NP_001385452 ⟸ NM_001398523
- Peptide Label:	isoform 1
- UniProtKB:	A0A0H2UHK3 (UniProtKB/TrEMBL), A6IPH0 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000112158 ⟸ ENSRNOT00000159270

Ensembl Acc Id:

ENSRNOP00000105398 ⟸ ENSRNOT00000161021

Protein Domains

RAP

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5M7V7-F1-model_v2	AlphaFold	Q5M7V7	1-679	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13696715

Promoter ID:

EPDNEW_R7239

Type:

multiple initiation site

Name:

Fastkd2_1

Description:

FAST kinase domains 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	9	70,450,474 - 70,450,534	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1307883	AgrOrtholog
BioCyc Gene	G2FUF-27337	BioCyc
Ensembl Genes	ENSRNOG00000023923	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000159270	ENTREZGENE
IMAGE_CLONE	IMAGE:7112913	IMAGE-MGC_LOAD
InterPro	FAST_kinase	UniProtKB/Swiss-Prot
	FAST_Leu-rich	UniProtKB/Swiss-Prot
	RAP	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:94943	IMAGE-MGC_LOAD
NCBI Gene	301463	ENTREZGENE
PANTHER	FAST KINASE DOMAIN-CONTAINING PROTEIN 2, MITOCHONDRIAL	UniProtKB/Swiss-Prot
	FAST LEU-RICH DOMAIN-CONTAINING	UniProtKB/Swiss-Prot
Pfam	FAST_1	UniProtKB/Swiss-Prot
	RAP	UniProtKB/Swiss-Prot
PhenoGen	Fastkd2	PhenoGen
PROSITE	RAP	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000023923	RatGTEx
SMART	RAP	UniProtKB/Swiss-Prot
UniProt	A0A0H2UHK3	ENTREZGENE, UniProtKB/TrEMBL
	A6IPH0	ENTREZGENE, UniProtKB/TrEMBL
	FAKD2_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-03-07	Fastkd2	FAST kinase domains 2	RGD1307883	similar to RIKEN cDNA 2810421I24	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	RGD1307883	similar to RIKEN cDNA 2810421I24	RGD1307883_predicted	similar to RIKEN cDNA 2810421I24 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-20	RGD1307883_predicted	similar to RIKEN cDNA 2810421I24 (predicted)	LOC301463_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC301463_predicted	similar to RIKEN cDNA 2810421I24 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM