Ifitm1 (interferon induced transmembrane protein 1)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Ifitm1 (interferon induced transmembrane protein 1) Rattus norvegicus

Analyze

Symbol:

Ifitm1

Name:

interferon induced transmembrane protein 1

RGD ID:

1307601

Description:

Involved in heart development. Predicted to be located in lysosomal membrane. Predicted to be part of protein-containing complex. Predicted to be active in plasma membrane. Human ortholog(s) of this gene implicated in COVID-19; adenosquamous gallbladder carcinoma; and gallbladder adenocarcinoma. Orthologous to human IFITM1 (interferon induced transmembrane protein 1); IFITM2 (interferon induced transmembrane protein 2); and IFITM3 (interferon induced transmembrane protein 3); INTERACTS WITH 1-naphthyl isothiocyanate; 17alpha-ethynylestradiol; 17beta-estradiol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

interferon-induced transmembrane protein 1; LOC293618

RGD Orthologs

Human

Mouse

Bonobo

Dog

Pig

Green Monkey

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	1	196,067,163 - 196,069,169 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	196,067,963 - 196,069,169 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	204,413,074 - 204,414,979 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	1	211,539,932 - 211,541,839 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	1	204,213,789 - 204,215,694 (+)	NCBI	Rnor_WKY
Rnor_6.0	1	213,765,825 - 213,767,841 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	213,766,758 - 213,767,815 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	220,686,994 - 220,689,004 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	201,154,494 - 201,155,509 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	201,304,375 - 201,305,502 (+)	NCBI
Celera	1	193,702,100 - 193,704,005 (+)	NCBI		Celera
Cytogenetic Map	1	q41	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

adenosquamous gallbladder carcinoma (ISO)

developmental and epileptic encephalopathy (ISO)

early infantile epileptic encephalopathy (ISO)

Experimental Liver Cirrhosis (ISO)

gallbladder adenocarcinoma (ISO)

genetic disease (ISO)

immunodeficiency 39 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

1,2-dimethylhydrazine (ISO)

1,4-dichlorobenzene (ISO)

1-naphthyl isothiocyanate (EXP)

1-nitropyrene (ISO)

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (EXP,ISO)

17beta-estradiol 3-benzoate (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-diaminodiphenylmethane (EXP)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

5-aza-2'-deoxycytidine (ISO)

5-fluorouracil (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

acetic acid (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

amphetamine (EXP)

antimycin A (ISO)

arsane (ISO)

arsenic atom (ISO)

atrazine (ISO)

belinostat (ISO)

benzene (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

beta-naphthoflavone (ISO)

bexarotene (EXP)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

bleomycin A2 (ISO)

bortezomib (ISO)

bromochloroacetic acid (ISO)

buspirone (EXP)

butanal (ISO)

calcitriol (ISO)

cannabidiol (ISO)

carbon nanotube (ISO)

choline (ISO)

chromium(6+) (ISO)

cisplatin (EXP,ISO)

cobalt dichloride (EXP)

crocidolite asbestos (ISO)

cyclosporin A (ISO)

DDT (ISO)

dexamethasone (ISO)

diazinon (EXP)

dibutyl phthalate (EXP)

dieldrin (EXP)

dorsomorphin (ISO)

doxorubicin (ISO)

elemental selenium (ISO)

endosulfan (EXP)

entinostat (ISO)

etoposide (ISO)

fenthion (ISO)

flutamide (EXP)

folic acid (ISO)

fulvestrant (ISO)

genistein (ISO)

gentamycin (EXP)

glafenine (EXP)

hydrogen peroxide (ISO)

hydroquinone (ISO)

indometacin (ISO)

irinotecan (EXP,ISO)

isotretinoin (ISO)

L-methionine (ISO)

lipopolysaccharide (ISO)

methapyrilene (EXP)

methidathion (ISO)

methotrexate (ISO)

methyl methanesulfonate (ISO)

methylmercury chloride (ISO)

mitoxantrone (ISO)

N-methyl-4-phenylpyridinium (EXP,ISO)

N-methyl-N'-nitro-N-nitrosoguanidine (ISO)

N-nitrosodiethylamine (ISO)

N-nitrosodimethylamine (EXP)

nefazodone (EXP)

nickel atom (ISO)

nickel dichloride (EXP)

nickel sulfate (ISO)

nimesulide (EXP)

nitrofen (EXP)

panobinostat (ISO)

paracetamol (ISO)

paraquat (EXP)

phenobarbital (ISO)

phenylmercury acetate (ISO)

progesterone (EXP)

propanal (ISO)

resveratrol (EXP,ISO)

rotenone (EXP,ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

selenium atom (ISO)

serpentine asbestos (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

Soman (EXP)

sulindac sulfide (ISO)

sunitinib (ISO)

tamoxifen (EXP,ISO)

temozolomide (ISO)

tert-butyl hydroperoxide (ISO)

testosterone (EXP,ISO)

tetrachloromethane (ISO)

thioacetamide (EXP)

thiophenes (ISO)

titanium dioxide (ISO)

tofacitinib (ISO)

trichostatin A (ISO)

triclosan (ISO)

triptonide (ISO)

troglitazone (ISO)

valproic acid (EXP,ISO)

vancomycin (ISO)

vitamin E (ISO)

zidovudine (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

anterior/posterior pattern specification (ISO)

defense response to virus (IBA,ISO)

heart development (IEP)

negative regulation of cell migration (ISO)

negative regulation of cell population proliferation (ISO)

negative regulation of viral entry into host cell (IBA,ISO)

negative regulation of viral genome replication (IBA,ISO)

positive regulation of osteoblast differentiation (ISO)

response to interferon-alpha (IBA,ISO)

response to interferon-beta (IBA,ISO)

response to type II interferon (IBA,ISO)

response to virus (ISO)

somitogenesis (ISO)

type I interferon-mediated signaling pathway (IBA)

Cellular Component

lysosomal membrane (ISO)

plasma membrane (IBA,ISO)

protein-containing complex (ISO)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Interferons induce the expression of IFITM1 and IFITM3 and suppress the proliferation of rat neonatal cardiomyocytes.	Lau SL, etal., J Cell Biochem. 2012 Mar;113(3):841-7. doi: 10.1002/jcb.23412.
4.	DDR2 and IFITM1 Are Prognostic Markers in Gallbladder Squamous Cell/Adenosquamous Carcinomas and Adenocarcinomas.	Li D, etal., Pathol Oncol Res. 2019 Jan;25(1):157-167. doi: 10.1007/s12253-017-0314-3. Epub 2017 Oct 17.
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	GOA pipeline	RGD automated data pipeline
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	Comprehensive gene review and curation	RGD comprehensive gene curation

Additional References at PubMed

PMID:15857914	PMID:20064371	PMID:21253575	PMID:23166625	PMID:25738301	PMID:29300519

Genomics

Comparative Map Data

Ifitm1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	1	196,067,163 - 196,069,169 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	196,067,963 - 196,069,169 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	204,413,074 - 204,414,979 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	1	211,539,932 - 211,541,839 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	1	204,213,789 - 204,215,694 (+)	NCBI	Rnor_WKY
Rnor_6.0	1	213,765,825 - 213,767,841 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	213,766,758 - 213,767,815 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	220,686,994 - 220,689,004 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	201,154,494 - 201,155,509 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	201,304,375 - 201,305,502 (+)	NCBI
Celera	1	193,702,100 - 193,704,005 (+)	NCBI		Celera
Cytogenetic Map	1	q41	NCBI

IFITM1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	314,040 - 315,272 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	11	310,041 - 315,272 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	11	314,040 - 315,272 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	303,991 - 305,272 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	11	303,852 - 305,272	NCBI
Celera	11	244,174 - 245,455 (-)	NCBI		Celera
Cytogenetic Map	11	p15.5	NCBI
HuRef	11	133,537 - 134,818 (+)	NCBI		HuRef
CHM1_1	11	312,954 - 314,235 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	11	355,743 - 359,591 (-)	NCBI		T2T-CHM13v2.0

Ifitm1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	140,547,342 - 140,549,740 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	140,547,134 - 140,549,738 (+)	Ensembl		GRCm39 Ensembl
GRCm38	7	140,967,429 - 140,969,827 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	140,967,221 - 140,969,825 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	148,153,328 - 148,155,726 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	140,807,388 - 140,821,138 (+)	NCBI		MGSCv36	mm8
Celera	7	140,759,855 - 140,762,253 (+)	NCBI		Celera
Cytogenetic Map	7	F5	NCBI

IFITM1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	11	1,838,545 - 1,839,822 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	11	309,930 - 311,177 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	11	353,236 - 354,986 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	11	353,236 - 354,986 (+)	Ensembl	panpan1.1		panPan2

LOC483397
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	18	25,494,018 - 25,495,114 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	18	25,143,529 - 25,144,612 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	18	26,078,256 - 26,079,310 (-)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	18	25,588,641 - 25,589,734 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	18	25,233,330 - 25,234,423 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	18	25,845,850 - 25,846,933 (-)	NCBI		UU_Cfam_GSD_1.0

LOC102161418
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	2	156,364 - 157,650 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	162,102,396 - 162,214,685 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

LOC103238018
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	1	128,309 - 129,543 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023667312	4,464 - 5,812 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants

Variants in Ifitm1
20 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	51
Count of miRNA genes:	47
Interacting mature miRNAs:	50
Transcripts:	ENSRNOT00000005645
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	49393289	199050459	Rat
1578780	Cm52	Cardiac mass QTL 52	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	1	81591954	219808434	Rat
1331749	Hrtrt11	Heart rate QTL 11	2.973		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	94494440	198211706	Rat
70209	Niddm23	Non-insulin dependent diabetes mellitus QTL 23	2.82		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	94494440	198324465	Rat
731168	Bp154	Blood pressure QTL 154	3.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	94642722	214537671	Rat
1354591	Cm36	Cardiac mass QTL 36	4.1		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	102813953	201278233	Rat
1354615	Cm32	Cardiac mass QTL 32	5.2		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	1	102813953	201278233	Rat
1354606	Bp246	Blood pressure QTL 246	3.6		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	102813953	218753816	Rat
7794788	Mcs32	Mammary carcinoma susceptibility QTL 32	2.61		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	1	115540693	238914717	Rat
7421630	Bp362	Blood pressure QTL 362		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	118608292	241799120	Rat
631205	Bp196	Blood pressure QTL 196	4	0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	118944897	199050459	Rat
631549	Bp89	Blood pressure QTL 89	5.7		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	123350581	201284552	Rat
1598853	Memor3	Memory QTL 3	4.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	1	143506580	212458660	Rat
61348	Bp30	Blood pressure QTL 30	2.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	144017057	197814409	Rat
70160	Bw18	Body weight QTL 18	5.7		body mass (VT:0001259)	body weight (CMO:0000012)	1	144267353	196383635	Rat
737828	Hcas3	Hepatocarcinoma susceptibility QTL 3	4.9		liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	1	144267353	222987745	Rat
2302378	Insul11	Insulin level QTL 11	3.25		blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	1	144267353	251128347	Rat
7771612	Cm80	Cardiac mass QTL 80	8.4		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	1	149448574	221264292	Rat
724531	Uae5	Urinary albumin excretion QTL 5	4		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	1	150700142	252085212	Rat
1578759	Uae30	Urinary albumin excretion QTL 30	3.3	0.003	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	150700247	252085048	Rat
1578778	Pur4	Proteinuria QTL 4	3.3	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	1	150700247	252085048	Rat
1354602	Bw35	Body weight QTL 35	12.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	201278233	Rat
1354620	Kidm19	Kidney mass QTL 19	4		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	151162512	201278233	Rat
1354634	Kidm12	Kidney mass QTL 12	3.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	1	151162512	201278233	Rat
1354636	Lmblg1	Limb length QTL 1	6.4		tibia length (VT:0004357)	tibia length (CMO:0000450)	1	151162512	201278233	Rat
1354610	Bw34	Body weight QTL 34	4.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
1354646	Kidm18	Kidney mass QTL 18	5.7		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	151162512	256448636	Rat
1354661	Bw33	Body weight QTL 33	5.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
1358886	Bp260	Blood pressure QTL 260	3.67		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	151162766	225824951	Rat
61343	Bp28	Blood pressure QTL 28			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	151646613	196646613	Rat
1549837	Hcar15	Hepatocarcinoma resistance QTL 15		0.05	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	153136852	260522016	Rat
2303622	Vencon6	Ventilatory control QTL 6		0.001	respiration trait (VT:0001943)	respiration rate (CMO:0000289)	1	154561505	199561505	Rat
4889428	Stresp24	Stress response QTL 24		0.05	heart pumping trait (VT:2000009)	absolute change in electrocardiographic low frequency R-R spectral component to high frequency R-R spectral component ratio (CMO:0002162)	1	155866514	200866514	Rat
1354618	Kidm15	Kidney mass QTL 15	5		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	1	156677124	201278233	Rat
2312420	Pur17	Proteinuria QTL 17	7.1	0.0001	urine protein amount (VT:0005160)	urine total protein excretion rate (CMO:0000756)	1	156677124	218753816	Rat
1354580	Scort1	Serum corticosterone level QTL 1	3.4		blood corticosterone amount (VT:0005345)	blood corticosterone level (CMO:0001172)	1	156677124	256448636	Rat
61347	Bp197	Blood pressure QTL 197	4.2		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	1	158633083	203633083	Rat
2292222	Bp307	Blood pressure QTL 307	3.06	0.0014	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	164310393	213533942	Rat
2292220	Bp306	Blood pressure QTL 306	3.47	0.00087	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	164310393	243914901	Rat
619613	Bp77	Blood pressure QTL 77		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	164747424	209747424	Rat
619613	Bp77	Blood pressure QTL 77		0.01	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	164747424	209747424	Rat
1354653	Despr9	Despair related QTL 9		0.00019	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	167909849	212909849	Rat
619614	Bp78	Blood pressure QTL 78		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	169112897	197261052	Rat
619614	Bp78	Blood pressure QTL 78		0.001	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	169112897	197261052	Rat
61341	Bp26	Blood pressure QTL 26			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	169537671	214537671	Rat
724562	Rends1	Renal damage susceptibility QTL 1		0.05	kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	1	169537671	214537671	Rat
1358294	Bw37	Body weight QTL 37	5	0.000011	body mass (VT:0001259)	body weight (CMO:0000012)	1	171310381	216310381	Rat
2293689	Bss47	Bone structure and strength QTL 47	7.25	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	1	171629477	216629477	Rat
2293693	Bss22	Bone structure and strength QTL 22	33.52	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	1	171629477	216629477	Rat
2300161	Bmd43	Bone mineral density QTL 43	8.4	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	171629477	216629477	Rat
2300174	Bmd42	Bone mineral density QTL 42	8.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	bone mineral density (CMO:0001226)	1	171629477	216629477	Rat
2300187	Bmd41	Bone mineral density QTL 41	8.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	171629477	216629477	Rat
2293654	Bss30	Bone structure and strength QTL 30	32.65	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	1	171629477	216629477	Rat
2293673	Bss27	Bone structure and strength QTL 27	18.63	0.0001	femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	1	171629477	216629477	Rat
2293677	Bss41	Bone structure and strength QTL 41	9.38	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra cross-sectional area (CMO:0001689)	1	171629477	216629477	Rat
1549830	Bss1	Bone structure and strength QTL 1	4.8		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	1	172609619	217609619	Rat
631214	Bw61	Body weight QTL61	3.4	0.0001	intramuscular adipose amount (VT:0010044)	intramuscular fat area (CMO:0001162)	1	173108781	218108781	Rat
631670	Iddm10	Insulin dependent diabetes mellitus QTL 10	1.9		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	174133260	196383635	Rat
70163	Bw20	Body weight QTL 20	5.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	174133260	219133260	Rat
738032	Hcas5	Hepatocarcinoma susceptibility QTL 5	3.12		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	176426412	257976495	Rat
1600380	Niddm70	Non-insulin dependent diabetes mellitus QTL 70	3.1	0.0008	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	176550523	221550523	Rat
10059600	Bp378	Blood pressure QTL 378	3.08	0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	176869060	221869060	Rat
1354624	Cm35	Cardiac mass QTL35	5.7		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	177227632	256448636	Rat
1354652	Kidm20	Kidney mass QTL 20	4.3		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	177227632	256448636	Rat
1558658	Bw59	Body weight QTL 59	3.5	0.0003	body mass (VT:0001259)	body weight (CMO:0000012)	1	178784622	223784622	Rat
634321	Hc1	Hypercalciuria QTL 1	2.91		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	1	178810256	240830002	Rat
1578763	Kidm29	Kidney mass QTL 29	3.3	0.0001	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	1	179567751	260522016	Rat
1302787	Stl25	Serum triglyceride level QTL 25	2.7	0.0073	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	1	180359209	210702199	Rat
6903303	Scl34	Serum cholesterol QTL 34	2.5	0.0033	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	180359209	218108781	Rat
737977	Bp160	Blood pressure QTL 160		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	181133855	226133855	Rat
61378	Bp43	Blood pressure QTL 43	22.6		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	181746937	196383635	Rat
724559	Pancm1	Pancreatic morphology QTL 1	7.1		islet of Langerhans morphology trait (VT:0005215)	pancreatic islet damage composite score (CMO:0001156)	1	181759564	214537555	Rat
2293083	Iddm25	Insulin dependent diabetes mellitus QTL 25	4.18		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	181829673	224569684	Rat
634312	Bp143	Blood pressure QTL 143	3	0.0002	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	182623426	219932796	Rat
8655655	Arrd2	Age-related retinal degeneration QTL 2	7.79		retinal layer morphology trait (VT:0003727)	percentage of study population developing retinopathy during a period of time (CMO:0002453)	1	183970203	243914901	Rat
8655855	Arrd3	Age-related retinal degeneration QTL 3	3.07		lens clarity trait (VT:0001304)	cataract incidence/prevalence measurement (CMO:0001585)	1	183970203	243914901	Rat
631838	Niddm36	Non-insulin dependent diabetes mellitus QTL 36		0.01	insulin secretion trait (VT:0003564)	calculated pancreatic islet insulin release measurement (CMO:0001217)	1	184550676	229550676	Rat
1300145	Rf7	Renal function QTL 7	2.96		urine creatinine amount (VT:0010540)	urine creatinine level (CMO:0000125)	1	185145134	221264292	Rat
1359018	Hrtrt20	Heart rate QTL 20	3.08		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	185356336	202902618	Rat
2312564	Glom18	Glomerulus QTL 18	2.4	0.003	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	1	185356336	231689108	Rat
1582206	Kidm33	Kidney mass QTL 33	6.9		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	188377360	224054420	Rat
6480780	Insul18	Insulin level QTL 18	4.11		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	189607473	200611765	Rat
1358898	Bp255	Blood pressure QTL 255	3.6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	191019702	246062233	Rat
10059590	Kidm44	Kidney mass QTL 44	3.42	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	191033875	236033875	Rat
631260	Tcas2	Tongue tumor susceptibility QTL 2	4.93		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	1	192485903	199050587	Rat
1358191	Ept10	Estrogen-induced pituitary tumorigenesis QTL 10	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	192825253	243914732	Rat
8552891	Epfw5	Epididymal fat weight QTL 5	4.4		epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	1	193113876	238113876	Rat
634338	Hcar4	Hepatocarcinoma resistance QTL 4	4.6		liver integrity trait (VT:0010547)	liver tumorous lesion number to liver area ratio (CMO:0001210)	1	193422268	214537671	Rat
1600388	Niddm67	Non-insulin dependent diabetes mellitus QTL 67	5.84	0.000004	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	195804352	257091168	Rat
1600395	Niddm69	Non-insulin dependent diabetes mellitus QTL 69	4.14	0.0002	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	195804352	257091168	Rat
1600396	Niddm68	Non-insulin dependent diabetes mellitus QTL 68	4.97	0.0003	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	195804352	257091168	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High											1
Medium	3	37	50	41	19	41		1	8	35	33	11
Low		6	7				8	10	66		7		8
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001106314	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006230530	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473953	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221702	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000044	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000005645 ⟹ ENSRNOP00000042637

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	196,067,963 - 196,069,169 (+)	Ensembl
Rnor_6.0 Ensembl	1	213,766,758 - 213,767,815 (+)	Ensembl

RefSeq Acc Id:

NM_001106314 ⟹ NP_001099784

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	1	196,067,244 - 196,069,169 (+)	NCBI
Rnor_6.0	1	213,765,918 - 213,767,841 (+)	NCBI
Rnor_5.0	1	220,686,994 - 220,689,004 (+)	NCBI
RGSC_v3.4	1	201,154,494 - 201,155,509 (+)	RGD
Celera	1	193,702,100 - 193,704,005 (+)	RGD

Sequence:

show sequence

CAGGATCCCAGCGTACCTTCTAGAACCTCCCTGGGACCCTAGCACCAAATTGAGACAGCTGTTT
TTAGTCTTGTGGACGACTCCTAGATCCTGGGCCTTTCTGTCAGGAGACGGCCATTGTAGGGCTC
CTCGGACCAAGCCTGTATCCTCAAAAGCCAAGAGATGCCCAAGGAACAGCAAGAGGTGGTTATC
CTGGGAGGACCCCACACCTCAAATTCTGCGACAACCACCACAATCAACATGCCTGCTGAGATCT
CCACGCCTGACCACGTGGTCTGGTCCCTGTTCAATACGCTCTTCATGAACTTCTGCTGCCTGGG
CTTCATAGCGTATTCCTACTCTGTGAAGTCTAGGGACAGGAAGATGGTGGGTGATGTGACTGGG
GCCAAGACCTACGCCTCCACTGCCAAGTGCCTGAACATCAGCTCCGTGATTTTTACCATCCTCA
TGGCTATCCTCACGATCATTCTTTACGCCACTAAAAGAACATAGCCATCTTGCAGCACCTCACG
GTAGATAACAGATTCTGGGGCCTTCCAGTCTGCCCCAAACTCTAGTCTTAGTCCTGCCTGTTTA
CCCCACACATATGCAAATGTTATACTCACATGGCTGTTCATAGTGGATTCAATAAAATACATGT
GCTGCGACCTTCTGTCCCTGGACTAACCCTGT

hide sequence

RefSeq Acc Id:

XM_006230530 ⟹ XP_006230592

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	1	196,067,163 - 196,069,149 (+)	NCBI
Rnor_6.0	1	213,765,825 - 213,767,821 (+)	NCBI
Rnor_5.0	1	220,686,994 - 220,689,004 (+)	NCBI

Sequence:

show sequence

TAAAGGGACACAGAGGAAGGAAGTTACAGTCCGCCCCCACTCTCACTGGCTAGTTTATCTCTGC
TGCTCCAGAGATACTGGTGCCTACTTCTTCAGGATCCCAGCGTACCTTCTAGAACCTCCCTGGG
ACCCTAGCACCAAATTGAGACAGCTGTTTTTAGTCTTGTGGACGACTCCTAGATCCTGGGCCTT
TCTGTCAGGAGACGGCCATTGTAGGGCTCCTCGGACCAAGCCTCCTCAAAAGCCAAGAGATGCC
CAAGGAACAGCAAGAGGTGGTTATCCTGGGAGGACCCCACACCTCAACTTCTGCGACAACCACC
ACAATCAACATGCCTGCTGAGATCTCCACGCCTGACCACGTGGTCTGGTCCCTGTTCAATACGC
TCTTCATGAACTTCTGCTGCCTGGGCTTCATAGCGTATTCCTACTCTGTGAAGTCTAGGGACAG
GAAGATGGTGGGTGATGTGACTGGGGCCAAGACCTACGCCTCCACTGCCAAGTGCCTGAACATC
AGCTCCGTGATTTTTACCATCCTCATGGCTATCCTCACGATCATTCTTTACGCCACTAAAAGAA
CATAGCCATCTTGCAGCACCTCACGGTAGATAACAGATTCTGGGGCCTTCCAGTCTGCCCCAAA
CTCTAGTCTTAGTCCTGCCTGTTTACCCCACACATATGCAAATGTTATACTCACATGGCTGTTC
ATAGTGGATTCAATAAAATACATGTGCTGCGACCTTC

hide sequence

Protein Sequences


Protein RefSeqs	NP_001099784	(Get FASTA)	NCBI Sequence Viewer
	XP_006230592	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM11954	(Get FASTA)	NCBI Sequence Viewer
	EDM11955	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_001099784 ⟸ NM_001106314
- Sequence:	show sequence MPKEQQEVVILGGPHTSNSATTTTINMPAEISTPDHVVWSLFNTLFMNFCCLGFIAYSYSVKSR DRKMVGDVTGAKTYASTAKCLNISSVIFTILMAILTIILYATKRT hide sequence

RefSeq Acc Id:	XP_006230592 ⟸ XM_006230530
- Peptide Label:	isoform X1
- UniProtKB:	F1M3Q1 (UniProtKB/TrEMBL)
- Sequence:	show sequence MPKEQQEVVILGGPHTSTSATTTTINMPAEISTPDHVVWSLFNTLFMNFCCLGFIAYSYSVKSR DRKMVGDVTGAKTYASTAKCLNISSVIFTILMAILTIILYATKRT hide sequence

RefSeq Acc Id:

ENSRNOP00000042637 ⟸ ENSRNOT00000005645

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-F1M3Q1-F1-model_v2	AlphaFold	F1M3Q1	1-109	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13690524

Promoter ID:

EPDNEW_R1048

Type:

single initiation site

Name:

Ifitm1_1

Description:

interferon induced transmembrane protein 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	213,766,798 - 213,766,858	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1307601	AgrOrtholog
BioCyc Gene	G2FUF-56998	BioCyc
Ensembl Genes	ENSRNOG00000004273	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000042637	ENTREZGENE
	ENSRNOP00000042637.5	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000005645	ENTREZGENE
	ENSRNOT00000005645.7	UniProtKB/TrEMBL
InterPro	Interferon-induced_TM_protein	UniProtKB/TrEMBL
NCBI Gene	293618	ENTREZGENE
PANTHER	INTERFERON INDUCIBLE TRANSMEMBRANE PROTEIN	UniProtKB/TrEMBL
	INTERFERON-INDUCED TRANSMEMBRANE PROTEIN 1-RELATED	UniProtKB/TrEMBL
Pfam	CD225	UniProtKB/TrEMBL
PhenoGen	Ifitm1	PhenoGen
UniProt	F1M3Q1	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-04-30	Ifitm1	interferon induced transmembrane protein 1	Ifitm1_predicted	interferon induced transmembrane protein 1 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Ifitm1_predicted	interferon induced transmembrane protein 1 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD