Ciao1 (cytosolic iron-sulfur assembly component 1)

Advanced Search (OLGA)

Gene: Ciao1 (cytosolic iron-sulfur assembly component 1) Rattus norvegicus

Analyze

Symbol:

Ciao1

Name:

cytosolic iron-sulfur assembly component 1

RGD ID:

1307285

Description:

Predicted to be involved in iron-sulfur cluster assembly and protein maturation by iron-sulfur cluster transfer. Predicted to be located in cytoplasm. Predicted to be part of MMXD complex and cytosolic [4Fe-4S] assembly targeting complex. Orthologous to human CIAO1 (cytosolic iron-sulfur assembly component 1); PARTICIPATES IN cytosolic iron-sulfur cluster protein assembly pathway; INTERACTS WITH (S)-nicotine; 2,3,7,8-tetrachlorodibenzodioxine; 3H-1,2-dithiole-3-thione.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

cytosolic iron-sulfur protein assembly 1; cytosolic iron-sulfur protein assembly 1 homolog; cytosolic iron-sulfur protein assembly 1 homolog (S. cerevisiae); MGC95143; probable cytosolic iron-sulfur protein assembly protein CIAO1; WD repeat domain 39; WD repeat-containing protein 39; WD40 protein Ciao1; Wdr39

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CIAO1 (cytosolic iron-sulfur assembly component 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Ciao1 (cytosolic iron-sulfur protein assembly 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ciao1 (cytosolic iron-sulfur assembly component 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CIAO1 (cytosolic iron-sulfur assembly component 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CIAO1 (cytosolic iron-sulfur assembly component 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ciao1 (cytosolic iron-sulfur assembly component 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CIAO1 (cytosolic iron-sulfur assembly component 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CIAO1 (cytosolic iron-sulfur assembly component 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ciao1 (cytosolic iron-sulfur assembly component 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	SPIRE1 (spire type actin nucleation factor 1)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	CIAO1 (cytosolic iron-sulfur assembly component 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ciao1 (cytosolic iron-sulfur protein assembly 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ciao1 (cytosolic iron-sulfur assembly component 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	CIA1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Ciao1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	Y18D10A.9	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ciao1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	134,913,639 - 134,919,244 (-)	NCBI		GRCr8
mRatBN7.2	3	114,458,671 - 114,465,928 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	114,458,655 - 114,467,009 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	118,351,884 - 118,357,408 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	126,947,428 - 126,952,952 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	124,607,808 - 124,613,332 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	119,671,778 - 119,677,324 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	119,671,779 - 119,678,092 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	126,196,996 - 126,202,542 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	114,740,676 - 114,746,203 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	114,646,248 - 114,651,776 (-)	NCBI
Celera	3	113,300,999 - 113,306,382 (-)	NCBI		Celera
Cytogenetic Map	3	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

intellectual disability (ISO)

schizophrenia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(S)-nicotine (EXP)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3H-1,2-dithiole-3-thione (EXP)

5-fluorouracil (ISO)

9-cis-retinoic acid (EXP)

actinomycin D (ISO)

all-trans-retinoic acid (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

bexarotene (EXP)

bisphenol A (EXP)

clofibrate (ISO)

cobalt dichloride (ISO)

cocaine (EXP)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

diarsenic trioxide (ISO)

Dibutyl phosphate (ISO)

epoxiconazole (ISO)

flutamide (EXP)

folic acid (ISO)

ivermectin (ISO)

nicotine (EXP)

Nutlin-3 (ISO)

perfluorohexanesulfonic acid (ISO)

pregnenolone 16alpha-carbonitrile (EXP)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (ISO)

thiram (ISO)

titanium dioxide (ISO)

triphenyl phosphate (ISO)

triptonide (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

chromosome segregation (IEA)

iron-sulfur cluster assembly (IBA,IEA,ISO,ISS)

protein maturation by iron-sulfur cluster transfer (IEA,ISO,ISS)

