Efna4 (ephrin A4) - Rat Genome Database

Name: Efna4
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Advanced Search (OLGA)

Gene: Efna4 (ephrin A4) Rattus norvegicus

Analyze

Symbol:

Efna4

Name:

ephrin A4

RGD ID:

1307808

Description:

Predicted to enable ephrin receptor binding activity. Predicted to be involved in axon guidance and ephrin receptor signaling pathway. Predicted to be located in side of membrane. Predicted to be active in plasma membrane. Orthologous to human EFNA4 (ephrin A4); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; alpha-Zearalanol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

ephrin-A4; LOC310643

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	EFNA4 (ephrin A4)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):	Efna4 (ephrin A4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Efna4 (ephrin A4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	EFNA4 (ephrin A4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	EFNA4 (ephrin A4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Efna4 (ephrin A4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	EFNA4 (ephrin A4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	EFNA4 (ephrin A4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Efna4 (ephrin A4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	GTPBP3 (GTP binding protein 3, mitochondrial)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	EFNA4 (ephrin A4)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Efna4 (ephrin A4)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	si:dkey-246i14.3	Alliance	DIOPT (InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	efn-4	Alliance	DIOPT (Ensembl Compara\|InParanoid\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Ephrin	Alliance	DIOPT (Ensembl Compara\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	efna4	Alliance	DIOPT (PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	177,046,463 - 177,050,713 (-)	NCBI		GRCr8
mRatBN7.2	2	174,748,729 - 174,752,979 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	174,748,724 - 174,752,979 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	181,893,743 - 181,897,991 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	179,916,118 - 179,920,367 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	174,516,662 - 174,520,904 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	188,655,920 - 188,660,179 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	188,655,912 - 188,660,179 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	208,065,969 - 208,070,220 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	181,521,270 - 181,525,521 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	181,471,898 - 181,475,566 (-)	NCBI
Celera	2	168,690,302 - 168,694,545 (-)	NCBI		Celera
Cytogenetic Map	2	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Charcot-Marie-Tooth disease type 2 (ISO)

gastrointestinal stromal tumor (ISO)

immunodeficiency 42 (ISO)

MHC class II deficiency (ISO)

parathyroid carcinoma (ISO)

severe congenital neutropenia 3 (ISO)

severe congenital neutropenia 5 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

4-hydroxynon-2-enal (ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

acrylamide (ISO)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

arsenite(3-) (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (EXP)

Butylparaben (ISO)

chlordecone (ISO)

chlorpyrifos (ISO)

cisplatin (ISO)

cobalt dichloride (EXP)

cocaine (EXP)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

Dibutyl phosphate (ISO)

doxorubicin (ISO)

endosulfan (EXP)

formaldehyde (ISO)

gentamycin (EXP)

hydrogen chloride (ISO)

hydrogen peroxide (ISO)

lead(0) (ISO)

leflunomide (ISO)

methimazole (EXP)

methylparaben (ISO)

ozone (ISO)

paracetamol (EXP)

perfluorohexanesulfonic acid (ISO)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP,ISO)

phorbol 13-acetate 12-myristate (ISO)

potassium chromate (ISO)

potassium dichromate (ISO)

quercetin (ISO)

sarin (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (ISO)

sunitinib (ISO)

tert-butyl hydroperoxide (ISO)

thiram (ISO)

titanium dioxide (ISO)

triphenyl phosphate (ISO)

triptonide (ISO)

valproic acid (ISO)

vincristine (ISO)

zinc atom (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

axon guidance (IBA)

ephrin receptor signaling pathway (IBA)

Cellular Component

plasma membrane (IBA)

side of membrane (IEA)

Molecular Function

ephrin receptor binding (IBA,ISO)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:15777695	PMID:22193443	PMID:32745487

Genomics

Comparative Map Data

Efna4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	177,046,463 - 177,050,713 (-)	NCBI		GRCr8
mRatBN7.2	2	174,748,729 - 174,752,979 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	174,748,724 - 174,752,979 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	181,893,743 - 181,897,991 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	179,916,118 - 179,920,367 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	174,516,662 - 174,520,904 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	188,655,920 - 188,660,179 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	188,655,912 - 188,660,179 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	208,065,969 - 208,070,220 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	181,521,270 - 181,525,521 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	181,471,898 - 181,475,566 (-)	NCBI
Celera	2	168,690,302 - 168,694,545 (-)	NCBI		Celera
Cytogenetic Map	2	q34	NCBI

EFNA4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	155,063,740 - 155,069,553 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	155,063,737 - 155,069,553 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	155,036,216 - 155,042,029 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	153,302,837 - 153,308,653 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	1	128,107,735 - 128,113,551 (+)	NCBI		Celera
Cytogenetic Map	1	q21.3	NCBI
HuRef	1	126,398,217 - 126,404,030 (+)	NCBI		HuRef
CHM1_1	1	156,432,037 - 156,437,827 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	154,203,127 - 154,208,932 (+)	NCBI		T2T-CHM13v2.0

Efna4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	89,240,700 - 89,245,335 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	89,240,697 - 89,245,335 (-)	Ensembl		GRCm39 Ensembl
GRCm38	3	89,333,393 - 89,338,028 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	89,333,390 - 89,338,028 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	3	89,137,315 - 89,141,950 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	3	89,420,102 - 89,423,882 (-)	NCBI		MGSCv36	mm8
Celera	3	89,368,432 - 89,373,070 (-)	NCBI		Celera
Cytogenetic Map	3	F1	NCBI
cM Map	3	39.07	NCBI

Efna4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955545	1,556,584 - 1,561,354 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955545	1,557,107 - 1,561,234 (+)	NCBI	ChiLan1.0	ChiLan1.0

EFNA4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	94,771,410 - 94,777,128 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	94,503,455 - 94,509,279 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	130,410,991 - 130,417,593 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	134,021,400 - 134,027,212 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	134,021,405 - 134,027,212 (+)	Ensembl	panpan1.1		panPan2

EFNA4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	7	42,427,539 - 42,431,788 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	7	42,428,113 - 42,443,429 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	7	41,917,714 - 41,921,969 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	7	42,296,528 - 42,300,780 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	7	42,297,100 - 42,300,693 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	7	42,076,255 - 42,080,508 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	7	42,130,128 - 42,134,383 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	7	42,413,643 - 42,417,904 (-)	NCBI		UU_Cfam_GSD_1.0

Efna4
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	25,568,038 - 25,573,911 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936580	4,599,136 - 4,604,257 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936580	4,598,748 - 4,604,293 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

EFNA4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	94,730,792 - 94,735,559 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	4	94,730,790 - 94,735,578 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	103,512,402 - 103,517,185 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

EFNA4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	8,758,126 - 8,767,750 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	8,761,883 - 8,766,830 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	8,095,819 - 8,102,087 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Efna4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624885	2,436,535 - 2,440,200 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624885	2,436,629 - 2,440,196 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Efna4
18 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	404
Count of miRNA genes:	220
Interacting mature miRNAs:	269
Transcripts:	ENSRNOT00000027935
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578648	Bss11	Bone structure and strength QTL 11	4.7		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	2	114837527	211674221	Rat
1358356	Srcrt1	Stress Responsive Cort QTL1	3.66		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	2	161699179	222436696	Rat
1331734	Bp204	Blood pressure QTL 204	3.61192		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	168358098	223265385	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118463	226797303	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	81754530	227146641	Rat
10755499	Bp389	Blood pressure QTL 389	2.61		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	18960362	228801039	Rat
1298076	Bp166	Blood pressure QTL 166		0.0009	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	136445150	202447032	Rat
61457	Niddm8	Non-insulin dependent diabetes mellitus QTL 8	4.1	0.01	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	2	174543008	175950118	Rat
152025245	Scl81	Serum cholesterol level QTL 81	3.49		blood cholesterol amount (VT:0000180)		2	122609194	206936711	Rat
70162	Bp63	Blood pressure QTL 63	5.64		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	2	169745596	214745596	Rat
1554319	Bmd2	Bone mineral density QTL 2	13.4	0.0001	lumbar vertebra area (VT:0010570)	lumbar vertebra cross-sectional area (CMO:0001689)	2	114837675	212549332	Rat
12879836	Kidm61	Kidney mass QTL 61		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	152413072	185122374	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	78665619	219826953	Rat
10043136	Iddm54	Insulin dependent diabetes mellitus QTL 54	3.4	0.0001	blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	2	143657411	190602963	Rat
12879837	Am2	Aortic mass QTL 2		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	2	152413072	185122374	Rat
12879838	Cm86	Cardiac mass QTL 86		0.002	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	152413072	185122374	Rat
1302793	Bw16	Body weight QTL 16	5	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	2	157142209	202446871	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	43154682	202446871	Rat
12879839	Cm85	Cardiac mass QTL 85		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	2	152413072	185122374	Rat
61469	Bp16	Blood pressure QTL 16	5.64		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	2	169745596	214745596	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	2	135552573	202446871	Rat
1549833	Bp257	Blood pressure QTL 257		0.003	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	168354880	185122374	Rat
1358900	Bw48	Body weight QTL 48	4.88		body mass (VT:0001259)	body weight (CMO:0000012)	2	157142078	211086598	Rat
12879845	Cm89	Cardiac mass QTL 89		0.008	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	152413072	175950118	Rat
61473	Bp19	Blood pressure QTL 19	6.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	172710921	175950118	Rat
1359030	Bp277	Blood pressure QTL 277			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	114837527	185876470	Rat
12879846	Cm90	Cardiac mass QTL 90		0.011	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	2	152413072	175950118	Rat
12879847	Am4	Aortic mass QTL 4		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	2	152413072	175950118	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	56043031	202447032	Rat
12879840	Bw179	Body weight QTL 179		0.005	body mass (VT:0001259)	body weight (CMO:0000012)	2	152413072	185122374	Rat
1581502	Esta3	Estrogen-induced thymic atrophy QTL 3			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	2	136916935	189599348	Rat
1359032	Hrtrt18	Heart rate QTL 18			heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	2	157142078	192625452	Rat
2301966	Bp322	Blood pressure QTL 322	3.58		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	150540301	202447032	Rat
1298080	Bp163	Blood pressure QTL 163		0.02	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118275	202447032	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	81689826	221035911	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
1359022	Ppulsi1	Prepulse inhibition QTL 1	3.63		prepulse inhibition trait (VT:0003088)	acoustic startle response measurement (CMO:0001519)	2	136916935	213594495	Rat
1641891	Alcrsp17	Alcohol response QTL 17			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	249053267	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	78665619	249053267	Rat
61374	Edpm2	Estrogen-dependent pituitary mass QTL 2	4.42	0.86	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	76539322	202447032	Rat
8662843	Vetf9	Vascular elastic tissue fragility QTL 9	2.05		thoracic aorta molecular composition trait (VT:0010568)	aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003)	2	157142078	226277316	Rat
631501	Bp101	Blood pressure QTL 101	2.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	150341684	202446871	Rat
2301415	Cm67	Cardiac mass QTL 67		0.003	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	2	152413072	175950118	Rat
2307174	Activ3	Activity QTL 3	4.83	0.000058	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	2	168594495	213594495	Rat
1331794	Bp202	Blood pressure QTL 202	3.66819		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	141194931	223265385	Rat
71113	Cari2	Carrageenan-induced inflammation QTL 2	2.7	0.009	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	2	141596551	202447032	Rat
1331805	Cm29	Cardiac mass QTL 29	3.50746		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	2	141194931	223265385	Rat
11565180	Kidm56	Kidney mass QTL 56		0.003	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	152413072	175950118	Rat
634308	Sach6	Saccharin preference QTL 6	4.9		taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	2	112456140	212696837	Rat
1598805	Memor8	Memory QTL 8	3		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	2	150341585	189039377	Rat
11565181	Bw176	Body weight QTL 176		0.002	body mass (VT:0001259)	body weight (CMO:0000012)	2	152413072	175950118	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
724568	Uae13	Urinary albumin excretion QTL 13	4.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	2	143157029	210020885	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
1300165	Rf9	Renal function QTL 9	3.28		kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	2	133914684	202447032	Rat
61401	Niddm2	Non-insulin dependent diabetes mellitus QTL 2	4.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	144599348	189599348	Rat
631507	Bp105	Blood pressure QTL 105		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	112456140	212696837	Rat
1641925	Alcrsp2	Alcohol response QTL 2			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	221167075	Rat
1354609	Niddm62	Non-insulin dependent diabetes mellitus QTL 62	4.72	0.000006	insulin secretion trait (VT:0003564)	plasma insulin level (CMO:0000342)	2	150540301	202447032	Rat
1598833	Bp295	Blood pressure QTL 295	3.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	147798556	192798556	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	81754530	222436696	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	46123260	202447032	Rat
631522	Bp74	Blood pressure QTL 74		0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	172710921	184114403	Rat
7488927	Bp365	Blood pressure QTL 365		0.008	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	162765032	207765032	Rat
1598838	Bp290	Blood pressure QTL 290	1.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	166539266	211539266	Rat
7488925	Bp364	Blood pressure QTL 364		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	160564068	205564068	Rat
2293843	Kiddil6	Kidney dilation QTL 6	3.1		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	42804607	182042367	Rat
2306901	Bp337	Blood pressure QTL 337		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	164073756	227146641	Rat
1354605	Rf48	Renal function QTL 48	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	2	74786664	206665859	Rat
6903312	Bw112	Body weight QTL 112	3.2	0.0013	body mass (VT:0001259)	body weight (CMO:0000012)	2	143657569	184114274	Rat
7488904	Bp363	Blood pressure QTL 363		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	172982062	175950118	Rat
1354601	Slep1	Serum leptin concentration QTL 1	5.39		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	2	43171017	184114403	Rat

Markers in Region

RH139781

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	174,754,659 - 174,754,849 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	188,661,860 - 188,662,049	NCBI	Rnor6.0
Rnor_5.0	2	208,071,901 - 208,072,090	UniSTS	Rnor5.0
RGSC_v3.4	2	181,527,202 - 181,527,391	UniSTS	RGSC3.4
Celera	2	168,696,226 - 168,696,415	UniSTS
RH 3.4 Map	2	1156.4	UniSTS
Cytogenetic Map	2	q34	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001107692	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017590891	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC098750	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473976	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000027935 ⟹ ENSRNOP00000027935

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	174,748,729 - 174,752,979 (-)	Ensembl
Rnor_6.0 Ensembl	2	188,655,928 - 188,660,179 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000086916 ⟹ ENSRNOP00000074145

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	174,748,724 - 174,752,572 (-)	Ensembl
Rnor_6.0 Ensembl	2	188,655,912 - 188,657,940 (-)	Ensembl

RefSeq Acc Id:

NM_001107692 ⟹ NP_001101162

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	177,046,463 - 177,050,713 (-)	NCBI
mRatBN7.2	2	174,748,729 - 174,752,979 (-)	NCBI
Rnor_6.0	2	188,655,928 - 188,660,179 (-)	NCBI
Rnor_5.0	2	208,065,969 - 208,070,220 (-)	NCBI
RGSC_v3.4	2	181,521,270 - 181,525,521 (-)	RGD
Celera	2	168,690,302 - 168,694,545 (-)	RGD

Sequence:

show sequence

CGCCGGGACAGAGAAGTGGGCCGGGACCAGCCGGGCCAGACCAGACTGGACCCCAGGGGCGATG
CGGCTGTTGCCCCTGCTGCGGACTGTGCTCTGGGCCGCGCTGCTCGGCTCGCGCCTGCGGGGGT
GCTCCAGCCTCCGCCACTCTATCTACTGGAACTCCACTAACCCCAGGTTGCTTCGAGGAGATGC
CGTGGTGGAGCTGGGCCTCAACGATTACCTAGACATCTTCTGCCCACATTATGAGAGCCCAGGG
CCCCCAGAGGGCCCGGAAACGTTTGCATTATACATAGTGGACTGGTCAGGCTACGAGGCCTGCA
AGGCAGAGGGGGCAAATGCCTTCCAGCGCTGGAATTGCACGCTACCTTTTGCGCCTTTTGTCCC
TGTTCGATTCTCCGAAAAGATTCAGCGCTTCACACCGTTCCCGCTGGGCTTCGAGTTCTTGCCT
GGAGAGACTTACTACTACATCTCGGTGCCAACTCCGGAGAGTCCTGGCCAGTGCCTGAGACTCC
AGGTGTCTGTCTGCTGCAAGGAGGACAGATCCGAGTCAGCTCATCCTGTCGGGAGCCCTGGAGA
AAGTGGCACATCTGGGTGGCGGGGAGGACACGCCCCCAGCCCTCTGTCTCTCCTGCTGTTGCTG
CTGCTCCCAATACTCCGTCTTCTGCGAGTTCTGTGAGCCAAGTACACCTTCCCAGTCACCCCAA
GGAGCCAGAGCCCTTCCCAGGATCCTCTGTTGAAGGGGTTCCTGCCACCGTACAGGCGATGCCA
AGCCAGGCAGACATGATGAAGCTTTGATGTGCAAAGTCGGAGGATCTGAGGTGACCCTTGTAGG
TGACTGCTCCCTCACTACAGGCTGAAGAGGAACTGCAAGGAAGCTGCAGACAGTCGGGCACCCA
GAAGCATAGCTGCTTTGATGGTCTTGTCTCCTCCCCCTGGAAGACTGGGATTTCAGGGGATCAA
ATCCTTGAGACACTGGGGGCCAAAGCCAAAGACCTGGGAACCGGTGGGTTCCTGGCCAAGAGCA
GAGAAGCCACGGTCTCTGTGGCCTCCAGGCCTCTTCCCAGGAGCAATTGTTGCCCCTTCCAGGG
AGCCACTCTCTTGTCTTCTGTGAAGACGGACTTGCCATGAGGTTGAATTTCATGCTGGTTTGTA
TTTTTTATAAAGTGTTTGGACCAAACCTTCAATAAATCACCCGTTCT

hide sequence

Protein Sequences


Protein RefSeqs	NP_001101162	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM00640	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000027935.2
	ENSRNOP00000074145.2

RefSeq Acc Id:	NP_001101162 ⟸ NM_001107692
- Peptide Label:	precursor
- UniProtKB:	D3ZEN1 (UniProtKB/TrEMBL), A6J6E9 (UniProtKB/TrEMBL)
- Sequence:	show sequence MRLLPLLRTVLWAALLGSRLRGCSSLRHSIYWNSTNPRLLRGDAVVELGLNDYLDIFCPHYESP GPPEGPETFALYIVDWSGYEACKAEGANAFQRWNCTLPFAPFVPVRFSEKIQRFTPFPLGFEFL PGETYYYISVPTPESPGQCLRLQVSVCCKEDRSESAHPVGSPGESGTSGWRGGHAPSPLSLLLL LLLPILRLLRVL hide sequence

Ensembl Acc Id:

ENSRNOP00000027935 ⟸ ENSRNOT00000027935

Ensembl Acc Id:

ENSRNOP00000074145 ⟸ ENSRNOT00000086916

Protein Domains

Ephrin RBD

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZEN1-F1-model_v2	AlphaFold	D3ZEN1	1-204	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13691470

Promoter ID:

EPDNEW_R1995

Type:

multiple initiation site

Name:

Efna4_1

Description:

ephrin A4

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	2	188,660,189 - 188,660,249	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1307808	AgrOrtholog
BioCyc Gene	G2FUF-52420	BioCyc
Ensembl Genes	ENSRNOG00000020588	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000027935.4	UniProtKB/TrEMBL
	ENSRNOT00000086916.2	UniProtKB/TrEMBL
Gene3D-CATH	2.60.40.420	UniProtKB/TrEMBL
InterPro	Cupredoxin	UniProtKB/TrEMBL
	Ephrin	UniProtKB/TrEMBL
	Ephrin	UniProtKB/TrEMBL
	Ephrin-A_Ecto	UniProtKB/TrEMBL
	Ephrin_CS	UniProtKB/TrEMBL
KEGG Report	rno:310643	UniProtKB/TrEMBL
NCBI Gene	310643	ENTREZGENE
PANTHER	Ephrin	UniProtKB/TrEMBL
	EPHRIN-A4	UniProtKB/TrEMBL
Pfam	Ephrin	UniProtKB/TrEMBL
PhenoGen	Efna4	PhenoGen
PRINTS	EPHRIN	UniProtKB/TrEMBL
PROSITE	EPHRIN	UniProtKB/TrEMBL
	EPHRIN_RBD_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000020588	RatGTEx
Superfamily-SCOP	Cupredoxin	UniProtKB/TrEMBL
UniProt	A0A0G2K7C3_RAT	UniProtKB/TrEMBL
	A6J6E9	ENTREZGENE, UniProtKB/TrEMBL
	D3ZEN1	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-04-30	Efna4	ephrin A4	Efna4_predicted	ephrin A4 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Efna4_predicted	ephrin A4 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar