Predicted to be involved in elastic fiber assembly; regulation of collagen metabolic process; and response to UV. Predicted to be located in several cellular components, including collagen-containing extracellular matrix; elastic fiber; and microfibril. Orthologous to human MFAP4 (microfibril associated protein 4); INTERACTS WITH 1-naphthyl isothiocyanate; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.
[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of MFAP4 mRNA, [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of MFAP4 mRNA
[Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of MFAP4 mRNA
[Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of MFAP4 mRNA
[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of MFAP4 mRNA
[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of MFAP4 mRNA
[Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of MFAP4 mRNA
[Clofibrate co-treated with Acetaminophen] affects the expression of MFAP4 mRNA, PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of MFAP4 mRNA]
[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of MFAP4 mRNA, [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of MFAP4 mRNA
[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of MFAP4 mRNA, [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of MFAP4 mRNA
[Clofibrate co-treated with Acetaminophen] affects the expression of MFAP4 mRNA, PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of MFAP4 mRNA]
[Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of MFAP4 mRNA
MKTLSGLPLLLLLLLSTPPPCAPQASGIRGDALEKSCLQQPLDCDDIYMQGYQEDGVYLIYPYG PSVPVPVFCDMTTEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQNLHLLTLKQK YELRVDLEDFENNTAYAKYVDFSISPNAVSAEEDGYTLYVAGFEDGGAGDSLSYHSGQKFSTFD RDQDLFVQNCAALSSGAFWFRSCHFANLNGFYLGGSHLSYANGINWAQWKGFYYSLKRTEMKIR RA