Cellular Component

cytoplasm (ISO,ISS)

cytosolic [4Fe-4S] assembly targeting complex (IBA,IEA,ISO,ISS)

MMXD complex (IEA,ISO,ISS)

Molecular Function

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

cytosolic iron-sulfur cluster protein assembly pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Iron-sulfur cluster biogenesis in mammalian cells: New insights into the molecular mechanisms of cluster delivery.	Maio N and Rouault TA, Biochim Biophys Acta. 2015 Jun;1853(6):1493-512. doi: 10.1016/j.bbamcr.2014.09.009. Epub 2014 Sep 19.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Biogenesis of cytosolic and nuclear iron-sulfur proteins and their role in genome stability.	Paul VD and Lill R, Biochim Biophys Acta. 2015 Jun;1853(6):1528-39. doi: 10.1016/j.bbamcr.2014.12.018. Epub 2015 Jan 10.
5.	GOA pipeline	RGD automated data pipeline
6.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:15489334	PMID:17937914	PMID:20797633	PMID:22678361	PMID:22678362	PMID:23585563	PMID:23891004

Genomics

Comparative Map Data

Ciao1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	134,913,639 - 134,919,244 (-)	NCBI		GRCr8
mRatBN7.2	3	114,458,671 - 114,465,928 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	114,458,655 - 114,467,009 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	118,351,884 - 118,357,408 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	126,947,428 - 126,952,952 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	124,607,808 - 124,613,332 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	119,671,778 - 119,677,324 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	119,671,779 - 119,678,092 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	126,196,996 - 126,202,542 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	114,740,676 - 114,746,203 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	114,646,248 - 114,651,776 (-)	NCBI
Celera	3	113,300,999 - 113,306,382 (-)	NCBI		Celera
Cytogenetic Map	3	q36	NCBI

CIAO1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	96,266,225 - 96,274,173 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	96,266,159 - 96,274,173 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	96,931,963 - 96,939,911 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	96,295,611 - 96,303,644 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	2	96,353,757 - 96,361,786	NCBI
Celera	2	91,373,072 - 91,381,105 (+)	NCBI		Celera
Cytogenetic Map	2	q11.2	NCBI
HuRef	2	90,893,381 - 90,901,414 (+)	NCBI		HuRef
CHM1_1	2	96,936,239 - 96,944,254 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	2	96,772,833 - 96,780,781 (+)	NCBI		T2T-CHM13v2.0

Ciao1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	127,082,858 - 127,089,736 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	127,082,858 - 127,089,736 (-)	Ensembl		GRCm39 Ensembl
GRCm38	2	127,240,938 - 127,247,816 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	127,240,938 - 127,247,816 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	127,066,674 - 127,073,552 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	126,932,379 - 126,939,183 (-)	NCBI		MGSCv36	mm8
Celera	2	128,480,303 - 128,487,188 (-)	NCBI		Celera
Cytogenetic Map	2	F1	NCBI
cM Map	2	61.86	NCBI

Ciao1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955470	3,822,582 - 3,828,563 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955470	3,822,606 - 3,828,563 (+)	NCBI	ChiLan1.0	ChiLan1.0

CIAO1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	12	32,034,666 - 32,042,638 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2A	32,037,475 - 32,045,398 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2A	103,041,509 - 103,049,469 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2A	97,189,246 - 97,194,576 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2A	97,188,949 - 97,194,576 (+)	Ensembl	panpan1.1		panPan2

CIAO1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	17	34,507,136 - 34,512,566 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	17	34,508,662 - 34,512,486 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	17	34,277,047 - 34,282,512 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	17	35,278,219 - 35,283,798 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	17	35,278,225 - 35,283,748 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	17	34,407,476 - 34,412,941 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	17	34,476,119 - 34,481,585 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	17	34,682,825 - 34,688,404 (-)	NCBI		UU_Cfam_GSD_1.0

Ciao1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024406292	83,106,283 - 83,111,710 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936744	359,258 - 363,585 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936744	359,234 - 364,649 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CIAO1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	46,960,881 - 46,966,635 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	46,960,880 - 46,967,003 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	49,102,770 - 49,108,598 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CIAO1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	14	685,378 - 690,752 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	14	685,321 - 690,544 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666041	168,111,923 - 168,117,714 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ciao1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624749	2,344,743 - 2,351,358 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624749	2,344,833 - 2,350,986 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Ciao1
40 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	47
Count of miRNA genes:	43
Interacting mature miRNAs:	47
Transcripts:	ENSRNOT00000017603
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2312673	Scl63	Serum cholesterol level QTL 63		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	98535255	168026850	Rat
2301414	Kidm37	Kidney mass QTL 37		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	70653097	121056321	Rat
1582238	Bw68	Body weight QTL 68	3.2	0.0064	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
2302373	Gluco39	Glucose level QTL 39	5.01		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	3	98535386	161695835	Rat
1582239	Epfw1	Epididymal fat weight QTL 1	4.5	0.0006	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	3	53184593	115665732	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	47233211	147415807	Rat
1358362	Srcrt2	Stress Responsive Cort QTL 2	2.78		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	38192233	133483320	Rat
1582216	Bw65	Body weight QTL 65	6.3		body mass (VT:0001259)	body weight (CMO:0000012)	3	102200529	115665732	Rat
737818	Hcar12	Hepatocarcinoma resistance QTL 12	2.6		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	3	29463235	118376539	Rat
1582218	Bw74	Body weight QTL 74	3.9	0.0021	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
1582219	Bw63	Body weight QTL 63	3.8	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	3	96127817	115665732	Rat
1582221	Kidm30	Kidney mass QTL 30	3.5	0.0008	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	3	64655305	115665732	Rat
1581568	Rf53	Renal function QTL 53			urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	3	56395968	161299569	Rat
1582210	Bw71	Body weight QTL 71	3.3	0.0012	body mass (VT:0001259)	body weight (CMO:0000012)	3	64655305	115665732	Rat
1578754	Stresp16	Stress response QTL 16	4	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	3	112681431	157681431	Rat
1300111	Rf12	Renal function QTL 12	3.78		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	61017749	121056321	Rat
724523	Tsu1	Thymus enlargement suppressive QTL 1	3.84		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	3	50437504	115638231	Rat
1600376	Arunc5	Aerobic running capacity QTL 5		0.21	exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	3	73376539	118376539	Rat
8694437	Bw167	Body weight QTL 167	22.46	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	3	91797474	136797474	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	59242096	157323038	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
1581503	Cm58	Cardiac mass QTL 58	2.7	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	43827364	121056321	Rat
1354611	Despr2	Despair related QTL 2	3.03	0.0028	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	3	97084464	142084464	Rat
631649	Bp123	Blood pressure QTL 123	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	89772419	134772419	Rat
631841	Niddm39	Non-insulin dependent diabetes mellitus QTL 39	3.36		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	94856903	159898684	Rat
619618	Rf3	Renal disease susceptibility QTL 3	6.5	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate to body weight ratio (CMO:0001270)	3	107693393	152693393	Rat
12879848	Bw181	Body weght QTL 181		0.015	body mass (VT:0001259)	body weight (CMO:0000012)	3	70348525	121056321	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	41874578	155617519	Rat
2312659	Slep7	Serum leptin concentration QTL 7		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	3	98535255	168026850	Rat
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	41874578	155617519	Rat
1581546	Pur13	Proteinuria QTL 13	2.93	0.0335	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	3	78196190	146592722	Rat
631665	Bw8	Body weight QTL 8	5.5		body mass (VT:0001259)	body weight (CMO:0000012)	3	50437042	119183768	Rat
1331758	Bp207	Blood pressure QTL 207	2.848		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	112287552	135181505	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
2293087	Iddm27	Insulin dependent diabetes mellitus QTL 27	2.68		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	97551417	147415807	Rat
2312670	Bw94	Body weight QTL 94		0.01	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	3	98535255	168026850	Rat
724532	Cm17	Cardiac mass QTL 17	2		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	3	95735366	140735366	Rat

Markers in Region

RH128407

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	114,460,510 - 114,460,725 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	119,671,968 - 119,672,182	NCBI	Rnor6.0
Rnor_5.0	3	126,197,186 - 126,197,400	UniSTS	Rnor5.0
RGSC_v3.4	3	114,740,866 - 114,741,080	UniSTS	RGSC3.4
Celera	3	113,301,189 - 113,301,403	UniSTS
Cytogenetic Map	3	q35	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001008766	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039104428	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010064575	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC088474	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473949	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214368	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221650	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ230934	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ231672	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000017603 ⟹ ENSRNOP00000017603

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	114,460,321 - 114,465,888 (-)	Ensembl
Rnor_6.0 Ensembl	3	119,671,779 - 119,677,324 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000085562 ⟹ ENSRNOP00000069601

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	114,460,322 - 114,467,009 (-)	Ensembl
Rnor_6.0 Ensembl	3	119,671,921 - 119,678,092 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000103470 ⟹ ENSRNOP00000085618

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	114,460,465 - 114,465,917 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000109294 ⟹ ENSRNOP00000097207

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	114,464,380 - 114,465,888 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000113397 ⟹ ENSRNOP00000089224

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	114,460,468 - 114,465,872 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000117707 ⟹ ENSRNOP00000091185

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	114,458,655 - 114,465,888 (-)	Ensembl

RefSeq Acc Id:

NM_001008766 ⟹ NP_001008766

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	134,913,639 - 134,919,166 (-)	NCBI
mRatBN7.2	3	114,460,321 - 114,465,850 (-)	NCBI
Rnor_6.0	3	119,671,778 - 119,677,324 (-)	NCBI
Rnor_5.0	3	126,196,996 - 126,202,542 (-)	NCBI
RGSC_v3.4	3	114,740,676 - 114,746,203 (-)	RGD
Celera	3	113,300,999 - 113,306,382 (-)	RGD

Sequence:

show sequence

GGGTCCTATAGTGGCCAGTGGGTTCTGCGCGTTGCTTCTCTTGGCATCTTCCTTCCTCATCCTA
AAACAGTCACCATGAAGGATGCGCTGGTACTGCAGAGCCGCGTCCCGGCGCACCCGGATTCCCG
CTGCTGGTTCCTGGCCTGGAACCCCACGGGAACCTTGTTGGCCTCATGCGGAGGCGACCGTAAA
ATTCGCATCTGGGGCACCGAGGGTGACAGCTGGATTTGCAAGTCTGTCCTTTCTGAAGGCCATC
AGCGCACCGTTAGGAAAGTGGCCTGGTCCCCCTGTGGAAATTACCTGGCATCTGCCAGCTTTGA
TGCTACTACTTGCATTTGGAAGAAGAACCAGGATGACTTTGAGTGTGTGACCACTCTTGAGGGT
CATGAGAATGAGGTCAAGTCAGTGGCTTGGGCCCCATCTGGCAACCTCTTGGCTACCTGCAGCA
GAGATAAGAGCGTGTGGGTCTGGGAAGTTGATGAAGAAGATGAGTATGAATGCGTCAGTGTCCT
CAATTCTCACACACAGGATGTTAAGCATGTGGTTTGGCACCCAAGCCAGGAGCTTTTAGCTTCT
GCTAGCTATGATGACACAGTGAAGCTATACCAGGAAGAAGGGGATGACTGGGTCTGCTGTGCTA
CCCTTGAAGGTCACGAGTCCACTGTATGGAGCATAGCCTTTGATCCCAGCGGCCAGCGTCTGGC
ATCTTGCAGTGATGACCGAACTGTGCGCATCTGGCGCCAGTATCTACCTGGCAATGAACAAGGG
GTGGCATGCAGTGGCTCCGACCCCAGCTGGAAATGTGTTTGCACTTTGTCGGGCTTCCATACCA
GGACCATCTACGACGTTGCTTGGTGTCAGCTGACAGGGGCCCTGGCTACAGCTTGTGGAGATGA
TGCCATCCGAGTGTTTGAGGAAGATCCAGGCTCAGACCCACAGCAGCCCACCTTCTCTTTGACA
GCCCATCTTCGTCAGGCCCATTCCCAGGATGTCAACTGTGTGGCTTGGAACCCCAAGGAGGCAG
GGCTCCTGGCCTCTTGTAGTGATGATGGGGAGGTAGCCTTCTGGGAGTATCATCAGCCTGCAGG
TCTCTGAGCTGCAGCTTGACTTGGGGATCTTGATTCCCACAGAAAATGTCCTAAGACTTTTCCT
AGTCACTGAGAAGACCTGAAGCATCCTTGACTTTCATTTAGCTCAGGACCATTCACTGTTTCCT
TTGATGTGAGAAAGCCATTGGCAGAGCCACGGAACAGCAGAATATTAAATATTTAATATTTAAT
ATTAAATATTAAAGTTTTGCTTGATTTAGGGCAGGTGTTACATTTTGGGGGTAAATATATTTAT
AAAATATAATCAGTATATATGTATGAATGAATGTTTGAGAACTTTTGAAATTGTGAGCTTTATA
GAAATAATCCATCTGTGCCGCAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039104428 ⟹ XP_038960356

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	134,913,639 - 134,919,242 (-)	NCBI
mRatBN7.2	3	114,458,671 - 114,465,927 (-)	NCBI

RefSeq Acc Id:

XR_010064575

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	134,916,620 - 134,919,244 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001008766	(Get FASTA)	NCBI Sequence Viewer
	XP_038960356	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH88474	(Get FASTA)	NCBI Sequence Viewer
	EDL80106	(Get FASTA)	NCBI Sequence Viewer
	EDL80107	(Get FASTA)	NCBI Sequence Viewer
	EDL80108	(Get FASTA)	NCBI Sequence Viewer
	EDL80109	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000017603.4
	ENSRNOP00000069601.1
	ENSRNOP00000085618.1
	ENSRNOP00000089224.1
	ENSRNOP00000091185.1
	ENSRNOP00000097207.1
	ENSRNOP00055006525
	ENSRNOP00060020108
	ENSRNOP00065016338
GenBank Protein	Q5M7T1	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001008766 ⟸ NM_001008766

- UniProtKB:

Q5M7T1 (UniProtKB/Swiss-Prot), A6HQ07 (UniProtKB/TrEMBL), A0A8L2UJ40 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MKDALVLQSRVPAHPDSRCWFLAWNPTGTLLASCGGDRKIRIWGTEGDSWICKSVLSEGHQRTV
RKVAWSPCGNYLASASFDATTCIWKKNQDDFECVTTLEGHENEVKSVAWAPSGNLLATCSRDKS
VWVWEVDEEDEYECVSVLNSHTQDVKHVVWHPSQELLASASYDDTVKLYQEEGDDWVCCATLEG
HESTVWSIAFDPSGQRLASCSDDRTVRIWRQYLPGNEQGVACSGSDPSWKCVCTLSGFHTRTIY
DVAWCQLTGALATACGDDAIRVFEEDPGSDPQQPTFSLTAHLRQAHSQDVNCVAWNPKEAGLLA
SCSDDGEVAFWEYHQPAGL

hide sequence

Ensembl Acc Id:

ENSRNOP00000069601 ⟸ ENSRNOT00000085562

Ensembl Acc Id:

ENSRNOP00000017603 ⟸ ENSRNOT00000017603

RefSeq Acc Id:	XP_038960356 ⟸ XM_039104428
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I6A7Q2 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000091185 ⟸ ENSRNOT00000117707

Ensembl Acc Id:

ENSRNOP00000097207 ⟸ ENSRNOT00000109294

Ensembl Acc Id:

ENSRNOP00000085618 ⟸ ENSRNOT00000103470

Ensembl Acc Id:

ENSRNOP00000089224 ⟸ ENSRNOT00000113397

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5M7T1-F1-model_v2	AlphaFold	Q5M7T1	1-339	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692399

Promoter ID:

EPDNEW_R2924

Type:

initiation region

Name:

Ciao1_1

Description:

cytosolic iron-sulfur assembly component 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	119,677,336 - 119,677,396	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1307285	AgrOrtholog
BioCyc Gene	G2FUF-48000	BioCyc
Ensembl Genes	ENSRNOG00000012638	Ensembl, UniProtKB/TrEMBL
	ENSRNOG00055005334	UniProtKB/Swiss-Prot
	ENSRNOG00060014702	UniProtKB/Swiss-Prot
	ENSRNOG00065012925	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000017603.6	UniProtKB/TrEMBL
	ENSRNOT00000085562.2	UniProtKB/TrEMBL
	ENSRNOT00000103470.1	UniProtKB/TrEMBL
	ENSRNOT00000109294.1	UniProtKB/TrEMBL
	ENSRNOT00000113397.1	UniProtKB/TrEMBL
	ENSRNOT00000117707.1	UniProtKB/TrEMBL
	ENSRNOT00055008619	UniProtKB/Swiss-Prot
	ENSRNOT00060025234	UniProtKB/Swiss-Prot
	ENSRNOT00065021174	UniProtKB/Swiss-Prot
Gene3D-CATH	2.130.10.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7129030	IMAGE-MGC_LOAD
InterPro	CIAO1/Cia1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	G-protein_beta_WD-40_rep	UniProtKB/TrEMBL
	WD40/YVTN_repeat-like_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	WD40_repeat	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	WD40_repeat_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	WD40_repeat_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:29231	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:95143	IMAGE-MGC_LOAD
NCBI Gene	29231	ENTREZGENE
PANTHER	CYTOSOLIC IRON-SULFUR PROTEIN ASSEMBLY PROTEIN CIAO1-RELATED	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR19920	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	WD40	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Ciao1	PhenoGen
PRINTS	GPROTEINBRPT	UniProtKB/TrEMBL
PROSITE	PROKAR_LIPOPROTEIN	UniProtKB/TrEMBL
	WD_REPEATS_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	WD_REPEATS_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	WD_REPEATS_REGION	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000012638	RatGTEx
	ENSRNOG00055005334	RatGTEx
	ENSRNOG00060014702	RatGTEx
	ENSRNOG00065012925	RatGTEx
SMART	WD40	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF50978	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A0G2JVS7_RAT	UniProtKB/TrEMBL
	A0A8I6A3R5_RAT	UniProtKB/TrEMBL
	A0A8I6A7Q2	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6AE05_RAT	UniProtKB/TrEMBL
	A0A8I6AR63_RAT	UniProtKB/TrEMBL
	A0A8L2UJ40	ENTREZGENE, UniProtKB/TrEMBL
	A6HQ07	ENTREZGENE, UniProtKB/TrEMBL
	CIAO1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2014-01-23	Ciao1	cytosolic iron-sulfur assembly component 1	Ciao1	cytosolic iron-sulfur protein assembly 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2011-08-01	Ciao1	cytosolic iron-sulfur protein assembly 1	Ciao1	cytosolic iron-sulfur protein assembly 1 homolog (S. cerevisiae)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-04	Ciao1	cytosolic iron-sulfur protein assembly 1 homolog (S. cerevisiae)	Wdr39	WD repeat domain 39	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Wdr39	WD repeat domain 39	Ciao1	WD40 protein Ciao1	Symbol and Name updated	1299863	APPROVED
2005-12-06	Ciao1	WD40 protein Ciao1	Ciao1_predicted	WD40 protein Ciao1 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Ciao1_predicted	WD40 protein Ciao1 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

RGD Manual Annotations